F476232

General Info

Members Datasets Scaffolds Average Seq Length
702 592 246 420

Family's Representative Sequence

Representative Sequence 3300046460|Ga0495638_0026738|Ga0495638_0026738_840_2231
Length 463
Sequence MASRIGQKEAWNPYKLYRLTPEFFCAMTPEQLKAEGDVMPRTLIHAAAIMLAGGISLMAATAHAATDPAAVVKHYAELGHAKYEDALTTAKALDVAIDAFLAAPSEETQKAAKAAWIKARVPYQQTEAYRFGNSIVDDWEGKVNAWPLDEGLIDYVDKAYGTESDENEQYVLNVIANPKFSIGGKEIDATGITPELLESTLQEANETESNVATGYHAIEFLLWGQDLNGTGPGAGTRSYTDYDLKNCTNGNCDRRAAYLKAASSLLVTDLEYMVKQWAPDGEAAKAVTSDPTKGISAMLTGMGSLSYGELAGERMKLGLLLHDPEEEHDCFSDNTFNSHLNDAIGIQGVYTGKYTRADGTEMTGPSLSALVAEKDAAVDKELTGKLDTTIAAMQAMAKRGETVEAYDQMIGDGNAEGNKVVQAAIDGLVDQTKSIERAISALNLGKIELEGSDSLDNPAAVGK

Samples

Sample ID Description Type Environment
1 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
2 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
3 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
4 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
5 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
6 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
7 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
8 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
9 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
10 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
11 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
12 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
13 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
14 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
15 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
16 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
17 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
18 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
19 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
20 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
21 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
22 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
23 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
24 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
25 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
26 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
27 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
28 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
29 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
30 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
31 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
32 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
33 2516143018 Ensifer sp. BR816 Isolate Nodule
34 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
35 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
36 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
37 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
38 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
39 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
40 2519899620 Rhizobium sp. Pop5 Isolate Nodule
41 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
42 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
43 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
44 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
45 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
46 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
47 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
48 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
49 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
50 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
51 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
52 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
53 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
54 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
55 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
56 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
57 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
58 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
59 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
60 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
61 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
62 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
63 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
64 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
65 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
66 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
67 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
68 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
69 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
70 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
71 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
72 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
73 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
74 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
75 2643221557 Ensifer sp. Root558 Isolate Unclassified
76 2643221569 Achromobacter sp. Root565 Isolate Unclassified
77 2643221580 Devosia sp. Root635 Isolate Unclassified
78 2643221591 Devosia sp. Root685 Isolate Unclassified
79 2643221594 Achromobacter sp. Root170 Isolate Unclassified
80 2643221599 Rhizobium sp. Root708 Isolate Unclassified
81 2643221607 Rhizobium sp. Root73 Isolate Unclassified
82 2643221610 Ensifer sp. Root74 Isolate Unclassified
83 2643221621 Achromobacter sp. Root83 Isolate Unclassified
84 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
85 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
86 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
87 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
88 2643221668 Ensifer sp. Root423 Isolate Unclassified
89 2643221674 Devosia sp. Root436 Isolate Unclassified
90 2643221675 Ensifer sp. Root1298 Isolate Unclassified
91 2643221680 Ensifer sp. Root1312 Isolate Unclassified
92 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
93 2643221688 Rhizobium sp. Root482 Isolate Unclassified
94 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
95 2643221718 Rhizobium sp. Root268 Isolate Unclassified
96 2643221723 Ensifer sp. Root278 Isolate Unclassified
97 2643221726 Ensifer sp. Root954 Isolate Unclassified
98 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
99 2713897090 Paracoccus sphaerophysae HAMBI 3106 Isolate Nodule
100 2718217882 Rhizobium sp. N741 Isolate Nodule
101 2718217927 Rhizobium sp. N324 Isolate Nodule
102 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
103 2718218009 Rhizobium sp. N561 Isolate Nodule
104 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
105 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
106 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
107 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
108 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
109 2718218363 Rhizobium sp. N113 Isolate Nodule
110 2718218365 Rhizobium sp. N731 Isolate Nodule
111 2718218366 Rhizobium sp. N621 Isolate Nodule
112 2718218423 Rhizobium sp. N941 Isolate Nodule
113 2721755514 Rhizobium sp. N6212 Isolate Nodule
114 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
115 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
116 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
117 2721755809 Rhizobium sp. N541 Isolate Nodule
118 2721755810 Rhizobium sp. N871 Isolate Nodule
119 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
120 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
121 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
122 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
123 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
124 2728369365 Rhizobium sp. N1341 Isolate Nodule
125 2728369397 Rhizobium sp. N1314 Isolate Nodule
126 2738541293 Rhizobium sp. GV031 Isolate Unclassified
127 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
128 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
129 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
130 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
131 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
132 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
133 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
134 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
135 2791355256 Rhizobium sp. M10 Isolate Nodule
136 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
137 2791355260 Rhizobium sp. L9 Isolate Nodule
138 2791355261 Rhizobium sp. J15 Isolate Nodule
139 2791355262 Rhizobium sp. M1 Isolate Nodule
140 2791355263 Rhizobium chutanense C5 Isolate Nodule
141 2791355264 Rhizobium sp. S9 Isolate Nodule
142 2791355265 Rhizobium sp. H4 Isolate Nodule
143 2791355266 Rhizobium sp. L43 Isolate Nodule
144 2791355267 Rhizobium sp. L18 Isolate Nodule
145 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
146 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
147 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
148 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
149 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
150 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
151 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
152 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
153 2802429633 Rhizobium anhuiense J3 Isolate Nodule
154 2802429634 Rhizobium anhuiense S10 Isolate Nodule
155 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
156 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
157 2802429637 Rhizobium anhuiense C15 Isolate Nodule
158 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
159 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
160 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
161 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
162 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
163 2838048938 Rhizobium pisi 27/80 Isolate Nodule
164 2838061910 Rhizobium phaseoli L15 Isolate Nodule
165 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
166 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
167 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
168 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
169 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
170 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
171 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
172 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
173 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
174 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
175 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
176 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
177 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
178 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
179 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
180 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
181 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
182 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
183 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
184 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
185 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
186 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
187 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
188 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
189 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
190 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
191 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
192 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
193 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
194 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
195 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
196 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
197 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
198 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
199 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
200 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
201 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
202 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
203 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
204 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
205 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
206 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
207 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
208 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
209 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
210 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
211 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
212 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
213 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
214 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
215 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
216 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
217 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
218 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
219 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
220 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
221 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
222 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
223 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
224 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
225 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
226 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
227 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
228 2858950400 Achromobacter sp. K91 Isolate Unclassified
229 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
230 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
231 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
232 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
233 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
234 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
235 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
236 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
237 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
238 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
239 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
240 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
241 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
242 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
243 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
244 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
245 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
246 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
247 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
248 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
249 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
250 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
251 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
252 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
253 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
254 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
255 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
256 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
257 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
258 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
259 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
260 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
261 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
262 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
263 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
264 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
265 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
266 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
267 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
268 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
269 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
270 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
271 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
272 2932401849 Devosia sp. 2618 Isolate Rhizosphere
273 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
274 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
275 2933599457 Rhizobium phaseoli M3 Isolate Nodule
276 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
277 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
278 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
279 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
280 2936381700 Rhizobium chutanense C16 Isolate Unclassified
281 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
282 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
283 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
284 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
285 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
286 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
287 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
288 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
289 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
290 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
291 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
292 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
293 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
294 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
295 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
296 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
297 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
298 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
299 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
300 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
301 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
302 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
303 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
304 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
305 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
306 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
307 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
308 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
309 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
310 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
311 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
312 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
313 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
314 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
315 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
316 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
317 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
318 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
319 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
320 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
321 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
322 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
323 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
324 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
325 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
326 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
327 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
328 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
329 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
330 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
331 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
332 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
333 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
334 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
335 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
336 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
337 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
338 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
339 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
340 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
341 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
342 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
343 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
344 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
345 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
346 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
347 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
348 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
349 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
350 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
351 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
352 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
353 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
354 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
355 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
356 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
357 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
358 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
359 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
360 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
361 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
362 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
363 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
364 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
365 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
366 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
367 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
368 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
369 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
370 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
371 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
372 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
373 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
374 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
375 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
376 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
377 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
378 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
379 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
380 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
381 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
382 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
383 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
384 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
385 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
386 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
387 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
388 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
389 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
390 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
391 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
392 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
393 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
394 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
395 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
396 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
397 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
398 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
399 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
400 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
401 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
402 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
403 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
404 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
405 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
406 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
407 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
408 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
409 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
410 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
411 2996887358 Rhizobium sp. R711 Isolate Nodule
412 2996893221 Rhizobium sp. R635 Isolate Nodule
413 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
414 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
415 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
416 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
417 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
418 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
419 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
420 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
421 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
422 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
423 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
424 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
425 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
426 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
427 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
428 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
429 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
430 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
431 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
432 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
433 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
434 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
435 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
436 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
437 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
438 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
439 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
440 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
441 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
442 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
443 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
444 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
445 3300009763 Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix Metagenome Nodule
446 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
447 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
448 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
449 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
450 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
451 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
452 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
453 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
454 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
455 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
456 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
457 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
458 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
459 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
460 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
461 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
462 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
463 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
464 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
465 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
466 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
467 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
468 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
469 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
470 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
471 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
472 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
473 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
474 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
475 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
476 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
477 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
478 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
479 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
480 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
481 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
482 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
483 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
484 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
485 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
486 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
487 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
488 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
489 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
490 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
491 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
492 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
493 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
494 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
495 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
496 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
497 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
498 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
499 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
500 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
501 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
502 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
503 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
504 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
505 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
506 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
507 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
508 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
509 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
510 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
511 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
512 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
513 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
514 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
515 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
516 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
517 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
518 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
519 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
520 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
521 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
522 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
523 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
524 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
525 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
526 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
527 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
528 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
529 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
530 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
531 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
532 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
533 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
534 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
535 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
536 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
537 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
538 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
539 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
540 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
541 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
542 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
543 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
544 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
545 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
546 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
547 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
548 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
549 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
550 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
551 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
552 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
553 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
554 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
555 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
556 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
557 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
558 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
559 8005258706 Rhizobium sp. R693 Isolate Nodule
560 8005275841 Rhizobium sp. N4311 Isolate Nodule
561 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
562 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
563 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
564 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
565 8005321885 Rhizobium sp. R72 Isolate Nodule
566 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
567 8005382845 Rhizobium sp. R634 Isolate Nodule
568 8005395548 Rhizobium sp. R339 Isolate Nodule
569 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
570 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
571 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
572 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
573 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
574 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
575 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
576 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
577 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
578 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
579 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
580 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
581 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
582 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
583 8018176218 Rhizobium sp. N122 Isolate Nodule
584 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
585 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
586 8024501048 Rhizobium sp. H4 Isolate Nodule
587 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
588 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
589 8056382006 Rhizobium croatiense 13T Isolate Nodule
590 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
591 8057132660 Paracoccus rhizosphaerae LMG 21293 Isolate Rhizosphere
592 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 34.9
Metatranscriptomes 0.14
Isolates 64.96

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.95
Nodule 54.84
Rhizoplane 1.28
Rhizosphere 13.96
Stem 0
Stem Tuber 0
Unclassified 13.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1001611 3300002773 Bacteria 9437
2 JGI25152J39213_1002582 3300002773 Bacteria 6766
3 JGI25152J39213_1003990 3300002773 Bacteria 4817
4 JGI25150J39212_1000064 3300002774 Bacteria 64002
5 JGI25159J45721_1000015 3300002987 Bacteria 142431
6 JGI25151J46595_10000242 3300003187 Bacteria 64028
7 JGI25151J46595_10000278 3300003187 Bacteria 58449
8 JGI25153J46596_10001280 3300003215 Bacteria 15099
9 JGI25153J46596_10003865 3300003215 Bacteria 8237
10 JGI25153J46596_10017954 3300003215 Bacteria 2766
11 JGI25160J50197_1000003 3300003354 Bacteria 482719
12 JGI25160J50197_1001559 3300003354 Bacteria 11318
13 JGI25161J50226_1000219 3300003374 Bacteria 35426
14 JGI25161J50226_1000229 3300003374 Bacteria 34236
15 Ga0055526_1000858 3300003771 Bacteria 22642
16 Ga0055526_1005467 3300003771 Bacteria 7294
17 Ga0055526_1009373 3300003771 Bacteria 4719
18 Ga0055524_1003177 3300003775 Bacteria 8079
19 Ga0055524_1004718 3300003775 Bacteria 6244
20 Ga0055524_1005580 3300003775 Bacteria 5589
21 Ga0055524_1005604 3300003775 Bacteria 5575
22 Ga0055524_1009805 3300003775 Bacteria 3863
23 Ga0055528_1000454 3300003790 Bacteria 32651
24 Ga0055528_1000622 3300003790 Bacteria 26376
25 Ga0055528_1002653 3300003790 Bacteria 9442
26 Ga0055528_1006382 3300003790 Bacteria 5353
27 Ga0055528_1024480 3300003790 Bacteria 1807
28 Ga0055540_1000797 3300003792 Bacteria 21342
29 Ga0055531_10016836 3300003794 Bacteria 3126
30 Ga0055543_1000034 3300004625 Bacteria 128668
31 Ga0055543_1000105 3300004625 Bacteria 73426
32 Ga0055543_1001402 3300004625 Bacteria 9583
33 Ga0065165_1000025 3300005262 Bacteria 246909
34 Ga0065165_1006563 3300005262 Bacteria 6059
35 Ga0070683_100057641 3300005329 Bacteria 3609
36 Ga0070666_10045013 3300005335 Bacteria 2958
37 Ga0070674_100126581 3300005356 Bacteria 1899
38 Ga0068857_100010337 3300005577 Bacteria 8108
39 Ga0081455_10003244 3300005937 Bacteria 18830
40 Ga0075365_10000983 3300006038 Bacteria 12147
41 Ga0075368_10020337 3300006042 Bacteria 2513
42 Ga0075363_100005718 3300006048 Bacteria 5572
43 Ga0075367_10005124 3300006178 Bacteria 6469
44 Ga0075369_10057344 3300006186 Bacteria 1694
45 Ga0075370_10010819 3300006353 Bacteria 4782
46 Ga0075370_10035491 3300006353 Bacteria 2798
47 Ga0075431_100149348 3300006847 Bacteria 2407
48 Ga0079104_1002193 3300006946 Bacteria 11005
49 Ga0105248_10006903 3300009177 Bacteria 12443
50 Ga0123340_1036039 3300009763 Bacteria 2608
51 Ga0123341_1000024 3300009765 Bacteria 73026
52 Ga0123341_1057399 3300009765 Bacteria 2005
53 Ga0123342_1011229 3300009766 Bacteria 9889
54 Ga0123342_1018459 3300009766 Bacteria 5546
55 Ga0171463_1001 3300013249 Bacteria 1406070
56 Ga0163163_10178111 3300014325 Bacteria 2173
57 Ga0183363_1038 3300015690 Bacteria 43720
58 Ga0214544_1006450 3300021320 Bacteria 21631
59 Ga0214542_1000029 3300021321 Bacteria 174097
60 Ga0214543_1000040 3300021327 Bacteria 174142
61 Ga0228711_1003057 3300022739 Bacteria 25943
62 Ga0228710_1000004 3300022740 Bacteria 250560
63 Ga0209436_100113 3300025208 Bacteria 39873
64 Ga0207425_1000139 3300025245 Bacteria 64086
65 Ga0207425_1000470 3300025245 Bacteria 25566
66 Ga0207425_1016087 3300025245 Bacteria 1666
67 Ga0209148_1000268 3300025254 Bacteria 81728
68 Ga0209129_1000066 3300025258 Bacteria 226820
69 Ga0209129_1000223 3300025258 Bacteria 64086
70 Ga0209129_1001237 3300025258 Bacteria 14652
71 Ga0209129_1001838 3300025258 Bacteria 11245
72 Ga0209129_1002820 3300025258 Bacteria 8065
73 Ga0209129_1003106 3300025258 Bacteria 7469
74 Ga0209129_1003118 3300025258 Bacteria 7456
75 Ga0209455_1000617 3300025272 Bacteria 22458
76 Ga0209673_1000024 3300025273 Bacteria 409632
77 Ga0209673_1000135 3300025273 Bacteria 160333
78 Ga0209673_1000378 3300025273 Bacteria 80351
79 Ga0209673_1000906 3300025273 Bacteria 37927
80 Ga0209673_1000988 3300025273 Bacteria 34774
81 Ga0209673_1005713 3300025273 Bacteria 6201
82 Ga0209130_1000002 3300025284 Bacteria 722648
83 Ga0209130_1000005 3300025284 Bacteria 599620
84 Ga0209676_1006401 3300025292 Bacteria 5822
85 Ga0209676_1014920 3300025292 Bacteria 2889
86 Ga0209025_1000105 3300025294 Bacteria 224157
87 Ga0209025_1000235 3300025294 Bacteria 129981
88 Ga0209025_1000557 3300025294 Bacteria 69226
89 Ga0209025_1000612 3300025294 Bacteria 64088
90 Ga0209025_1000866 3300025294 Bacteria 47843
91 Ga0209025_1013668 3300025294 Bacteria 5076
92 Ga0209025_1016133 3300025294 Bacteria 4441
93 Ga0209025_1024523 3300025294 Bacteria 3107
94 Ga0209025_1036655 3300025294 Bacteria 2191
95 Ga0209025_1043031 3300025294 Bacteria 1910
96 Ga0209564_1000113 3300025295 Bacteria 211564
97 Ga0209564_1000138 3300025295 Bacteria 181512
98 Ga0209564_1000683 3300025295 Bacteria 50090
99 Ga0209564_1001075 3300025295 Bacteria 32804
100 Ga0209758_1000495 3300025297 Bacteria 64088
101 Ga0209758_1000786 3300025297 Bacteria 45428
102 Ga0209758_1001165 3300025297 Bacteria 33420
103 Ga0209758_1001945 3300025297 Bacteria 22393
104 Ga0209758_1003289 3300025297 Bacteria 14977
105 Ga0209758_1004173 3300025297 Bacteria 12285
106 Ga0209758_1035638 3300025297 Bacteria 1957
107 Ga0209050_1003387 3300025298 Bacteria 11833
108 Ga0209050_1007425 3300025298 Bacteria 6149
109 Ga0209050_1024793 3300025298 Bacteria 2061
110 Ga0209256_1000027 3300025299 Bacteria 423283
111 Ga0209256_1000664 3300025299 Bacteria 46510
112 Ga0209256_1001273 3300025299 Bacteria 27393
113 Ga0209256_1001386 3300025299 Bacteria 25312
114 Ga0209256_1002435 3300025299 Bacteria 15208
115 Ga0209256_1009794 3300025299 Bacteria 4130
116 Ga0209256_1016066 3300025299 Bacteria 2575
117 Ga0207426_1000013 3300025302 Bacteria 721897
118 Ga0207426_1000015 3300025302 Bacteria 599316
119 Ga0207426_1000142 3300025302 Bacteria 194023
120 Ga0207426_1017300 3300025302 Bacteria 2565
121 Ga0209051_1000228 3300025303 Bacteria 94166
122 Ga0209051_1001381 3300025303 Bacteria 20949
123 Ga0209051_1010997 3300025303 Bacteria 4512
124 Ga0209051_1019124 3300025303 Bacteria 3001
125 Ga0209257_1002062 3300025304 Bacteria 21252
126 Ga0209257_1002102 3300025304 Bacteria 20853
127 Ga0209257_1013628 3300025304 Bacteria 3589
128 Ga0207680_10146461 3300025903 Bacteria 1570
129 Ga0207705_10169839 3300025909 Bacteria 1642
130 Ga0207657_10125836 3300025919 Bacteria 2105
131 Ga0207694_10067431 3300025924 Bacteria 2793
132 Ga0207644_10107983 3300025931 Bacteria 2100
133 Ga0207690_10278719 3300025932 Bacteria 1301
134 Ga0207691_10159707 3300025940 Bacteria 1978
135 Ga0207711_10029785 3300025941 Bacteria 4605
136 Ga0207661_10218722 3300025944 Bacteria 1683
137 Ga0207674_10007967 3300026116 Bacteria 12293
138 Ga0207698_10217507 3300026142 Bacteria 1724
139 Ga0209281_1000134 3300027111 Bacteria 185406
140 Ga0209281_1000445 3300027111 Bacteria 59209
141 Ga0209282_1000029 3300027666 Bacteria 157883
142 Ga0209813_10013212 3300027866 Bacteria 2200
143 Ga0307515_10000029 3300028794 Bacteria 365410
144 Ga0307515_10002648 3300028794 Bacteria 38377
145 Ga0307515_10005710 3300028794 Bacteria 25131
146 Ga0307515_10022967 3300028794 Bacteria 10967
147 Ga0307513_10003029 3300031456 Bacteria 22905
148 Ga0307405_10012088 3300031731 Bacteria 4554
149 Ga0307406_10004494 3300031901 Bacteria 7594
150 Ga0307412_10000392 3300031911 Bacteria 27005
151 Ga0307412_10003119 3300031911 Bacteria 9206
152 Ga0315914_1000004 3300031967 Bacteria 288534
153 Ga0307409_100151509 3300031995 Bacteria 2014
154 Ga0316593_10001489 3300032168 Bacteria 5177
155 Ga0315913_1000370 3300033430 Bacteria 38384
156 Ga0315915_1000003 3300033464 Bacteria 407996
157 Ga0373935_0119619 3300035692 Bacteria 1758
158 Ga0373927_0000144 3300035695 Bacteria 55726
159 Ga0373937_0006337 3300036401 Bacteria 10203
160 Ga0373925_0000481 3300037068 Bacteria 39959
161 Ga0373925_0142376 3300037068 Bacteria 1878
162 Ga0395905_0002704 3300037471 Bacteria 19430
163 Ga0395905_0004201 3300037471 Bacteria 15073
164 Ga0395905_0203134 3300037471 Bacteria 1857
165 Ga0316581_0007722 3300037588 Bacteria 2899
166 Ga0451843_0714921 3300041509 Bacteria 1618
167 Ga0451855_0902888 3300041511 Bacteria 1839
168 Ga0439432_034009 3300042006 Bacteria 1638
169 Ga0439449_0002720 3300042007 Bacteria 6882
170 Ga0450906_013508 3300042145 Bacteria 1504
171 Ga0495638_0000833 3300046460 Bacteria 32378
172 Ga0495638_0026738 3300046460 Bacteria 3739
173 Ga0495605_0040122 3300046474 Bacteria 2341
174 Ga0495607_0000073 3300046501 Bacteria 100053
175 Ga0495632_0003395 3300046519 Bacteria 11341
176 Ga0495643_0008881 3300046522 Bacteria 6317
177 Ga0495654_0000070 3300046530 Bacteria 117357
178 Ga0495625_0008274 3300046660 Bacteria 8891
179 Ga0495625_0066373 3300046660 Bacteria 2541
180 Ga0495687_055298 3300047443 Bacteria 1660
181 Ga0495626_0049962 3300048091 Bacteria 1934
182 Ga0496106_0001485 3300048909 Bacteria 17625
183 Ga0496110_0116450 3300048913 Bacteria 2406
184 Ga0496111_0000442 3300048914 Bacteria 21049
185 Ga0496111_0030233 3300048914 Bacteria 3852
186 Ga0496116_0050618 3300048919 Bacteria 2766
187 Ga0496117_0004320 3300048920 Bacteria 15810
188 Ga0496117_0030079 3300048920 Bacteria 4174
189 Ga0496118_0042727 3300048921 Bacteria 3572
190 Ga0496119_0013263 3300048922 Bacteria 6587
191 Ga0496121_0001404 3300048924 Bacteria 40784
192 Ga0496121_0024205 3300048924 Bacteria 5816
193 Ga0496121_0041613 3300048924 Bacteria 4013
194 Ga0496121_0134569 3300048924 Bacteria 1843
195 Ga0496122_0000029 3300048925 Bacteria 336396
196 Ga0496122_0000309 3300048925 Bacteria 107844
197 Ga0496122_0054865 3300048925 Bacteria 2988
198 Ga0496122_0055524 3300048925 Bacteria 2962
199 Ga0496123_0000531 3300048926 Bacteria 65624
200 Ga0496123_0002465 3300048926 Bacteria 22901
201 Ga0496123_0009237 3300048926 Bacteria 8911
202 Ga0496123_0047285 3300048926 Bacteria 2909
203 Ga0496123_0050246 3300048926 Bacteria 2787
204 Ga0496124_0000024 3300048927 Bacteria 414291
205 Ga0496124_0003452 3300048927 Bacteria 19323
206 Ga0496124_0003968 3300048927 Bacteria 17643
207 Ga0496124_0020894 3300048927 Bacteria 6040
208 Ga0496124_0072907 3300048927 Bacteria 2842
209 Ga0496124_0134620 3300048927 Bacteria 1958
210 Ga0496125_0000244 3300048928 Bacteria 111663
211 Ga0496125_0000276 3300048928 Bacteria 103024
212 Ga0496125_0005992 3300048928 Bacteria 13304
213 Ga0496125_0008430 3300048928 Bacteria 10791
214 Ga0496126_0002943 3300048929 Bacteria 22129
215 Ga0496126_0037148 3300048929 Bacteria 4548
216 Ga0496126_0051670 3300048929 Bacteria 3740
217 Ga0496126_0118593 3300048929 Bacteria 2297
218 Ga0496126_0135372 3300048929 Bacteria 2126
219 Ga0501031_0110537 3300049568 Bacteria 1794
220 Ga0501032_0060679 3300049569 Bacteria 2536
221 Ga0501032_0160835 3300049569 Bacteria 1475
222 Ga0501034_0001136 3300049571 Bacteria 37035
223 Ga0501034_0052060 3300049571 Bacteria 4126
224 Ga0501034_0056633 3300049571 Bacteria 3943
225 Ga0501036_0223235 3300049572 Bacteria 1582
226 Ga0501037_0030549 3300049573 Bacteria 3981
227 Ga0501038_0081611 3300049574 Bacteria 2724
228 Ga0501039_0183028 3300049575 Bacteria 1648
229 Ga0501040_0030218 3300049576 Bacteria 3660
230 Ga0501043_0092676 3300049579 Bacteria 2375
231 Ga0501048_0120718 3300049582 Bacteria 1852
232 Ga0501071_0078355 3300049587 Bacteria 2415
233 Ga0501074_0062119 3300049590 Bacteria 2691
234 Ga0501075_0064214 3300049591 Bacteria 2769
235 Ga0501076_0143706 3300049592 Bacteria 1939
236 Ga0501081_0178345 3300049743 Bacteria 1536
237 Ga0501083_0031941 3300049744 Bacteria 3611
238 Ga0501044_0094358 3300049823 Bacteria 3017
239 Ga0500618_000096 3300053125 Bacteria 72003
240 Ga0500658_0001404 3300053134 Bacteria 9709
241 Ga0500573_0001956 3300053140 Bacteria 10068
242 Ga0500622_0000323 3300053156 Bacteria 47794
243 Ga0500634_0000002 3300053161 Bacteria 252372
244 Ga0501084_0093167 3300054114 Bacteria 2529
245 Ga0501082_0095206 3300060353 Bacteria 2573
246 Ga0530510_0069767 3300061734 Bacteria 2550

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049569 Ga0501032_0160835 Ga0501032_0160835_437_1462 321
2 3300049582 Ga0501048_0120718 Ga0501048_0120718_745_1842 326
3 3300049587 Ga0501071_0078355 Ga0501071_0078355_1303_2400 329
4 3300035692 Ga0373935_0119619 Ga0373935_0119619_668_1738 344
5 3300036401 Ga0373937_0006337 Ga0373937_0006337_3969_5159 349
6 3300049743 Ga0501081_0178345 Ga0501081_0178345_336_1520 355
7 3300005356 Ga0070674_100126581 Ga0070674_1001265812 357
8 3300025909 Ga0207705_10169839 Ga0207705_101698391 357
9 3300025940 Ga0207691_10159707 Ga0207691_101597071 357
10 3300026142 Ga0207698_10217507 Ga0207698_102175071 357
11 3300053140 Ga0500573_0001956 Ga0500573_0001956_7256_8536 369
12 3300049575 Ga0501039_0183028 Ga0501039_0183028_28_1281 371
13 3300048929 Ga0496126_0135372 Ga0496126_0135372_14_1180 372
14 3300047443 Ga0495687_055298 Ga0495687_055298_18_1196 373
15 3300005937 Ga0081455_10003244 Ga0081455_100032444 376
16 3300006847 Ga0075431_100149348 Ga0075431_1001493482 377
17 3300049572 Ga0501036_0223235 Ga0501036_0223235_10_1329 377
18 3300049576 Ga0501040_0030218 Ga0501040_0030218_892_2211 377
19 3300049590 Ga0501074_0062119 Ga0501074_0062119_371_1690 377
20 3300049591 Ga0501075_0064214 Ga0501075_0064214_281_1600 377
21 3300049592 Ga0501076_0143706 Ga0501076_0143706_256_1575 377
22 3300054114 Ga0501084_0093167 Ga0501084_0093167_350_1669 377
23 3300060353 Ga0501082_0095206 Ga0501082_0095206_450_1769 377
24 3300061734 Ga0530510_0069767 Ga0530510_0069767_253_1572 377
25 3300028794 Ga0307515_10000029 Ga0307515_10000029212 381
26 3300031456 Ga0307513_10003029 Ga0307513_100030296 381
27 3300049568 Ga0501031_0110537 Ga0501031_0110537_238_1575 381
28 3300049571 Ga0501034_0056633 Ga0501034_0056633_59_1339 381
29 3300006048 Ga0075363_100005718 Ga0075363_1000057181 382
30 3300006353 Ga0075370_10035491 Ga0075370_100354912 382
31 3300042006 Ga0439432_034009 Ga0439432_034009_27_1307 382
32 3300025294 Ga0209025_1036655 Ga0209025_10366552 383
33 3300005329 Ga0070683_100057641 Ga0070683_1000576414 385
34 3300005577 Ga0068857_100010337 Ga0068857_1000103377 385
35 3300025919 Ga0207657_10125836 Ga0207657_101258362 385
36 3300025924 Ga0207694_10067431 Ga0207694_100674313 385
37 3300025932 Ga0207690_10278719 Ga0207690_102787191 385
38 3300025944 Ga0207661_10218722 Ga0207661_102187222 385
39 3300026116 Ga0207674_10007967 Ga0207674_1000796712 385
40 3300028794 Ga0307515_10005710 Ga0307515_1000571016 385
41 3300042145 Ga0450906_013508 Ga0450906_013508_199_1494 385
42 3300037068 Ga0373925_0142376 Ga0373925_0142376_109_1365 386
43 3300048929 Ga0496126_0037148 Ga0496126_0037148_2736_4013 386
44 iso_pu_bacteria 2643221580 2643910399 386
45 iso_pu_bacteria 2643221591 2643963909 386
46 iso_pu_bacteria 2643221674 2644411711 386
47 iso_pu_bacteria 2713897090 2715498521 386
48 iso_pu_bacteria 2932401849 2932402333 386
49 3300021320 Ga0214544_1006450 Ga0214544_100645018 387
50 3300021321 Ga0214542_1000029 Ga0214542_100002919 387
51 3300021327 Ga0214543_1000040 Ga0214543_100004019 387
52 3300025292 Ga0209676_1006401 Ga0209676_10064013 387
53 3300025298 Ga0209050_1003387 Ga0209050_10033879 387
54 3300025303 Ga0209051_1010997 Ga0209051_10109973 387
55 3300053161 Ga0500634_0000002 Ga0500634_0000002_233520_234779 387
56 iso_pu_bacteria 8057132660 8057134821 387
57 3300032168 Ga0316593_10001489 Ga0316593_100014893 388
58 3300037588 Ga0316581_0007722 Ga0316581_0007722_1352_2611 388
59 3300053156 Ga0500622_0000323 Ga0500622_0000323_45820_47100 388
60 iso_pu_bacteria 2791355094 2792637696 388
61 3300027111 Ga0209281_1000445 Ga0209281_100044544 389
62 3300031995 Ga0307409_100151509 Ga0307409_1001515092 389
63 3300042007 Ga0439449_0002720 Ga0439449_0002720_3640_4920 389
64 3300048913 Ga0496110_0116450 Ga0496110_0116450_998_2287 389
65 3300048914 Ga0496111_0030233 Ga0496111_0030233_436_1725 389
66 3300048926 Ga0496123_0047285 Ga0496123_0047285_459_1736 389
67 3300048927 Ga0496124_0020894 Ga0496124_0020894_1518_2807 389
68 3300048928 Ga0496125_0000276 Ga0496125_0000276_44178_45467 389
69 3300049571 Ga0501034_0001136 Ga0501034_0001136_27144_28406 389
70 iso_pu_bacteria 2516143018 2516204721 389
71 iso_pu_bacteria 2558860100 2558866496 389
72 iso_pu_bacteria 2599185236 2599718882 389
73 iso_pu_bacteria 2599185292 2599906612 389
74 iso_pu_bacteria 2600254933 2600376667 389
75 iso_pu_bacteria 2643221569 2643860819 389
76 iso_pu_bacteria 2643221594 2643981341 389
77 iso_pu_bacteria 2643221621 2644124111 389
78 iso_pu_bacteria 2739367655 2739612111 389
79 iso_pu_bacteria 2808606395 2809035258 389
80 iso_pu_bacteria 2838680041 2838680130 389
81 iso_pu_bacteria 2838694306 2838695839 389
82 iso_pu_bacteria 2838707686 2838709214 389
83 iso_pu_bacteria 2842077413 2842079550 389
84 iso_pu_bacteria 2842118031 2842120168 389
85 iso_pu_bacteria 2842237096 2842238625 389
86 iso_pu_bacteria 2842291075 2842293211 389
87 iso_pu_bacteria 2842370503 2842370592 389
88 iso_pu_bacteria 2842377471 2842379608 389
89 iso_pu_bacteria 2842384541 2842386679 389
90 iso_pu_bacteria 2854896431 2854900713 389
91 iso_pu_bacteria 2854916844 2854919590 389
92 iso_pu_bacteria 2857537821 2857542279 389
93 iso_pu_bacteria 2857542790 2857545052 389
94 iso_pu_bacteria 2858950400 2858953567 389
95 iso_pu_bacteria 2887375801 2887377817 389
96 iso_pu_bacteria 2891373044 2891375347 389
97 iso_pu_bacteria 2935894831 2935896359 389
98 iso_pu_bacteria 2941479691 2941484670 389
99 iso_pu_bacteria 2989349275 2989351823 389
100 iso_pu_bacteria 2509276021 2509388884 390
101 iso_pu_bacteria 2509276033 2509444470 390
102 iso_pu_bacteria 2510065057 2510308153 390
103 iso_pu_bacteria 2510461076 2510897265 390
104 iso_pu_bacteria 2511231052 2511498932 390
105 iso_pu_bacteria 2512047086 2512535060 390
106 iso_pu_bacteria 2512875026 2512973115 390
107 iso_pu_bacteria 2513237086 2513587200 390
108 iso_pu_bacteria 2513237089 2513604304 390
109 iso_pu_bacteria 2513237091 2513616210 390
110 iso_pu_bacteria 2513237140 2513882637 390
111 iso_pu_bacteria 2513237143 2513904620 390
112 iso_pu_bacteria 2513237156 2513983175 390
113 iso_pu_bacteria 2513237159 2513996391 390
114 iso_pu_bacteria 2513237160 2514008182 390
115 iso_pu_bacteria 2513237162 2514022228 390
116 iso_pu_bacteria 2515154107 2515607350 390
117 iso_pu_bacteria 2515154113 2515633882 390
118 iso_pu_bacteria 2515154114 2515641296 390
119 iso_pu_bacteria 2515154116 2515659698 390
120 iso_pu_bacteria 2516653046 2516895208 390
121 iso_pu_bacteria 2517093000 2517097586 390
122 iso_pu_bacteria 2517287029 2517409056 390
123 iso_pu_bacteria 2517487022 2517571885 390
124 iso_pu_bacteria 2519899620 2520375838 390
125 iso_pu_bacteria 2522572158 2523104461 390
126 iso_pu_bacteria 2524023207 2524450908 390
127 iso_pu_bacteria 2529292951 2530648242 390
128 iso_pu_bacteria 2551306084 2551675230 390
129 iso_pu_bacteria 2551306085 2551686977 390
130 iso_pu_bacteria 2551306086 2551696606 390
131 iso_pu_bacteria 2551306089 2551709258 390
132 iso_pu_bacteria 2551306090 2551716500 390
133 iso_pu_bacteria 2551306091 2551726712 390
134 iso_pu_bacteria 2551306092 2551734428 390
135 iso_pu_bacteria 2551306093 2551743136 390
136 iso_pu_bacteria 2582581283 2585164532 390
137 iso_pu_bacteria 2582581306 2585264841 390
138 iso_pu_bacteria 2582581865 2585386103 390
139 iso_pu_bacteria 2582581866 2585394666 390
140 iso_pu_bacteria 2599185156 2599332678 390
141 iso_pu_bacteria 2599185352 2600197556 390
142 iso_pu_bacteria 2615840624 2616293847 390
143 iso_pu_bacteria 2643221557 2643805893 390
144 iso_pu_bacteria 2643221607 2644051510 390
145 iso_pu_bacteria 2643221610 2644066069 390
146 iso_pu_bacteria 2643221636 2644200007 390
147 iso_pu_bacteria 2643221637 2644207168 390
148 iso_pu_bacteria 2643221668 2644380374 390
149 iso_pu_bacteria 2643221675 2644417400 390
150 iso_pu_bacteria 2643221680 2644450796 390
151 iso_pu_bacteria 2643221686 2644480379 390
152 iso_pu_bacteria 2643221688 2644495506 390
153 iso_pu_bacteria 2643221689 2644498884 390
154 iso_pu_bacteria 2643221718 2644650816 390
155 iso_pu_bacteria 2643221723 2644671569 390
156 iso_pu_bacteria 2643221726 2644692780 390
157 iso_pu_bacteria 2690316117 2692317667 390
158 iso_pu_bacteria 2718217882 2719183451 390
159 iso_pu_bacteria 2718217927 2719388195 390
160 iso_pu_bacteria 2718217997 2719667817 390
161 iso_pu_bacteria 2718218009 2719734168 390
162 iso_pu_bacteria 2718218199 2720494237 390
163 iso_pu_bacteria 2718218232 2720615699 390
164 iso_pu_bacteria 2718218233 2720622484 390
165 iso_pu_bacteria 2718218235 2720633838 390
166 iso_pu_bacteria 2718218269 2720777538 390
167 iso_pu_bacteria 2718218363 2721149563 390
168 iso_pu_bacteria 2718218366 2721166400 390
169 iso_pu_bacteria 2718218423 2721401830 390
170 iso_pu_bacteria 2721755514 2722842570 390
171 iso_pu_bacteria 2721755556 2723029137 390
172 iso_pu_bacteria 2721755684 2723562751 390
173 iso_pu_bacteria 2721755685 2723569445 390
174 iso_pu_bacteria 2721755809 2724040644 390
175 iso_pu_bacteria 2721755810 2724046924 390
176 iso_pu_bacteria 2721755819 2724092145 390
177 iso_pu_bacteria 2721755822 2724106710 390
178 iso_pu_bacteria 2721755823 2724112519 390
179 iso_pu_bacteria 2728369352 2730110073 390
180 iso_pu_bacteria 2728369365 2730166686 390
181 iso_pu_bacteria 2751185821 2753459867 390
182 iso_pu_bacteria 2775507049 2776916168 390
183 iso_pu_bacteria 2791355091 2792621050 390
184 iso_pu_bacteria 2791355092 2792625265 390
185 iso_pu_bacteria 2791355256 2793296722 390
186 iso_pu_bacteria 2791355259 2793314106 390
187 iso_pu_bacteria 2791355262 2793336709 390
188 iso_pu_bacteria 2791355264 2793349564 390
189 iso_pu_bacteria 2791355265 2793352586 390
190 iso_pu_bacteria 2791355266 2793358409 390
191 iso_pu_bacteria 2791355267 2793365443 390
192 iso_pu_bacteria 2802428858 2802718682 390
193 iso_pu_bacteria 2802428859 2802724362 390
194 iso_pu_bacteria 2802428860 2802729976 390
195 iso_pu_bacteria 2802428861 2802737319 390
196 iso_pu_bacteria 2802428862 2802742235 390
197 iso_pu_bacteria 2802428863 2802748917 390
198 iso_pu_bacteria 2802429605 2805928254 390
199 iso_pu_bacteria 2802429606 2805936582 390
200 iso_pu_bacteria 2838016132 2838020702 390
201 iso_pu_bacteria 2838048938 2838053205 390
202 iso_pu_bacteria 2838061910 2838064600 390
203 iso_pu_bacteria 2838068647 2838070624 390
204 iso_pu_bacteria 2838668709 2838674058 390
205 iso_pu_bacteria 2838701080 2838706502 390
206 iso_pu_bacteria 2841864319 2841869001 390
207 iso_pu_bacteria 2842146304 2842151160 390
208 iso_pu_bacteria 2842192696 2842196263 390
209 iso_pu_bacteria 2842205361 2842209026 390
210 iso_pu_bacteria 2842250916 2842256216 390
211 iso_pu_bacteria 2842278818 2842282284 390
212 iso_pu_bacteria 2842285085 2842286394 390
213 iso_pu_bacteria 2842311132 2842312325 390
214 iso_pu_bacteria 2842317721 2842321921 390
215 iso_pu_bacteria 2842341865 2842344532 390
216 iso_pu_bacteria 2842363717 2842367573 390
217 iso_pu_bacteria 2842395702 2842397734 390
218 iso_pu_bacteria 2842402390 2842404053 390
219 iso_pu_bacteria 2842409023 2842410244 390
220 iso_pu_bacteria 2842415677 2842416892 390
221 iso_pu_bacteria 2842422224 2842424238 390
222 iso_pu_bacteria 2842447887 2842453934 390
223 iso_pu_bacteria 2842489311 2842494210 390
224 iso_pu_bacteria 2842495871 2842499820 390
225 iso_pu_bacteria 2842521101 2842521311 390
226 iso_pu_bacteria 2842922631 2842922953 390
227 iso_pu_bacteria 2847417321 2847421353 390
228 iso_pu_bacteria 2848992105 2848996138 390
229 iso_pu_bacteria 2855825444 2855827846 390
230 iso_pu_bacteria 2855839649 2855843214 390
231 iso_pu_bacteria 2855872281 2855877846 390
232 iso_pu_bacteria 2858800743 2858802942 390
233 iso_pu_bacteria 2913295892 2913298333 390
234 iso_pu_bacteria 2915980308 2915986606 390
235 iso_pu_bacteria 2915986958 2915993650 390
236 iso_pu_bacteria 2915993759 2915994186 390
237 iso_pu_bacteria 2916000859 2916004912 390
238 iso_pu_bacteria 2916007675 2916008315 390
239 iso_pu_bacteria 2916014648 2916015114 390
240 iso_pu_bacteria 2916021584 2916026191 390
241 iso_pu_bacteria 2916028427 2916035153 390
242 iso_pu_bacteria 2916035215 2916041522 390
243 iso_pu_bacteria 2916041962 2916047416 390
244 iso_pu_bacteria 2916048683 2916054847 390
245 iso_pu_bacteria 2916055098 2916058953 390
246 iso_pu_bacteria 2916061851 2916065878 390
247 iso_pu_bacteria 2916068649 2916069437 390
248 iso_pu_bacteria 2916076590 2916077268 390
249 iso_pu_bacteria 2920822456 2920822922 390
250 iso_pu_bacteria 2921201388 2921202459 390
251 iso_pu_bacteria 2921208531 2921209216 390
252 iso_pu_bacteria 2921237296 2921237601 390
253 iso_pu_bacteria 2921244191 2921249766 390
254 iso_pu_bacteria 2921250672 2921254863 390
255 iso_pu_bacteria 2921257292 2921263876 390
256 iso_pu_bacteria 2921263974 2921270539 390
257 iso_pu_bacteria 2921282425 2921283111 390
258 iso_pu_bacteria 2921289301 2921289991 390
259 iso_pu_bacteria 2921296804 2921298059 390
260 iso_pu_bacteria 2924144063 2924146136 390
261 iso_pu_bacteria 2924150972 2924158209 390
262 iso_pu_bacteria 2924158325 2924164538 390
263 iso_pu_bacteria 2924165586 2924171371 390
264 iso_pu_bacteria 2924172951 2924179631 390
265 iso_pu_bacteria 2924179722 2924180035 390
266 iso_pu_bacteria 2924186466 2924186801 390
267 iso_pu_bacteria 2924193448 2924200296 390
268 iso_pu_bacteria 2924200457 2924202613 390
269 iso_pu_bacteria 2924207177 2924209442 390
270 iso_pu_bacteria 2924214083 2924217851 390
271 iso_pu_bacteria 2924221636 2924227059 390
272 iso_pu_bacteria 2924228884 2924234741 390
273 iso_pu_bacteria 2933599457 2933601428 390
274 iso_pu_bacteria 2936381700 2936386210 390
275 iso_pu_bacteria 2936996657 2936998662 390
276 iso_pu_bacteria 2937002841 2937006318 390
277 iso_pu_bacteria 2937009748 2937011676 390
278 iso_pu_bacteria 2937016420 2937018382 390
279 iso_pu_bacteria 2937023124 2937025724 390
280 iso_pu_bacteria 2937029754 2937033623 390
281 iso_pu_bacteria 2937036028 2937040341 390
282 iso_pu_bacteria 2937042894 2937045782 390
283 iso_pu_bacteria 2937049772 2937055993 390
284 iso_pu_bacteria 2937056579 2937057221 390
285 iso_pu_bacteria 2937063883 2937069967 390
286 iso_pu_bacteria 2937071275 2937078315 390
287 iso_pu_bacteria 2937078374 2937082712 390
288 iso_pu_bacteria 2937084907 2937088629 390
289 iso_pu_bacteria 2937091812 2937092579 390
290 iso_pu_bacteria 2937098957 2937106323 390
291 iso_pu_bacteria 2937106411 2937108279 390
292 iso_pu_bacteria 2937113482 2937118688 390
293 iso_pu_bacteria 2937119839 2937121867 390
294 iso_pu_bacteria 2937126314 2937129675 390
295 iso_pu_bacteria 2941499720 2941501116 390
296 iso_pu_bacteria 2957375807 2957377929 390
297 iso_pu_bacteria 2957382221 2957384327 390
298 iso_pu_bacteria 2957388812 2957393777 390
299 iso_pu_bacteria 2957395598 2957396027 390
300 iso_pu_bacteria 2957402308 2957405600 390
301 iso_pu_bacteria 2957408893 2957413527 390
302 iso_pu_bacteria 2957415311 2957422294 390
303 iso_pu_bacteria 2957422303 2957426268 390
304 iso_pu_bacteria 2957430029 2957434353 390
305 iso_pu_bacteria 2957437181 2957437550 390
306 iso_pu_bacteria 2957443900 2957450140 390
307 iso_pu_bacteria 2957450854 2957452820 390
308 iso_pu_bacteria 2957457609 2957458213 390
309 iso_pu_bacteria 2957464669 2957466309 390
310 iso_pu_bacteria 2957471148 2957474691 390
311 iso_pu_bacteria 2957478035 2957484082 390
312 iso_pu_bacteria 2957484790 2957485225 390
313 iso_pu_bacteria 2957491536 2957493775 390
314 iso_pu_bacteria 2957498199 2957498923 390
315 iso_pu_bacteria 2957505466 2957506027 390
316 iso_pu_bacteria 2960584000 2960584612 390
317 iso_pu_bacteria 2960591022 2960593255 390
318 iso_pu_bacteria 2960597568 2960603188 390
319 iso_pu_bacteria 2960603979 2960609378 390
320 iso_pu_bacteria 2960610863 2960615327 390
321 iso_pu_bacteria 2960617483 2960623259 390
322 iso_pu_bacteria 2960624210 2960624815 390
323 iso_pu_bacteria 2960631154 2960637041 390
324 iso_pu_bacteria 2960637947 2960638867 390
325 iso_pu_bacteria 2960645483 2960650954 390
326 iso_pu_bacteria 2960652885 2960659355 390
327 iso_pu_bacteria 2960660292 2960666929 390
328 iso_pu_bacteria 2960667422 2960670169 390
329 iso_pu_bacteria 2960674078 2960679540 390
330 iso_pu_bacteria 2960680706 2960687288 390
331 iso_pu_bacteria 2960687367 2960693666 390
332 iso_pu_bacteria 2960693952 2960697366 390
333 iso_pu_bacteria 2964607997 2964611566 390
334 iso_pu_bacteria 2964615318 2964621545 390
335 iso_pu_bacteria 2964621998 2964622469 390
336 iso_pu_bacteria 2964628898 2964634259 390
337 iso_pu_bacteria 2964636051 2964641409 390
338 iso_pu_bacteria 2964643177 2964644956 390
339 iso_pu_bacteria 2964649959 2964655935 390
340 iso_pu_bacteria 2964656573 2964657027 390
341 iso_pu_bacteria 2964663802 2964670353 390
342 iso_pu_bacteria 2964670856 2964674809 390
343 iso_pu_bacteria 2964678106 2964684533 390
344 iso_pu_bacteria 2964685014 2964685352 390
345 iso_pu_bacteria 2964691889 2964692394 390
346 iso_pu_bacteria 2964698721 2964705387 390
347 iso_pu_bacteria 2964705432 2964708955 390
348 iso_pu_bacteria 2964712639 2964713037 390
349 iso_pu_bacteria 2964719344 2964720295 390
350 iso_pu_bacteria 2967664464 2967665793 390
351 iso_pu_bacteria 2967671571 2967671958 390
352 iso_pu_bacteria 2967678726 2967679130 390
353 iso_pu_bacteria 2967686174 2967689907 390
354 iso_pu_bacteria 2967693043 2967695277 390
355 iso_pu_bacteria 2967699805 2967703853 390
356 iso_pu_bacteria 2967706974 2967707704 390
357 iso_pu_bacteria 2967714385 2967720672 390
358 iso_pu_bacteria 2967721400 2967728479 390
359 iso_pu_bacteria 2967728569 2967732777 390
360 iso_pu_bacteria 2967735183 2967741124 390
361 iso_pu_bacteria 2967742019 2967742380 390
362 iso_pu_bacteria 2967748971 2967749601 390
363 iso_pu_bacteria 2967755722 2967761959 390
364 iso_pu_bacteria 2967762386 2967768670 390
365 iso_pu_bacteria 2967769361 2967771414 390
366 iso_pu_bacteria 2967775926 2967776569 390
367 iso_pu_bacteria 2970019648 2970020065 390
368 iso_pu_bacteria 2970026789 2970031045 390
369 iso_pu_bacteria 2970033650 2970040198 390
370 iso_pu_bacteria 2970040964 2970046848 390
371 iso_pu_bacteria 2970047711 2970051836 390
372 iso_pu_bacteria 2970054988 2970060412 390
373 iso_pu_bacteria 2970061556 2970062081 390
374 iso_pu_bacteria 2970068827 2970075186 390
375 iso_pu_bacteria 2970076120 2970082286 390
376 iso_pu_bacteria 2970082768 2970087981 390
377 iso_pu_bacteria 2970088815 2970091643 390
378 iso_pu_bacteria 2970095765 2970097099 390
379 iso_pu_bacteria 2970102677 2970108322 390
380 iso_pu_bacteria 2970109326 2970113553 390
381 iso_pu_bacteria 2970116247 2970121984 390
382 iso_pu_bacteria 2970122695 2970128617 390
383 iso_pu_bacteria 2970129317 2970135425 390
384 iso_pu_bacteria 2970136068 2970139727 390
385 iso_pu_bacteria 2970143518 2970149332 390
386 iso_pu_bacteria 2970149975 2970153601 390
387 iso_pu_bacteria 2970156795 2970157894 390
388 iso_pu_bacteria 2970164137 2970169680 390
389 iso_pu_bacteria 2970170962 2970174034 390
390 iso_pu_bacteria 2970177841 2970182461 390
391 iso_pu_bacteria 2970184632 2970186998 390
392 iso_pu_bacteria 2970191845 2970198655 390
393 iso_pu_bacteria 2977516862 2977517448 390
394 iso_pu_bacteria 2977523885 2977530341 390
395 iso_pu_bacteria 2977530762 2977530986 390
396 iso_pu_bacteria 2977537788 2977538620 390
397 iso_pu_bacteria 2977544691 2977548635 390
398 iso_pu_bacteria 2977551784 2977554219 390
399 iso_pu_bacteria 2977558990 2977565316 390
400 iso_pu_bacteria 2977565890 2977569965 390
401 iso_pu_bacteria 2977572785 2977579435 390
402 iso_pu_bacteria 2977579622 2977584018 390
403 iso_pu_bacteria 2989771324 2989772445 390
404 iso_pu_bacteria 3003930520 3003931559 390
405 iso_pu_bacteria 639633055 639646191 390
406 iso_pu_bacteria 643692032 643827844 390
407 iso_pu_bacteria 648276728 648736669 390
408 iso_pu_bacteria 8003992118 8003995796 390
409 iso_pu_bacteria 8003999396 8004003556 390
410 iso_pu_bacteria 8005275841 8005278401 390
411 iso_pu_bacteria 8005282627 8005285370 390
412 iso_pu_bacteria 8005289223 8005291533 390
413 iso_pu_bacteria 8005430974 8005433284 390
414 iso_pu_bacteria 8005497431 8005498214 390
415 iso_pu_bacteria 8005619151 8005619423 390
416 iso_pu_bacteria 8005626139 8005627990 390
417 iso_pu_bacteria 8005668836 8005669623 390
418 iso_pu_bacteria 8005695170 8005701347 390
419 iso_pu_bacteria 8018127388 8018132669 390
420 iso_pu_bacteria 8018176218 8018181965 390
421 iso_pu_bacteria 8024501048 8024506438 390
422 iso_pu_bacteria 8054558443 8054561116 390
423 iso_pu_bacteria 8056375014 8056381063 390
424 iso_pu_bacteria 8056382006 8056382579 390
425 iso_pu_bacteria 8057874678 8057879076 390
426 3300006946 Ga0079104_1002193 Ga0079104_10021935 391
427 3300009765 Ga0123341_1000024 Ga0123341_10000242 391
428 3300009766 Ga0123342_1018459 Ga0123342_10184592 391
429 3300022739 Ga0228711_1003057 Ga0228711_100305723 391
430 3300022740 Ga0228710_1000004 Ga0228710_100000419 391
431 3300025254 Ga0209148_1000268 Ga0209148_100026860 391
432 3300025272 Ga0209455_1000617 Ga0209455_100061720 391
433 3300027111 Ga0209281_1000134 Ga0209281_100013445 391
434 3300027666 Ga0209282_1000029 Ga0209282_100002913 391
435 3300031967 Ga0315914_1000004 Ga0315914_100000424 391
436 3300033430 Ga0315913_1000370 Ga0315913_100037013 391
437 3300033464 Ga0315915_1000003 Ga0315915_1000003131 391
438 3300041509 Ga0451843_0714921 Ga0451843_0714921_260_1534 391
439 3300041511 Ga0451855_0902888 Ga0451855_0902888_480_1754 391
440 iso_pu_bacteria 2510065019 2510135786 391
441 iso_pu_bacteria 2510917030 2511194079 391
442 iso_pu_bacteria 2513237084 2513570951 391
443 iso_pu_bacteria 2513237085 2513574849 391
444 iso_pu_bacteria 2513237093 2513634095 391
445 iso_pu_bacteria 2513237144 2513911086 391
446 iso_pu_bacteria 2513237146 2513924397 391
447 iso_pu_bacteria 2515075009 2515114994 391
448 iso_pu_bacteria 2515154134 2515741075 391
449 iso_pu_bacteria 2516653077 2517038580 391
450 iso_pu_bacteria 2516653085 2517078834 391
451 iso_pu_bacteria 2582581298 2585223369 391
452 iso_pu_bacteria 2585427526 2585523834 391
453 iso_pu_bacteria 2585427528 2585543377 391
454 iso_pu_bacteria 2585427529 2585546035 391
455 iso_pu_bacteria 2585427593 2585840795 391
456 iso_pu_bacteria 2599185170 2599419644 391
457 iso_pu_bacteria 2718218365 2721160966 391
458 iso_pu_bacteria 2724679232 2725947582 391
459 iso_pu_bacteria 2728369397 2730300598 391
460 iso_pu_bacteria 2738541333 2739038215 391
461 iso_pu_bacteria 2765235942 2766063273 391
462 iso_pu_bacteria 2791355260 2793322390 391
463 iso_pu_bacteria 2791355261 2793327679 391
464 iso_pu_bacteria 2791355263 2793341151 391
465 iso_pu_bacteria 2802429633 2806046581 391
466 iso_pu_bacteria 2802429634 2806051331 391
467 iso_pu_bacteria 2802429635 2806059320 391
468 iso_pu_bacteria 2802429636 2806066707 391
469 iso_pu_bacteria 2802429637 2806073764 391
470 iso_pu_bacteria 2838022645 2838026329 391
471 iso_pu_bacteria 2838035591 2838039823 391
472 iso_pu_bacteria 2838042994 2838044750 391
473 iso_pu_bacteria 2838661181 2838664105 391
474 iso_pu_bacteria 2838686498 2838689734 391
475 iso_pu_bacteria 2838729681 2838731570 391
476 iso_pu_bacteria 2838742623 2838744511 391
477 iso_pu_bacteria 2841851746 2841853051 391
478 iso_pu_bacteria 2842110456 2842112632 391
479 iso_pu_bacteria 2842156927 2842160378 391
480 iso_pu_bacteria 2842163707 2842165644 391
481 iso_pu_bacteria 2842180545 2842183956 391
482 iso_pu_bacteria 2842198810 2842202090 391
483 iso_pu_bacteria 2842217011 2842219300 391
484 iso_pu_bacteria 2842229732 2842231537 391
485 iso_pu_bacteria 2842243621 2842245993 391
486 iso_pu_bacteria 2842257432 2842260371 391
487 iso_pu_bacteria 2842271015 2842273782 391
488 iso_pu_bacteria 2842304105 2842308993 391
489 iso_pu_bacteria 2844454524 2844456482 391
490 iso_pu_bacteria 2857516855 2857522077 391
491 iso_pu_bacteria 2857576091 2857579400 391
492 iso_pu_bacteria 2919100787 2919101751 391
493 iso_pu_bacteria 2933570622 2933575436 391
494 iso_pu_bacteria 2933586486 2933588479 391
495 iso_pu_bacteria 2935901341 2935902431 391
496 iso_pu_bacteria 2936367885 2936369401 391
497 iso_pu_bacteria 2936375103 2936380095 391
498 iso_pu_bacteria 2996893221 2996897711 391
499 iso_pu_bacteria 3005409236 3005410724 391
500 iso_pu_bacteria 3005445848 3005450198 391
501 iso_pu_bacteria 8005301065 8005305586 391
502 iso_pu_bacteria 8005307578 8005310361 391
503 iso_pu_bacteria 8005376324 8005377910 391
504 iso_pu_bacteria 8005382845 8005385204 391
505 iso_pu_bacteria 8005395548 8005399716 391
506 iso_pu_bacteria 8005460587 8005465691 391
507 iso_pu_bacteria 8005556819 8005560094 391
508 iso_pu_bacteria 8005563573 8005564407 391
509 iso_pu_bacteria 8005570704 8005573968 391
510 iso_pu_bacteria 8005688590 8005692661 391
511 iso_pu_bacteria 8018163183 8018167480 391
512 iso_pu_bacteria 8023680758 8023681162 391
513 iso_pu_bacteria 8024479707 8024479812 391
514 iso_pu_bacteria 8056875544 8056878753 391
515 3300003187 JGI25151J46595_10000278 JGI25151J46595_1000027863 392
516 3300003215 JGI25153J46596_10017954 JGI25153J46596_100179541 392
517 3300003771 Ga0055526_1005467 Ga0055526_10054672 392
518 3300003775 Ga0055524_1003177 Ga0055524_10031775 392
519 3300003790 Ga0055528_1002653 Ga0055528_10026534 392
520 3300003790 Ga0055528_1006382 Ga0055528_10063821 392
521 3300004625 Ga0055543_1001402 Ga0055543_10014023 392
522 3300006042 Ga0075368_10020337 Ga0075368_100203372 392
523 3300006186 Ga0075369_10057344 Ga0075369_100573442 392
524 3300006353 Ga0075370_10010819 Ga0075370_100108194 392
525 3300025258 Ga0209129_1003118 Ga0209129_10031184 392
526 3300025273 Ga0209673_1000378 Ga0209673_100037818 392
527 3300025294 Ga0209025_1000235 Ga0209025_1000235110 392
528 3300025295 Ga0209564_1001075 Ga0209564_100107522 392
529 3300025297 Ga0209758_1001165 Ga0209758_100116524 392
530 3300025297 Ga0209758_1004173 Ga0209758_10041732 392
531 3300025299 Ga0209256_1001273 Ga0209256_100127320 392
532 3300025302 Ga0207426_1000142 Ga0207426_10001424 392
533 3300025303 Ga0209051_1001381 Ga0209051_10013816 392
534 3300027866 Ga0209813_10013212 Ga0209813_100132121 392
535 3300046474 Ga0495605_0040122 Ga0495605_0040122_553_1830 392
536 3300046522 Ga0495643_0008881 Ga0495643_0008881_870_2147 392
537 3300046660 Ga0495625_0066373 Ga0495625_0066373_158_1435 392
538 3300053134 Ga0500658_0001404 Ga0500658_0001404_6784_8061 392
539 iso_pu_bacteria 2510917028 2511185723 392
540 iso_pu_bacteria 2513237088 2513595411 392
541 iso_pu_bacteria 2513237138 2513870235 392
542 iso_pu_bacteria 2534681796 2535514679 392
543 iso_pu_bacteria 2582581299 2585232382 392
544 iso_pu_bacteria 2582581304 2585256301 392
545 iso_pu_bacteria 2582581867 2585398979 392
546 iso_pu_bacteria 2585427590 2585818900 392
547 iso_pu_bacteria 2585427594 2585843817 392
548 iso_pu_bacteria 2643221599 2644004522 392
549 iso_pu_bacteria 2643221634 2644196967 392
550 iso_pu_bacteria 2643221643 2644237567 392
551 iso_pu_bacteria 2738541293 2738800893 392
552 iso_pu_bacteria 2996887358 2996888081 392
553 iso_pu_bacteria 3005452660 3005456471 392
554 iso_pu_bacteria 8005258706 8005261354 392
555 iso_pu_bacteria 8005321885 8005322608 392
556 iso_pu_bacteria 8005542996 8005543347 392
557 3300003790 Ga0055528_1000454 Ga0055528_100045429 393
558 3300025273 Ga0209673_1000135 Ga0209673_100013584 393
559 3300025294 Ga0209025_1000866 Ga0209025_100086638 393
560 3300025295 Ga0209564_1000138 Ga0209564_100013866 393
561 3300025299 Ga0209256_1000664 Ga0209256_100066422 393
562 3300028794 Ga0307515_10002648 Ga0307515_1000264819 393
563 3300031911 Ga0307412_10000392 Ga0307412_1000039216 393
564 3300037471 Ga0395905_0002704 Ga0395905_0002704_15971_17248 393
565 3300046530 Ga0495654_0000070 Ga0495654_0000070_69732_71009 393
566 3300048914 Ga0496111_0000442 Ga0496111_0000442_2650_3927 393
567 3300048920 Ga0496117_0004320 Ga0496117_0004320_6473_7750 393
568 3300048922 Ga0496119_0013263 Ga0496119_0013263_1308_2606 393
569 3300048924 Ga0496121_0001404 Ga0496121_0001404_19454_20752 393
570 3300048924 Ga0496121_0024205 Ga0496121_0024205_1453_2751 393
571 3300048924 Ga0496121_0041613 Ga0496121_0041613_819_2120 393
572 3300048925 Ga0496122_0000029 Ga0496122_0000029_39874_41172 393
573 3300048925 Ga0496122_0000309 Ga0496122_0000309_1338_2615 393
574 3300048926 Ga0496123_0000531 Ga0496123_0000531_24453_25751 393
575 3300048926 Ga0496123_0002465 Ga0496123_0002465_8940_10217 393
576 3300048926 Ga0496123_0009237 Ga0496123_0009237_7573_8871 393
577 3300048927 Ga0496124_0000024 Ga0496124_0000024_286667_287968 393
578 3300048927 Ga0496124_0003968 Ga0496124_0003968_6972_8249 393
579 3300048927 Ga0496124_0072907 Ga0496124_0072907_1273_2571 393
580 3300048927 Ga0496124_0134620 Ga0496124_0134620_463_1740 393
581 3300048928 Ga0496125_0000244 Ga0496125_0000244_32103_33401 393
582 3300048928 Ga0496125_0005992 Ga0496125_0005992_6766_8043 393
583 3300048928 Ga0496125_0008430 Ga0496125_0008430_1590_2888 393
584 3300048929 Ga0496126_0002943 Ga0496126_0002943_10399_11676 393
585 3300048929 Ga0496126_0118593 Ga0496126_0118593_664_1962 393
586 3300049569 Ga0501032_0060679 Ga0501032_0060679_468_1745 393
587 3300049571 Ga0501034_0052060 Ga0501034_0052060_564_1841 393
588 3300049573 Ga0501037_0030549 Ga0501037_0030549_311_1588 393
589 3300049574 Ga0501038_0081611 Ga0501038_0081611_897_2174 393
590 3300049579 Ga0501043_0092676 Ga0501043_0092676_53_1330 393
591 3300049744 Ga0501083_0031941 Ga0501083_0031941_1465_2736 393
592 3300002987 JGI25159J45721_1000015 JGI25159J45721_100001555 394
593 3300003354 JGI25160J50197_1000003 JGI25160J50197_1000003129 394
594 3300003374 JGI25161J50226_1000219 JGI25161J50226_100021931 394
595 3300003771 Ga0055526_1009373 Ga0055526_10093732 394
596 3300003775 Ga0055524_1009805 Ga0055524_10098052 394
597 3300003794 Ga0055531_10016836 Ga0055531_100168362 394
598 3300004625 Ga0055543_1000034 Ga0055543_100003425 394
599 3300005262 Ga0065165_1000025 Ga0065165_1000025203 394
600 3300013249 Ga0171463_1001 Ga0171463_10011154 394
601 3300015690 Ga0183363_1038 Ga0183363_103835 394
602 3300025245 Ga0207425_1016087 Ga0207425_10160871 394
603 3300025273 Ga0209673_1000906 Ga0209673_10009069 394
604 3300025284 Ga0209130_1000005 Ga0209130_1000005352 394
605 3300025294 Ga0209025_1000105 Ga0209025_100010565 394
606 3300025294 Ga0209025_1043031 Ga0209025_10430312 394
607 3300025295 Ga0209564_1000113 Ga0209564_100011340 394
608 3300025298 Ga0209050_1007425 Ga0209050_10074255 394
609 3300025298 Ga0209050_1024793 Ga0209050_10247931 394
610 3300025299 Ga0209256_1000027 Ga0209256_100002767 394
611 3300025299 Ga0209256_1002435 Ga0209256_100243515 394
612 3300025302 Ga0207426_1000015 Ga0207426_1000015247 394
613 3300025303 Ga0209051_1000228 Ga0209051_100022839 394
614 3300025304 Ga0209257_1002062 Ga0209257_100206220 394
615 3300025304 Ga0209257_1002102 Ga0209257_10021022 394
616 3300028794 Ga0307515_10022967 Ga0307515_100229678 394
617 3300037471 Ga0395905_0004201 Ga0395905_0004201_866_2146 394
618 3300037471 Ga0395905_0203134 Ga0395905_0203134_279_1559 394
619 3300046519 Ga0495632_0003395 Ga0495632_0003395_5542_6825 394
620 3300049823 Ga0501044_0094358 Ga0501044_0094358_1067_2347 394
621 3300002773 JGI25152J39213_1002582 JGI25152J39213_10025822 395
622 3300003215 JGI25153J46596_10001280 JGI25153J46596_100012803 395
623 3300003354 JGI25160J50197_1001559 JGI25160J50197_10015594 395
624 3300003374 JGI25161J50226_1000229 JGI25161J50226_10002291 395
625 3300003771 Ga0055526_1000858 Ga0055526_10008583 395
626 3300003775 Ga0055524_1005580 Ga0055524_10055803 395
627 3300003792 Ga0055540_1000797 Ga0055540_100079719 395
628 3300004625 Ga0055543_1000105 Ga0055543_100010577 395
629 3300005262 Ga0065165_1006563 Ga0065165_10065633 395
630 3300025208 Ga0209436_100113 Ga0209436_10011343 395
631 3300025245 Ga0207425_1000470 Ga0207425_100047025 395
632 3300025258 Ga0209129_1001237 Ga0209129_10012373 395
633 3300025258 Ga0209129_1001838 Ga0209129_10018385 395
634 3300025258 Ga0209129_1002820 Ga0209129_10028206 395
635 3300025273 Ga0209673_1000988 Ga0209673_100098840 395
636 3300025284 Ga0209130_1000002 Ga0209130_1000002482 395
637 3300025295 Ga0209564_1000683 Ga0209564_100068325 395
638 3300025297 Ga0209758_1000786 Ga0209758_100078636 395
639 3300025297 Ga0209758_1001945 Ga0209758_100194510 395
640 3300025297 Ga0209758_1003289 Ga0209758_10032899 395
641 3300025299 Ga0209256_1009794 Ga0209256_10097942 395
642 3300025302 Ga0207426_1000013 Ga0207426_1000013482 395
643 3300025304 Ga0209257_1013628 Ga0209257_10136283 395
644 3300046460 Ga0495638_0000833 Ga0495638_0000833_11084_12364 395
645 3300046501 Ga0495607_0000073 Ga0495607_0000073_69832_71157 395
646 3300048091 Ga0495626_0049962 Ga0495626_0049962_157_1482 395
647 3300048909 Ga0496106_0001485 Ga0496106_0001485_6461_7738 395
648 3300048920 Ga0496117_0030079 Ga0496117_0030079_424_1728 395
649 3300048921 Ga0496118_0042727 Ga0496118_0042727_259_1563 395
650 3300053125 Ga0500618_000096 Ga0500618_000096_49810_51126 395
651 3300002773 JGI25152J39213_1001611 JGI25152J39213_10016117 396
652 3300002773 JGI25152J39213_1003990 JGI25152J39213_10039903 396
653 3300002774 JGI25150J39212_1000064 JGI25150J39212_100006424 396
654 3300003187 JGI25151J46595_10000242 JGI25151J46595_1000024250 396
655 3300003215 JGI25153J46596_10003865 JGI25153J46596_100038657 396
656 3300003775 Ga0055524_1004718 Ga0055524_10047182 396
657 3300003775 Ga0055524_1005604 Ga0055524_10056043 396
658 3300003790 Ga0055528_1000622 Ga0055528_10006224 396
659 3300003790 Ga0055528_1024480 Ga0055528_10244802 396
660 3300005335 Ga0070666_10045013 Ga0070666_100450132 396
661 3300006038 Ga0075365_10000983 Ga0075365_100009831 396
662 3300006178 Ga0075367_10005124 Ga0075367_100051244 396
663 3300009177 Ga0105248_10006903 Ga0105248_1000690314 396
664 3300009763 Ga0123340_1036039 Ga0123340_10360392 396
665 3300009765 Ga0123341_1057399 Ga0123341_10573992 396
666 3300009766 Ga0123342_1011229 Ga0123342_10112293 396
667 3300014325 Ga0163163_10178111 Ga0163163_101781112 396
668 3300025245 Ga0207425_1000139 Ga0207425_100013950 396
669 3300025258 Ga0209129_1000066 Ga0209129_100006664 396
670 3300025258 Ga0209129_1000223 Ga0209129_100022326 396
671 3300025258 Ga0209129_1003106 Ga0209129_10031065 396
672 3300025273 Ga0209673_1000024 Ga0209673_1000024198 396
673 3300025273 Ga0209673_1005713 Ga0209673_10057136 396
674 3300025292 Ga0209676_1014920 Ga0209676_10149201 396
675 3300025294 Ga0209025_1000557 Ga0209025_100055730 396
676 3300025294 Ga0209025_1000612 Ga0209025_100061226 396
677 3300025294 Ga0209025_1013668 Ga0209025_10136683 396
678 3300025294 Ga0209025_1016133 Ga0209025_10161332 396
679 3300025294 Ga0209025_1024523 Ga0209025_10245231 396
680 3300025297 Ga0209758_1000495 Ga0209758_100049526 396
681 3300025297 Ga0209758_1035638 Ga0209758_10356382 396
682 3300025299 Ga0209256_1001386 Ga0209256_100138625 396
683 3300025299 Ga0209256_1016066 Ga0209256_10160661 396
684 3300025302 Ga0207426_1017300 Ga0207426_10173002 396
685 3300025303 Ga0209051_1019124 Ga0209051_10191242 396
686 3300025903 Ga0207680_10146461 Ga0207680_101464611 396
687 3300025931 Ga0207644_10107983 Ga0207644_101079832 396
688 3300025941 Ga0207711_10029785 Ga0207711_100297852 396
689 3300031731 Ga0307405_10012088 Ga0307405_100120885 396
690 3300031901 Ga0307406_10004494 Ga0307406_100044944 396
691 3300031911 Ga0307412_10003119 Ga0307412_100031196 396
692 3300035695 Ga0373927_0000144 Ga0373927_0000144_24024_25307 396
693 3300037068 Ga0373925_0000481 Ga0373925_0000481_14025_15308 396
694 3300046460 Ga0495638_0026738 Ga0495638_0026738_840_2231 396
695 3300046660 Ga0495625_0008274 Ga0495625_0008274_6021_7301 396
696 3300048919 Ga0496116_0050618 Ga0496116_0050618_1224_2504 396
697 3300048924 Ga0496121_0134569 Ga0496121_0134569_524_1801 396
698 3300048925 Ga0496122_0054865 Ga0496122_0054865_1238_2515 396
699 3300048925 Ga0496122_0055524 Ga0496122_0055524_1627_2907 396
700 3300048926 Ga0496123_0050246 Ga0496123_0050246_1452_2732 396
701 3300048927 Ga0496124_0003452 Ga0496124_0003452_7337_8617 396
702 3300048929 Ga0496126_0051670 Ga0496126_0051670_1954_3231 396

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09375

Peptidase_M75

Imelysin

79

435

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7xrx-assembly1.cif.gz_A insulin-cleaving membrane protease-icmp 0.7703 17 386
7xrx-assembly1.cif.gz_A insulin-cleaving membrane protease-icmp 0.7216 17 386
3ze3-assembly1.cif.gz_E crystal structure of the integral membrane diacylglycerol kinase - delta7 0.662 303 376
3n8u-assembly1.cif.gz_A crystal structure of an imelysin peptidase (bacova_03801) from bacteroides ovatus at 1.44 a resolution 0.6378 213 394
5xsj-assembly1.cif.gz_L xylfii-lytsn complex 0.622 225 376
ID Description Score Start End Superfamily
3ze3E00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.662 303 376 1.10.287.3610
af_K7KFM6_449_571_1.20.58.390 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Neurotransmitter-gated ion-channel transmembrane domain 0.6333 266 371 1.20.58.390
af_I1L4B1_302_450_1.20.120.520 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);nmb1532 protein domain like 0.6268 225 378 1.20.120.520
4cjzB00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.6245 300 375 1.10.287.3610
af_A0A1D6NZI8_358_467_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.6231 266 369 1.10.287.70
ID Description Score Start End GO Terms
AF-A0A531MP64-F1-model_v4 Peptidase 0.9638 240 396 GO:0030313
AF-A0A531LHJ3-F1-model_v4 Peptidase 0.9627 191 396 GO:0030313
AF-A0A0P9I643-F1-model_v4 deleted 0.9622 232 386
AF-A0A528TLN6-F1-model_v4 Peptidase 0.9615 230 375 GO:0030313
AF-A0A836NVF3-F1-model_v4 deleted 0.9615 248 383

Feature Viewer

pLDDT pTM Quality
80.37 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map