F476100
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 700 | 322 | 1400 | 214 |
Family's Representative Sequence
| Representative Sequence | 3300031728|Ga0316578_10180508|Ga0316578_101805082 |
| Length | 243 |
| Sequence | MLGVGSSVVGAVGVAAGGRILGAMLFRKNAEMVAEADALPGRTDQTMPVPEEHFVNGHPLTGPWPEGMQTVVFGMGCFWGAERKFWQTEGVYSTFAGYAGGYTPNPAYEEVCSGRTGHAEVVGVVFDPEVVTIEQLLKVFWEEHDPTQGMRQGNDVGSQYRSTIYYTDAAHLPAIESSRQMFQQRLAEKGYGEITTEVAPIDFDSAFFYAEPYHQQYLAKNPNGYCGIGGTGVSCPIGVASAD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 4 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 36 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 48 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 50 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 52 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 53 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 54 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 55 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 56 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 57 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 58 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 59 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 60 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 62 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 63 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 66 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 68 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 69 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 70 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 71 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 72 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 73 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 74 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 75 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 77 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009987 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG | Metagenome | Rhizosphere |
| 90 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 102 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 105 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 106 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 108 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 109 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 110 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 111 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 112 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 159 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 160 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 161 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 162 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 163 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 164 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 165 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 166 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 167 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 168 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 169 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 170 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 171 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 172 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 173 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 174 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 175 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 176 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 177 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 178 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 179 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 180 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 181 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 182 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 183 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 184 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 185 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 186 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 187 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 188 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 189 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 190 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 191 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 192 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 193 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 194 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 195 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 196 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 197 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 198 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 199 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 200 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 201 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 202 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 203 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 204 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 205 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 206 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 207 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 208 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 209 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 210 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 211 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 212 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 213 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 261 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 262 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 263 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 264 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 265 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 266 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 267 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 268 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 269 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 270 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 271 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 272 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 273 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 274 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 275 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 276 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 302 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 303 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 304 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 305 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 307 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 308 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 309 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 310 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 316 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 317 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 319 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 320 | 2928142448 | Prescottella equi DPS 2018 | Isolate | Unclassified |
| 321 | 2989771324 | Rhizobium rhizolycopersici DBTS2 | Isolate | Rhizosphere |
| 322 | 3003665799 | Methylobacterium aquaticum BG2 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.14 |
| Metatranscriptomes | 1.43 |
| Isolates | 0.43 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.14 |
| Nodule | 0 |
| Rhizoplane | 11.57 |
| Rhizosphere | 86.71 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0316578_10180508 | 3300031728 | Bacteria | 1272 |
| 2 | SwRhRL2b_contig_691202 | 2162886007 | Bacteria | 2202 |
| 3 | JGI25407J50210_10000443 | 3300003373 | Bacteria | 8143 |
| 4 | Ga0065715_10299150 | 3300005293 | Bacteria | 1045 |
| 5 | Ga0070658_10008891 | 3300005327 | Bacteria | 8073 |
| 6 | Ga0070658_10039908 | 3300005327 | Bacteria | 3788 |
| 7 | Ga0070658_10093274 | 3300005327 | Bacteria | 2483 |
| 8 | Ga0070676_10047134 | 3300005328 | Bacteria | 2516 |
| 9 | Ga0070683_100006661 | 3300005329 | Bacteria | 9700 |
| 10 | Ga0070683_100064468 | 3300005329 | Bacteria | 3411 |
| 11 | Ga0070683_100315916 | 3300005329 | Bacteria | 1486 |
| 12 | Ga0070690_100048183 | 3300005330 | Bacteria | 2712 |
| 13 | Ga0070670_100260341 | 3300005331 | Bacteria | 1512 |
| 14 | Ga0068869_100133013 | 3300005334 | Bacteria | 1914 |
| 15 | Ga0070680_100025210 | 3300005336 | Bacteria | 4751 |
| 16 | Ga0070680_100078313 | 3300005336 | Bacteria | 2723 |
| 17 | Ga0070680_100113005 | 3300005336 | Bacteria | 2262 |
| 18 | Ga0070682_100005235 | 3300005337 | Bacteria | 7216 |
| 19 | Ga0070682_100159918 | 3300005337 | Bacteria | 1554 |
| 20 | Ga0070682_100195917 | 3300005337 | Bacteria | 1422 |
| 21 | Ga0070682_100597107 | 3300005337 | Bacteria | 871 |
| 22 | Ga0068868_100317209 | 3300005338 | Bacteria | 1327 |
| 23 | Ga0070660_100008871 | 3300005339 | Bacteria | 7049 |
| 24 | Ga0070660_100019607 | 3300005339 | Bacteria | 4959 |
| 25 | Ga0070660_100475643 | 3300005339 | Bacteria | 1038 |
| 26 | Ga0070691_10095947 | 3300005341 | Bacteria | 1468 |
| 27 | Ga0070687_100052387 | 3300005343 | Bacteria | 2118 |
| 28 | Ga0070661_100280789 | 3300005344 | Bacteria | 1292 |
| 29 | Ga0070668_100075748 | 3300005347 | Bacteria | 2627 |
| 30 | Ga0070675_100689443 | 3300005354 | Bacteria | 930 |
| 31 | Ga0070674_100065367 | 3300005356 | Bacteria | 2553 |
| 32 | Ga0070688_100030661 | 3300005365 | Bacteria | 3229 |
| 33 | Ga0070659_100011870 | 3300005366 | Bacteria | 6448 |
| 34 | Ga0070659_100287384 | 3300005366 | Bacteria | 1369 |
| 35 | Ga0070659_100291208 | 3300005366 | Bacteria | 1360 |
| 36 | Ga0070667_100009187 | 3300005367 | Bacteria | 8184 |
| 37 | Ga0070667_100206496 | 3300005367 | Bacteria | 1744 |
| 38 | Ga0070709_10006800 | 3300005434 | Bacteria | 6242 |
| 39 | Ga0070714_100013375 | 3300005435 | Bacteria | 6577 |
| 40 | Ga0070714_100030401 | 3300005435 | Bacteria | 4495 |
| 41 | Ga0070714_100042528 | 3300005435 | Bacteria | 3839 |
| 42 | Ga0070714_100053293 | 3300005435 | Bacteria | 3452 |
| 43 | Ga0070714_100209351 | 3300005435 | Bacteria | 1787 |
| 44 | Ga0070714_100628550 | 3300005435 | Bacteria | 1033 |
| 45 | Ga0070714_100752989 | 3300005435 | Bacteria | 942 |
| 46 | Ga0070714_100984050 | 3300005435 | Bacteria | 821 |
| 47 | Ga0070713_100038702 | 3300005436 | Bacteria | 3866 |
| 48 | Ga0070713_100173576 | 3300005436 | Bacteria | 1932 |
| 49 | Ga0070713_100185746 | 3300005436 | Bacteria | 1871 |
| 50 | Ga0070710_10000102 | 3300005437 | Bacteria | 39413 |
| 51 | Ga0070710_10001658 | 3300005437 | Bacteria | 10488 |
| 52 | Ga0070711_100200572 | 3300005439 | Bacteria | 1539 |
| 53 | Ga0070711_100301353 | 3300005439 | Bacteria | 1274 |
| 54 | Ga0070700_100376806 | 3300005441 | Bacteria | 1060 |
| 55 | Ga0070694_100066953 | 3300005444 | Bacteria | 2465 |
| 56 | Ga0070708_100060523 | 3300005445 | Bacteria | 3380 |
| 57 | Ga0070708_100829826 | 3300005445 | Bacteria | 869 |
| 58 | Ga0070678_100517753 | 3300005456 | Bacteria | 1055 |
| 59 | Ga0070662_100005855 | 3300005457 | Bacteria | 7891 |
| 60 | Ga0070681_10022309 | 3300005458 | Bacteria | 6356 |
| 61 | Ga0070681_10041077 | 3300005458 | Bacteria | 4635 |
| 62 | Ga0070681_10110832 | 3300005458 | Bacteria | 2684 |
| 63 | Ga0070681_10211689 | 3300005458 | Bacteria | 1854 |
| 64 | Ga0068867_100260110 | 3300005459 | Bacteria | 1414 |
| 65 | Ga0070685_10270979 | 3300005466 | Bacteria | 1133 |
| 66 | Ga0070706_100211730 | 3300005467 | Bacteria | 1810 |
| 67 | Ga0070707_100000419 | 3300005468 | Bacteria | 41972 |
| 68 | Ga0070707_100072656 | 3300005468 | Bacteria | 3316 |
| 69 | Ga0070707_100275664 | 3300005468 | Bacteria | 1635 |
| 70 | Ga0070698_100087902 | 3300005471 | Bacteria | 3093 |
| 71 | Ga0070699_100047503 | 3300005518 | Bacteria | 3714 |
| 72 | Ga0070679_100030145 | 3300005530 | Bacteria | 5354 |
| 73 | Ga0070679_100044535 | 3300005530 | Bacteria | 4421 |
| 74 | Ga0070684_100045627 | 3300005535 | Bacteria | 3795 |
| 75 | Ga0070684_100217463 | 3300005535 | Bacteria | 1743 |
| 76 | Ga0070686_100072758 | 3300005544 | Bacteria | 2255 |
| 77 | Ga0070686_100075843 | 3300005544 | Bacteria | 2213 |
| 78 | Ga0070686_100343089 | 3300005544 | Bacteria | 1120 |
| 79 | Ga0070695_100000704 | 3300005545 | Bacteria | 17855 |
| 80 | Ga0070696_100007698 | 3300005546 | Bacteria | 7194 |
| 81 | Ga0070665_100860143 | 3300005548 | Bacteria | 920 |
| 82 | Ga0068855_100043637 | 3300005563 | Bacteria | 5310 |
| 83 | Ga0070664_100924933 | 3300005564 | Bacteria | 818 |
| 84 | Ga0068856_100082176 | 3300005614 | Bacteria | 3197 |
| 85 | Ga0068856_100219651 | 3300005614 | Bacteria | 1916 |
| 86 | Ga0068856_100275753 | 3300005614 | Bacteria | 1698 |
| 87 | Ga0070702_100038518 | 3300005615 | Bacteria | 2663 |
| 88 | Ga0070702_100058417 | 3300005615 | Bacteria | 2235 |
| 89 | Ga0070702_100083113 | 3300005615 | Bacteria | 1923 |
| 90 | Ga0068852_100003990 | 3300005616 | Bacteria | 10374 |
| 91 | Ga0068859_100171889 | 3300005617 | Bacteria | 2248 |
| 92 | Ga0068864_100383780 | 3300005618 | Bacteria | 1332 |
| 93 | Ga0068861_100016199 | 3300005719 | Bacteria | 5269 |
| 94 | Ga0068863_101049067 | 3300005841 | Bacteria | 819 |
| 95 | Ga0068860_100024603 | 3300005843 | Bacteria | 5815 |
| 96 | Ga0081455_10121593 | 3300005937 | Bacteria | 2056 |
| 97 | Ga0081538_10000205 | 3300005981 | Bacteria | 65480 |
| 98 | Ga0081539_10019082 | 3300005985 | Bacteria | 4714 |
| 99 | Ga0081539_10026497 | 3300005985 | Bacteria | 3698 |
| 100 | Ga0070717_10002778 | 3300006028 | Bacteria | 12387 |
| 101 | Ga0070717_10003918 | 3300006028 | Bacteria | 10714 |
| 102 | Ga0075365_10644505 | 3300006038 | Bacteria | 749 |
| 103 | Ga0075364_10027959 | 3300006051 | Bacteria | 3606 |
| 104 | Ga0070716_100016624 | 3300006173 | Bacteria | 3801 |
| 105 | Ga0070716_100263790 | 3300006173 | Bacteria | 1180 |
| 106 | Ga0070712_100275257 | 3300006175 | Bacteria | 1354 |
| 107 | Ga0075362_10303863 | 3300006177 | Bacteria | 792 |
| 108 | Ga0097621_100006510 | 3300006237 | Bacteria | 8298 |
| 109 | Ga0075370_10088421 | 3300006353 | Bacteria | 1786 |
| 110 | Ga0068871_100020594 | 3300006358 | Bacteria | 5055 |
| 111 | Ga0075428_100187507 | 3300006844 | Bacteria | 2237 |
| 112 | Ga0075431_100046842 | 3300006847 | Bacteria | 4459 |
| 113 | Ga0075433_10020593 | 3300006852 | Bacteria | 5520 |
| 114 | Ga0075433_10261367 | 3300006852 | Bacteria | 1534 |
| 115 | Ga0075433_10696874 | 3300006852 | Bacteria | 890 |
| 116 | Ga0075434_100004477 | 3300006871 | Bacteria | 12608 |
| 117 | Ga0075434_100025037 | 3300006871 | Bacteria | 5837 |
| 118 | Ga0075434_100487407 | 3300006871 | Bacteria | 1254 |
| 119 | Ga0068865_100036109 | 3300006881 | Bacteria | 3329 |
| 120 | Ga0068865_100202519 | 3300006881 | Bacteria | 1542 |
| 121 | Ga0075436_100014265 | 3300006914 | Bacteria | 5442 |
| 122 | Ga0097620_100171884 | 3300006931 | Bacteria | 2248 |
| 123 | Ga0075435_100136203 | 3300007076 | Bacteria | 2057 |
| 124 | Ga0105240_10104239 | 3300009093 | Bacteria | 3444 |
| 125 | Ga0105240_10165416 | 3300009093 | Bacteria | 2624 |
| 126 | Ga0105240_10207104 | 3300009093 | Bacteria | 2295 |
| 127 | Ga0111539_10100043 | 3300009094 | Bacteria | 3405 |
| 128 | Ga0105245_10005674 | 3300009098 | Bacteria | 10969 |
| 129 | Ga0105245_10156989 | 3300009098 | Bacteria | 2156 |
| 130 | Ga0105247_10094572 | 3300009101 | Bacteria | 1901 |
| 131 | Ga0114129_10206002 | 3300009147 | Bacteria | 2661 |
| 132 | Ga0105243_10112435 | 3300009148 | Bacteria | 2281 |
| 133 | Ga0105243_10211016 | 3300009148 | Bacteria | 1710 |
| 134 | Ga0105241_10626481 | 3300009174 | Bacteria | 974 |
| 135 | Ga0105241_11065384 | 3300009174 | Bacteria | 759 |
| 136 | Ga0105242_10029876 | 3300009176 | Bacteria | 4349 |
| 137 | Ga0105242_10057189 | 3300009176 | Bacteria | 3193 |
| 138 | Ga0105248_10547812 | 3300009177 | Bacteria | 1305 |
| 139 | Ga0105248_10751434 | 3300009177 | Bacteria | 1100 |
| 140 | Ga0105237_10040178 | 3300009545 | Bacteria | 4719 |
| 141 | Ga0105237_10428749 | 3300009545 | Bacteria | 1328 |
| 142 | Ga0105238_10425192 | 3300009551 | Bacteria | 1323 |
| 143 | Ga0105249_10003543 | 3300009553 | Bacteria | 13501 |
| 144 | Ga0105249_10674990 | 3300009553 | Bacteria | 1092 |
| 145 | Ga0105030_107553 | 3300009987 | Bacteria | 924 |
| 146 | Ga0105239_10045384 | 3300010375 | Bacteria | 4816 |
| 147 | Ga0105239_10425840 | 3300010375 | Bacteria | 1504 |
| 148 | Ga0105239_10631950 | 3300010375 | Bacteria | 1222 |
| 149 | Ga0105246_10375257 | 3300011119 | Bacteria | 1173 |
| 150 | Ga0157373_10047036 | 3300013100 | Bacteria | 3078 |
| 151 | Ga0157370_10131682 | 3300013104 | Bacteria | 2332 |
| 152 | Ga0157369_10039718 | 3300013105 | Bacteria | 5142 |
| 153 | Ga0157369_10123087 | 3300013105 | Bacteria | 2751 |
| 154 | Ga0157369_10208098 | 3300013105 | Bacteria | 2051 |
| 155 | Ga0157374_10040366 | 3300013296 | Bacteria | 4297 |
| 156 | Ga0157374_10587118 | 3300013296 | Bacteria | 1123 |
| 157 | Ga0157378_10084787 | 3300013297 | Bacteria | 2869 |
| 158 | Ga0163162_10123772 | 3300013306 | Bacteria | 2691 |
| 159 | Ga0163162_10174932 | 3300013306 | Bacteria | 2272 |
| 160 | Ga0157372_10127943 | 3300013307 | Bacteria | 2921 |
| 161 | Ga0157372_10148858 | 3300013307 | Bacteria | 2701 |
| 162 | Ga0157372_10781183 | 3300013307 | Bacteria | 1110 |
| 163 | Ga0157375_10032608 | 3300013308 | Bacteria | 4942 |
| 164 | Ga0157375_10048336 | 3300013308 | Bacteria | 4161 |
| 165 | Ga0157375_10428836 | 3300013308 | Bacteria | 1488 |
| 166 | Ga0157375_10436578 | 3300013308 | Bacteria | 1475 |
| 167 | Ga0163163_10141022 | 3300014325 | Bacteria | 2452 |
| 168 | Ga0182008_10012847 | 3300014497 | Bacteria | 4412 |
| 169 | Ga0157379_10102448 | 3300014968 | Bacteria | 2570 |
| 170 | Ga0157376_10019535 | 3300014969 | Bacteria | 5225 |
| 171 | Ga0157376_10359635 | 3300014969 | Bacteria | 1396 |
| 172 | Ga0157376_10707875 | 3300014969 | Bacteria | 1013 |
| 173 | Ga0182006_1086609 | 3300015261 | Bacteria | 1133 |
| 174 | Ga0182007_10005740 | 3300015262 | Bacteria | 5409 |
| 175 | Ga0163161_10036691 | 3300017792 | Bacteria | 3511 |
| 176 | Ga0197907_10239323 | 3300020069 | Bacteria | 779 |
| 177 | Ga0206356_10210716 | 3300020070 | Bacteria | 2899 |
| 178 | Ga0206356_10874498 | 3300020070 | Bacteria | 1120 |
| 179 | Ga0206354_10222102 | 3300020081 | Bacteria | 1213 |
| 180 | Ga0206354_10456579 | 3300020081 | Bacteria | 1418 |
| 181 | Ga0206353_10469699 | 3300020082 | Bacteria | 2849 |
| 182 | Ga0206353_10475768 | 3300020082 | Bacteria | 9040 |
| 183 | Ga0224712_10175101 | 3300022467 | Bacteria | 964 |
| 184 | Ga0224712_10237863 | 3300022467 | Bacteria | 838 |
| 185 | Ga0224712_10286841 | 3300022467 | Bacteria | 767 |
| 186 | Ga0207692_10002158 | 3300025898 | Bacteria | 7516 |
| 187 | Ga0207692_10101451 | 3300025898 | Bacteria | 1580 |
| 188 | Ga0207642_10171435 | 3300025899 | Bacteria | 1174 |
| 189 | Ga0207688_10026836 | 3300025901 | Bacteria | 3168 |
| 190 | Ga0207685_10197152 | 3300025905 | Bacteria | 944 |
| 191 | Ga0207699_10097222 | 3300025906 | Bacteria | 1860 |
| 192 | Ga0207645_10053431 | 3300025907 | Bacteria | 2582 |
| 193 | Ga0207705_10040487 | 3300025909 | Bacteria | 3342 |
| 194 | Ga0207705_10176125 | 3300025909 | Bacteria | 1612 |
| 195 | Ga0207684_10292356 | 3300025910 | Bacteria | 1405 |
| 196 | Ga0207684_10497953 | 3300025910 | Bacteria | 1044 |
| 197 | Ga0207654_10060409 | 3300025911 | Bacteria | 2214 |
| 198 | Ga0207707_10016657 | 3300025912 | Bacteria | 6407 |
| 199 | Ga0207707_10071646 | 3300025912 | Bacteria | 3020 |
| 200 | Ga0207707_10442976 | 3300025912 | Bacteria | 1112 |
| 201 | Ga0207695_10133223 | 3300025913 | Bacteria | 2441 |
| 202 | Ga0207671_10029673 | 3300025914 | Bacteria | 4082 |
| 203 | Ga0207693_10006840 | 3300025915 | Bacteria | 9419 |
| 204 | Ga0207693_10008431 | 3300025915 | Bacteria | 8432 |
| 205 | Ga0207663_10022084 | 3300025916 | Bacteria | 3633 |
| 206 | Ga0207663_10128312 | 3300025916 | Bacteria | 1748 |
| 207 | Ga0207663_10629307 | 3300025916 | Bacteria | 845 |
| 208 | Ga0207660_10009617 | 3300025917 | Bacteria | 6258 |
| 209 | Ga0207660_10142071 | 3300025917 | Bacteria | 1836 |
| 210 | Ga0207660_10283839 | 3300025917 | Bacteria | 1315 |
| 211 | Ga0207657_10002568 | 3300025919 | Bacteria | 19643 |
| 212 | Ga0207657_10005522 | 3300025919 | Bacteria | 13205 |
| 213 | Ga0207657_10024904 | 3300025919 | Bacteria | 5531 |
| 214 | Ga0207657_10304618 | 3300025919 | Bacteria | 1262 |
| 215 | Ga0207657_10621990 | 3300025919 | Bacteria | 842 |
| 216 | Ga0207649_10149222 | 3300025920 | Bacteria | 1608 |
| 217 | Ga0207652_10011628 | 3300025921 | Bacteria | 7100 |
| 218 | Ga0207652_10054507 | 3300025921 | Bacteria | 3438 |
| 219 | Ga0207652_10146043 | 3300025921 | Bacteria | 2117 |
| 220 | Ga0207652_10320104 | 3300025921 | Bacteria | 1400 |
| 221 | Ga0207652_10546389 | 3300025921 | Bacteria | 1041 |
| 222 | Ga0207646_10008847 | 3300025922 | Bacteria | 10033 |
| 223 | Ga0207646_10193061 | 3300025922 | Bacteria | 1839 |
| 224 | Ga0207694_10019641 | 3300025924 | Bacteria | 5111 |
| 225 | Ga0207687_10015043 | 3300025927 | Bacteria | 5068 |
| 226 | Ga0207687_10119832 | 3300025927 | Bacteria | 1966 |
| 227 | Ga0207687_10157794 | 3300025927 | Bacteria | 1738 |
| 228 | Ga0207700_10030457 | 3300025928 | Bacteria | 3822 |
| 229 | Ga0207700_10041146 | 3300025928 | Bacteria | 3379 |
| 230 | Ga0207700_10223948 | 3300025928 | Bacteria | 1596 |
| 231 | Ga0207700_10731134 | 3300025928 | Bacteria | 884 |
| 232 | Ga0207664_10030721 | 3300025929 | Bacteria | 4104 |
| 233 | Ga0207664_10096733 | 3300025929 | Bacteria | 2431 |
| 234 | Ga0207690_10024176 | 3300025932 | Bacteria | 3802 |
| 235 | Ga0207690_10184605 | 3300025932 | Bacteria | 1573 |
| 236 | Ga0207690_10242189 | 3300025932 | Bacteria | 1390 |
| 237 | Ga0207706_10010223 | 3300025933 | Bacteria | 8584 |
| 238 | Ga0207686_10181374 | 3300025934 | Bacteria | 1493 |
| 239 | Ga0207704_10019816 | 3300025938 | Bacteria | 3543 |
| 240 | Ga0207704_10230536 | 3300025938 | Bacteria | 1377 |
| 241 | Ga0207665_10000946 | 3300025939 | Bacteria | 19627 |
| 242 | Ga0207691_10736877 | 3300025940 | Bacteria | 830 |
| 243 | Ga0207711_10541536 | 3300025941 | Bacteria | 1086 |
| 244 | Ga0207661_10008536 | 3300025944 | Bacteria | 7322 |
| 245 | Ga0207661_10441661 | 3300025944 | Bacteria | 1184 |
| 246 | Ga0207661_10748865 | 3300025944 | Bacteria | 899 |
| 247 | Ga0207667_10416031 | 3300025949 | Bacteria | 1368 |
| 248 | Ga0207667_10676163 | 3300025949 | Bacteria | 1036 |
| 249 | Ga0207651_10114467 | 3300025960 | Bacteria | 2032 |
| 250 | Ga0207668_10008394 | 3300025972 | Bacteria | 6154 |
| 251 | Ga0207658_10005445 | 3300025986 | Bacteria | 8729 |
| 252 | Ga0207658_10324825 | 3300025986 | Bacteria | 1333 |
| 253 | Ga0207677_10152248 | 3300026023 | Bacteria | 1786 |
| 254 | Ga0207677_10194632 | 3300026023 | Bacteria | 1606 |
| 255 | Ga0207708_10026374 | 3300026075 | Bacteria | 4397 |
| 256 | Ga0207708_10416371 | 3300026075 | Bacteria | 1114 |
| 257 | Ga0207702_10055882 | 3300026078 | Bacteria | 3349 |
| 258 | Ga0207702_10100810 | 3300026078 | Bacteria | 2548 |
| 259 | Ga0207702_10267110 | 3300026078 | Bacteria | 1613 |
| 260 | Ga0207702_10572702 | 3300026078 | Bacteria | 1106 |
| 261 | Ga0207641_10157185 | 3300026088 | Bacteria | 2064 |
| 262 | Ga0207641_10919809 | 3300026088 | Bacteria | 869 |
| 263 | Ga0207648_10014326 | 3300026089 | Bacteria | 7329 |
| 264 | Ga0207648_10459384 | 3300026089 | Bacteria | 1160 |
| 265 | Ga0207676_11184744 | 3300026095 | Bacteria | 757 |
| 266 | Ga0207675_100000798 | 3300026118 | Bacteria | 31278 |
| 267 | Ga0207675_100171883 | 3300026118 | Bacteria | 2072 |
| 268 | Ga0207675_100244884 | 3300026118 | Bacteria | 1733 |
| 269 | Ga0207675_100529317 | 3300026118 | Bacteria | 1176 |
| 270 | Ga0207683_10121394 | 3300026121 | Bacteria | 2346 |
| 271 | Ga0207683_11081125 | 3300026121 | Bacteria | 744 |
| 272 | Ga0207698_10348969 | 3300026142 | Bacteria | 1397 |
| 273 | Ga0207698_10819469 | 3300026142 | Bacteria | 934 |
| 274 | Ga0207698_11168735 | 3300026142 | Bacteria | 783 |
| 275 | Ga0268265_10270798 | 3300028380 | Bacteria | 1515 |
| 276 | Ga0268264_10278241 | 3300028381 | Bacteria | 1566 |
| 277 | Ga0265331_10084818 | 3300031250 | Bacteria | 1468 |
| 278 | Ga0265327_10002128 | 3300031251 | Bacteria | 21899 |
| 279 | Ga0265327_10005773 | 3300031251 | Bacteria | 10188 |
| 280 | Ga0316579_10104373 | 3300031691 | Bacteria | 1359 |
| 281 | Ga0316576_10024195 | 3300031727 | Bacteria | 4239 |
| 282 | Ga0316576_10130751 | 3300031727 | Bacteria | 1889 |
| 283 | Ga0316576_10197982 | 3300031727 | Bacteria | 1514 |
| 284 | Ga0316576_10373303 | 3300031727 | Bacteria | 1059 |
| 285 | Ga0316578_10025219 | 3300031728 | Bacteria | 3341 |
| 286 | Ga0316578_10072631 | 3300031728 | Bacteria | 2038 |
| 287 | Ga0316578_10191500 | 3300031728 | Bacteria | 1232 |
| 288 | Ga0307405_10104166 | 3300031731 | Bacteria | 1909 |
| 289 | Ga0307413_10034170 | 3300031824 | Bacteria | 2903 |
| 290 | Ga0307407_10226155 | 3300031903 | Bacteria | 1268 |
| 291 | Ga0307409_100150130 | 3300031995 | Bacteria | 2022 |
| 292 | Ga0307409_100177418 | 3300031995 | Bacteria | 1882 |
| 293 | Ga0307416_100215138 | 3300032002 | Bacteria | 1837 |
| 294 | Ga0307416_100938554 | 3300032002 | Bacteria | 967 |
| 295 | Ga0307411_10206879 | 3300032005 | Bacteria | 1512 |
| 296 | Ga0307415_100217807 | 3300032126 | Bacteria | 1528 |
| 297 | Ga0316585_10057529 | 3300032137 | Bacteria | 1253 |
| 298 | Ga0373941_0049426 | 3300035115 | Bacteria | 1331 |
| 299 | Ga0373953_0028854 | 3300035117 | Bacteria | 2143 |
| 300 | Ga0373960_0045608 | 3300035121 | Bacteria | 1284 |
| 301 | Ga0373955_0301647 | 3300035172 | Bacteria | 966 |
| 302 | Ga0373961_0017979 | 3300035241 | Bacteria | 1841 |
| 303 | Ga0373962_0165242 | 3300035242 | Bacteria | 732 |
| 304 | Ga0316574_0002742 | 3300035398 | Bacteria | 8931 |
| 305 | Ga0316574_0018461 | 3300035398 | Bacteria | 4099 |
| 306 | Ga0316574_0030591 | 3300035398 | Bacteria | 3262 |
| 307 | Ga0316574_0083363 | 3300035398 | Bacteria | 2032 |
| 308 | Ga0316574_0117568 | 3300035398 | Bacteria | 1706 |
| 309 | Ga0316574_0125401 | 3300035398 | Bacteria | 1650 |
| 310 | Ga0316574_0198966 | 3300035398 | Bacteria | 1287 |
| 311 | Ga0316574_0199798 | 3300035398 | Bacteria | 1284 |
| 312 | Ga0316574_0569202 | 3300035398 | Bacteria | 702 |
| 313 | Ga0373931_0074508 | 3300035691 | Bacteria | 1860 |
| 314 | Ga0373935_0023503 | 3300035692 | Bacteria | 3788 |
| 315 | Ga0373933_0025413 | 3300035724 | Bacteria | 3397 |
| 316 | Ga0373947_0041375 | 3300035725 | Bacteria | 2747 |
| 317 | Ga0373937_0004396 | 3300036401 | Bacteria | 11976 |
| 318 | Ga0316582_0099244 | 3300036647 | Bacteria | 1927 |
| 319 | Ga0316582_0169116 | 3300036647 | Bacteria | 1483 |
| 320 | Ga0316582_0494347 | 3300036647 | Bacteria | 843 |
| 321 | Ga0316584_0000239 | 3300036712 | Bacteria | 27354 |
| 322 | Ga0316584_0118244 | 3300036712 | Bacteria | 1982 |
| 323 | Ga0316584_0239719 | 3300036712 | Bacteria | 1327 |
| 324 | Ga0316584_0335747 | 3300036712 | Bacteria | 1087 |
| 325 | Ga0373925_0007980 | 3300037068 | Bacteria | 7706 |
| 326 | Ga0395899_0020687 | 3300037312 | Bacteria | 4989 |
| 327 | Ga0395899_0039277 | 3300037312 | Bacteria | 3543 |
| 328 | Ga0395900_0092858 | 3300037418 | Bacteria | 3100 |
| 329 | Ga0395900_0124572 | 3300037418 | Bacteria | 2643 |
| 330 | Ga0395900_0924032 | 3300037418 | Bacteria | 795 |
| 331 | Ga0395898_0036854 | 3300037466 | Bacteria | 4853 |
| 332 | Ga0395898_0552884 | 3300037466 | Bacteria | 1093 |
| 333 | Ga0395898_0673579 | 3300037466 | Bacteria | 976 |
| 334 | Ga0395898_0838246 | 3300037466 | Bacteria | 859 |
| 335 | Ga0395905_0015546 | 3300037471 | Bacteria | 7232 |
| 336 | Ga0395905_0129913 | 3300037471 | Bacteria | 2369 |
| 337 | Ga0395905_0235326 | 3300037471 | Bacteria | 1712 |
| 338 | Ga0395901_0028309 | 3300038443 | Bacteria | 5763 |
| 339 | Ga0395901_0028793 | 3300038443 | Bacteria | 5714 |
| 340 | Ga0395901_0154283 | 3300038443 | Bacteria | 2412 |
| 341 | Ga0395901_0202923 | 3300038443 | Bacteria | 2078 |
| 342 | Ga0395901_0369845 | 3300038443 | Bacteria | 1477 |
| 343 | Ga0395901_0411114 | 3300038443 | Bacteria | 1389 |
| 344 | Ga0439461_0011900 | 3300041410 | Bacteria | 1621 |
| 345 | Ga0451807_0927106 | 3300041486 | Bacteria | 1150 |
| 346 | Ga0451849_0624889 | 3300041505 | Bacteria | 1164 |
| 347 | Ga0451843_1307445 | 3300041509 | Bacteria | 869 |
| 348 | Ga0439463_063506 | 3300042016 | Bacteria | 944 |
| 349 | Ga0439464_0020823 | 3300042439 | Bacteria | 1798 |
| 350 | Ga0451577_0082891 | 3300042876 | Bacteria | 2860 |
| 351 | Ga0451577_0142457 | 3300042876 | Bacteria | 2155 |
| 352 | Ga0451577_0893472 | 3300042876 | Bacteria | 800 |
| 353 | Ga0466969_0112443 | 3300044656 | Bacteria | 1273 |
| 354 | Ga0466965_0129422 | 3300044683 | Bacteria | 1308 |
| 355 | Ga0466966_0039736 | 3300044684 | Bacteria | 3029 |
| 356 | Ga0466966_0043172 | 3300044684 | Bacteria | 2891 |
| 357 | Ga0466961_0035809 | 3300044693 | Bacteria | 3186 |
| 358 | Ga0466961_0035820 | 3300044693 | Bacteria | 3186 |
| 359 | Ga0466961_0055122 | 3300044693 | Bacteria | 2535 |
| 360 | Ga0466961_0058624 | 3300044693 | Bacteria | 2449 |
| 361 | Ga0466963_0001574 | 3300044694 | Bacteria | 12377 |
| 362 | Ga0466963_0001608 | 3300044694 | Bacteria | 12290 |
| 363 | Ga0466963_0002028 | 3300044694 | Bacteria | 11134 |
| 364 | Ga0466963_0004500 | 3300044694 | Bacteria | 8108 |
| 365 | Ga0466963_0055327 | 3300044694 | Bacteria | 2638 |
| 366 | Ga0466963_0055943 | 3300044694 | Bacteria | 2624 |
| 367 | Ga0466963_0082917 | 3300044694 | Bacteria | 2174 |
| 368 | Ga0466963_0106839 | 3300044694 | Bacteria | 1919 |
| 369 | Ga0466963_0181969 | 3300044694 | Bacteria | 1467 |
| 370 | Ga0466964_0000623 | 3300044706 | Bacteria | 11276 |
| 371 | Ga0466964_0008065 | 3300044706 | Bacteria | 3949 |
| 372 | Ga0466964_0011344 | 3300044706 | Bacteria | 3365 |
| 373 | Ga0466964_0016464 | 3300044706 | Bacteria | 2824 |
| 374 | Ga0466964_0041461 | 3300044706 | Bacteria | 1862 |
| 375 | Ga0466964_0140836 | 3300044706 | Bacteria | 1108 |
| 376 | Ga0453684_0027133 | 3300044712 | Bacteria | 8230 |
| 377 | Ga0453684_0143007 | 3300044712 | Bacteria | 2853 |
| 378 | Ga0466971_0001290 | 3300044719 | Bacteria | 10463 |
| 379 | Ga0466971_0101499 | 3300044719 | Bacteria | 1322 |
| 380 | Ga0466968_0000609 | 3300044735 | Bacteria | 12198 |
| 381 | Ga0466968_0003041 | 3300044735 | Bacteria | 6200 |
| 382 | Ga0466968_0021560 | 3300044735 | Bacteria | 2610 |
| 383 | Ga0466970_0002453 | 3300044765 | Bacteria | 8963 |
| 384 | Ga0466970_0032433 | 3300044765 | Bacteria | 2760 |
| 385 | Ga0466957_0004222 | 3300044842 | Bacteria | 7967 |
| 386 | Ga0466957_0008159 | 3300044842 | Bacteria | 5945 |
| 387 | Ga0466957_0013157 | 3300044842 | Bacteria | 4797 |
| 388 | Ga0466957_0042651 | 3300044842 | Bacteria | 2745 |
| 389 | Ga0466957_0097060 | 3300044842 | Bacteria | 1853 |
| 390 | Ga0466957_0115973 | 3300044842 | Bacteria | 1703 |
| 391 | Ga0466957_0129689 | 3300044842 | Bacteria | 1614 |
| 392 | Ga0466957_0324655 | 3300044842 | Bacteria | 1039 |
| 393 | Ga0466960_0207199 | 3300044901 | Bacteria | 1074 |
| 394 | Ga0466959_0000893 | 3300045049 | Bacteria | 17563 |
| 395 | Ga0466959_0029476 | 3300045049 | Bacteria | 4065 |
| 396 | Ga0466959_0221948 | 3300045049 | Bacteria | 1310 |
| 397 | Ga0451576_0411635 | 3300045051 | Bacteria | 1418 |
| 398 | Ga0466958_0006798 | 3300045836 | Bacteria | 6251 |
| 399 | Ga0466958_0007273 | 3300045836 | Bacteria | 6076 |
| 400 | Ga0466958_0011438 | 3300045836 | Bacteria | 4998 |
| 401 | Ga0466958_0023424 | 3300045836 | Bacteria | 3625 |
| 402 | Ga0466958_0026177 | 3300045836 | Bacteria | 3446 |
| 403 | Ga0466958_0028853 | 3300045836 | Bacteria | 3292 |
| 404 | Ga0466958_0079385 | 3300045836 | Bacteria | 2018 |
| 405 | Ga0466958_0083619 | 3300045836 | Bacteria | 1967 |
| 406 | Ga0466958_0122486 | 3300045836 | Bacteria | 1629 |
| 407 | Ga0466967_0000644 | 3300045976 | Bacteria | 17538 |
| 408 | Ga0466967_0004885 | 3300045976 | Bacteria | 9157 |
| 409 | Ga0466967_0013585 | 3300045976 | Bacteria | 6300 |
| 410 | Ga0466967_0018574 | 3300045976 | Bacteria | 5561 |
| 411 | Ga0466967_0020900 | 3300045976 | Bacteria | 5303 |
| 412 | Ga0466967_0037623 | 3300045976 | Bacteria | 4143 |
| 413 | Ga0466967_0044005 | 3300045976 | Bacteria | 3869 |
| 414 | Ga0466967_0061234 | 3300045976 | Bacteria | 3338 |
| 415 | Ga0466967_0123551 | 3300045976 | Bacteria | 2395 |
| 416 | Ga0466967_0160100 | 3300045976 | Bacteria | 2112 |
| 417 | Ga0466967_0175632 | 3300045976 | Bacteria | 2018 |
| 418 | Ga0466967_0186775 | 3300045976 | Bacteria | 1957 |
| 419 | Ga0466967_0234317 | 3300045976 | Bacteria | 1749 |
| 420 | Ga0495592_0002355 | 3300046454 | Bacteria | 13343 |
| 421 | Ga0495592_0022401 | 3300046454 | Bacteria | 4806 |
| 422 | Ga0495592_0070069 | 3300046454 | Bacteria | 2556 |
| 423 | Ga0495592_0237890 | 3300046454 | Bacteria | 1209 |
| 424 | Ga0495603_0002125 | 3300046455 | Bacteria | 11652 |
| 425 | Ga0495629_0028444 | 3300046459 | Bacteria | 3968 |
| 426 | Ga0495629_0269702 | 3300046459 | Bacteria | 1169 |
| 427 | Ga0495641_0003631 | 3300046461 | Bacteria | 11422 |
| 428 | Ga0495641_0032732 | 3300046461 | Bacteria | 2472 |
| 429 | Ga0495641_0041082 | 3300046461 | Bacteria | 2149 |
| 430 | Ga0495651_0000299 | 3300046462 | Bacteria | 38596 |
| 431 | Ga0495651_0239124 | 3300046462 | Bacteria | 1246 |
| 432 | Ga0495653_0008062 | 3300046463 | Bacteria | 8627 |
| 433 | Ga0495653_0009274 | 3300046463 | Bacteria | 8053 |
| 434 | Ga0495653_0137086 | 3300046463 | Bacteria | 1725 |
| 435 | Ga0495653_0464120 | 3300046463 | Bacteria | 794 |
| 436 | Ga0495580_0022747 | 3300046472 | Bacteria | 4608 |
| 437 | Ga0495582_0042539 | 3300046473 | Bacteria | 2502 |
| 438 | Ga0495582_0269376 | 3300046473 | Bacteria | 977 |
| 439 | Ga0495639_0001735 | 3300046475 | Bacteria | 9657 |
| 440 | Ga0495662_0049025 | 3300046476 | Bacteria | 2039 |
| 441 | Ga0495664_0037058 | 3300046477 | Bacteria | 2877 |
| 442 | Ga0495664_0354066 | 3300046477 | Bacteria | 884 |
| 443 | Ga0495584_0022196 | 3300046491 | Bacteria | 3222 |
| 444 | Ga0495594_0402077 | 3300046499 | Bacteria | 779 |
| 445 | Ga0495608_0011135 | 3300046511 | Bacteria | 6261 |
| 446 | Ga0495608_0058564 | 3300046511 | Bacteria | 2539 |
| 447 | Ga0495608_0324441 | 3300046511 | Bacteria | 951 |
| 448 | Ga0495618_0002083 | 3300046514 | Bacteria | 13126 |
| 449 | Ga0495618_0125929 | 3300046514 | Bacteria | 1640 |
| 450 | Ga0495618_0339679 | 3300046514 | Bacteria | 927 |
| 451 | Ga0495628_0000067 | 3300046516 | Bacteria | 85377 |
| 452 | Ga0495628_0083342 | 3300046516 | Bacteria | 2482 |
| 453 | Ga0495628_0335284 | 3300046516 | Bacteria | 1114 |
| 454 | Ga0495630_0061568 | 3300046517 | Bacteria | 2818 |
| 455 | Ga0495630_0617354 | 3300046517 | Bacteria | 831 |
| 456 | Ga0495644_0009907 | 3300046523 | Bacteria | 3670 |
| 457 | Ga0495652_0001269 | 3300046529 | Bacteria | 28245 |
| 458 | Ga0495652_0156288 | 3300046529 | Bacteria | 1775 |
| 459 | Ga0495652_0419531 | 3300046529 | Bacteria | 943 |
| 460 | Ga0495665_0001210 | 3300046531 | Bacteria | 13779 |
| 461 | Ga0495640_0006921 | 3300046533 | Bacteria | 8930 |
| 462 | Ga0495640_0137702 | 3300046533 | Bacteria | 1575 |
| 463 | Ga0495587_0001677 | 3300046536 | Bacteria | 14782 |
| 464 | Ga0495587_0012004 | 3300046536 | Bacteria | 5471 |
| 465 | Ga0495587_0224099 | 3300046536 | Bacteria | 1060 |
| 466 | Ga0495609_0187623 | 3300046538 | Bacteria | 868 |
| 467 | Ga0495645_0000189 | 3300046543 | Bacteria | 43923 |
| 468 | Ga0495645_0021648 | 3300046543 | Bacteria | 4646 |
| 469 | Ga0495656_0003714 | 3300046615 | Bacteria | 5180 |
| 470 | Ga0495634_0020805 | 3300046642 | Bacteria | 4648 |
| 471 | Ga0495635_0018320 | 3300046663 | Bacteria | 4886 |
| 472 | Ga0495635_0317824 | 3300046663 | Bacteria | 1042 |
| 473 | Ga0495659_0001465 | 3300046664 | Bacteria | 8010 |
| 474 | Ga0495659_0034307 | 3300046664 | Bacteria | 1784 |
| 475 | Ga0495657_0007359 | 3300046675 | Bacteria | 8513 |
| 476 | Ga0495657_0128908 | 3300046675 | Bacteria | 1586 |
| 477 | Ga0495657_0176793 | 3300046675 | Bacteria | 1312 |
| 478 | Ga0495599_0000651 | 3300046678 | Bacteria | 19603 |
| 479 | Ga0495599_0003138 | 3300046678 | Bacteria | 9632 |
| 480 | Ga0495599_0217337 | 3300046678 | Bacteria | 1170 |
| 481 | Ga0495623_0000160 | 3300046679 | Bacteria | 41833 |
| 482 | Ga0495623_0039418 | 3300046679 | Bacteria | 3019 |
| 483 | Ga0495646_0019153 | 3300046680 | Bacteria | 4334 |
| 484 | Ga0495646_0038268 | 3300046680 | Bacteria | 2962 |
| 485 | Ga0495647_0000745 | 3300046681 | Bacteria | 9670 |
| 486 | Ga0495658_0002149 | 3300046683 | Bacteria | 9974 |
| 487 | Ga0495613_0011630 | 3300046689 | Bacteria | 6542 |
| 488 | Ga0495613_0218962 | 3300046689 | Bacteria | 1337 |
| 489 | Ga0495624_0051807 | 3300046690 | Bacteria | 2595 |
| 490 | Ga0495624_0056598 | 3300046690 | Bacteria | 2467 |
| 491 | Ga0495671_0120232 | 3300046692 | Bacteria | 1282 |
| 492 | Ga0495600_0139502 | 3300046809 | Bacteria | 1573 |
| 493 | Ga0495581_0015107 | 3300047315 | Bacteria | 4482 |
| 494 | Ga0495604_0000076 | 3300047317 | Bacteria | 85332 |
| 495 | Ga0495604_0215647 | 3300047317 | Bacteria | 1324 |
| 496 | Ga0495604_0228692 | 3300047317 | Bacteria | 1277 |
| 497 | Ga0495604_0286992 | 3300047317 | Bacteria | 1110 |
| 498 | Ga0495674_0024067 | 3300047319 | Bacteria | 5603 |
| 499 | Ga0495674_0182597 | 3300047319 | Bacteria | 1746 |
| 500 | Ga0495674_0266357 | 3300047319 | Bacteria | 1407 |
| 501 | Ga0495674_0328039 | 3300047319 | Bacteria | 1245 |
| 502 | Ga0495680_0006437 | 3300047322 | Bacteria | 10911 |
| 503 | Ga0495680_0259052 | 3300047322 | Bacteria | 1230 |
| 504 | Ga0495675_0002790 | 3300047444 | Bacteria | 10479 |
| 505 | Ga0495675_0155896 | 3300047444 | Bacteria | 1409 |
| 506 | Ga0495677_0085935 | 3300047445 | Bacteria | 1182 |
| 507 | Ga0495684_0051391 | 3300047471 | Bacteria | 3145 |
| 508 | Ga0495684_0244915 | 3300047471 | Bacteria | 1306 |
| 509 | Ga0495684_0335074 | 3300047471 | Bacteria | 1078 |
| 510 | Ga0495593_0002806 | 3300047673 | Bacteria | 10493 |
| 511 | Ga0495602_0007098 | 3300048088 | Bacteria | 11759 |
| 512 | Ga0495602_0097293 | 3300048088 | Bacteria | 2425 |
| 513 | Ga0495602_0104166 | 3300048088 | Bacteria | 2322 |
| 514 | Ga0495602_0360631 | 3300048088 | Bacteria | 1046 |
| 515 | Ga0496100_0049607 | 3300048903 | Bacteria | 2715 |
| 516 | Ga0496100_0053761 | 3300048903 | Bacteria | 2624 |
| 517 | Ga0496100_0165497 | 3300048903 | Bacteria | 1588 |
| 518 | Ga0496100_0274940 | 3300048903 | Bacteria | 1254 |
| 519 | Ga0496101_0030264 | 3300048904 | Bacteria | 3794 |
| 520 | Ga0496101_0071695 | 3300048904 | Bacteria | 2540 |
| 521 | Ga0496102_0029927 | 3300048905 | Bacteria | 4872 |
| 522 | Ga0496102_0085477 | 3300048905 | Bacteria | 2913 |
| 523 | Ga0496102_0106229 | 3300048905 | Bacteria | 2612 |
| 524 | Ga0496102_0131179 | 3300048905 | Bacteria | 2346 |
| 525 | Ga0496102_0600885 | 3300048905 | Bacteria | 1023 |
| 526 | Ga0496103_0174873 | 3300048906 | Bacteria | 1379 |
| 527 | Ga0496104_0004084 | 3300048907 | Bacteria | 12670 |
| 528 | Ga0496104_0009843 | 3300048907 | Bacteria | 8529 |
| 529 | Ga0496104_0016335 | 3300048907 | Bacteria | 6741 |
| 530 | Ga0496104_0017670 | 3300048907 | Bacteria | 6501 |
| 531 | Ga0496104_0029934 | 3300048907 | Bacteria | 5056 |
| 532 | Ga0496104_0071752 | 3300048907 | Bacteria | 3292 |
| 533 | Ga0496104_0081043 | 3300048907 | Bacteria | 3094 |
| 534 | Ga0496104_0393718 | 3300048907 | Bacteria | 1297 |
| 535 | Ga0496105_0012031 | 3300048908 | Bacteria | 6850 |
| 536 | Ga0496105_0027824 | 3300048908 | Bacteria | 4622 |
| 537 | Ga0496105_0029197 | 3300048908 | Bacteria | 4514 |
| 538 | Ga0496105_0034748 | 3300048908 | Bacteria | 4147 |
| 539 | Ga0496105_0048961 | 3300048908 | Bacteria | 3488 |
| 540 | Ga0496105_0073075 | 3300048908 | Bacteria | 2833 |
| 541 | Ga0496105_0116255 | 3300048908 | Bacteria | 2206 |
| 542 | Ga0496106_0003549 | 3300048909 | Bacteria | 11613 |
| 543 | Ga0496106_0014613 | 3300048909 | Bacteria | 5801 |
| 544 | Ga0496106_0057833 | 3300048909 | Bacteria | 2933 |
| 545 | Ga0496106_0566906 | 3300048909 | Bacteria | 911 |
| 546 | Ga0496107_0004029 | 3300048910 | Bacteria | 9897 |
| 547 | Ga0496107_0128992 | 3300048910 | Bacteria | 1866 |
| 548 | Ga0496107_0286414 | 3300048910 | Bacteria | 1226 |
| 549 | Ga0496107_0352742 | 3300048910 | Bacteria | 1095 |
| 550 | Ga0496108_0097948 | 3300048911 | Bacteria | 2499 |
| 551 | Ga0496108_0115800 | 3300048911 | Bacteria | 2296 |
| 552 | Ga0496108_0126869 | 3300048911 | Bacteria | 2191 |
| 553 | Ga0496108_0161194 | 3300048911 | Bacteria | 1938 |
| 554 | Ga0496108_0184127 | 3300048911 | Bacteria | 1809 |
| 555 | Ga0496108_0571890 | 3300048911 | Bacteria | 985 |
| 556 | Ga0496109_0035851 | 3300048912 | Bacteria | 4478 |
| 557 | Ga0496109_0043495 | 3300048912 | Bacteria | 4071 |
| 558 | Ga0496109_0124744 | 3300048912 | Bacteria | 2400 |
| 559 | Ga0496109_0235630 | 3300048912 | Bacteria | 1722 |
| 560 | Ga0496109_0263588 | 3300048912 | Bacteria | 1623 |
| 561 | Ga0496109_0432767 | 3300048912 | Bacteria | 1243 |
| 562 | Ga0496109_0672730 | 3300048912 | Bacteria | 972 |
| 563 | Ga0496109_0675522 | 3300048912 | Bacteria | 970 |
| 564 | Ga0496109_0803431 | 3300048912 | Bacteria | 879 |
| 565 | Ga0496110_0011011 | 3300048913 | Bacteria | 7380 |
| 566 | Ga0496110_0042257 | 3300048913 | Bacteria | 3979 |
| 567 | Ga0496110_0141725 | 3300048913 | Bacteria | 2173 |
| 568 | Ga0496110_0164268 | 3300048913 | Bacteria | 2013 |
| 569 | Ga0496110_0350087 | 3300048913 | Bacteria | 1346 |
| 570 | Ga0496110_0395418 | 3300048913 | Bacteria | 1260 |
| 571 | Ga0496111_0013436 | 3300048914 | Bacteria | 5572 |
| 572 | Ga0496111_0190643 | 3300048914 | Bacteria | 1524 |
| 573 | Ga0496112_0017476 | 3300048915 | Bacteria | 6739 |
| 574 | Ga0496112_0019234 | 3300048915 | Bacteria | 6441 |
| 575 | Ga0496112_0044280 | 3300048915 | Bacteria | 4361 |
| 576 | Ga0496112_0102328 | 3300048915 | Bacteria | 2834 |
| 577 | Ga0496112_0195180 | 3300048915 | Bacteria | 1985 |
| 578 | Ga0496112_0197404 | 3300048915 | Bacteria | 1972 |
| 579 | Ga0496112_0243081 | 3300048915 | Bacteria | 1752 |
| 580 | Ga0496112_0521093 | 3300048915 | Bacteria | 1123 |
| 581 | Ga0496113_0030451 | 3300048916 | Bacteria | 3906 |
| 582 | Ga0496113_0050630 | 3300048916 | Bacteria | 3097 |
| 583 | Ga0496113_0493758 | 3300048916 | Bacteria | 983 |
| 584 | Ga0496113_0800022 | 3300048916 | Bacteria | 749 |
| 585 | Ga0496113_0982877 | 3300048916 | Bacteria | 665 |
| 586 | Ga0496114_0001888 | 3300048917 | Bacteria | 15905 |
| 587 | Ga0496114_0017232 | 3300048917 | Bacteria | 5828 |
| 588 | Ga0496114_0024731 | 3300048917 | Bacteria | 4902 |
| 589 | Ga0496114_0189387 | 3300048917 | Bacteria | 1799 |
| 590 | Ga0496114_0471727 | 3300048917 | Bacteria | 1110 |
| 591 | Ga0496115_0026528 | 3300048918 | Bacteria | 4522 |
| 592 | Ga0496115_0089250 | 3300048918 | Bacteria | 2517 |
| 593 | Ga0496115_0231695 | 3300048918 | Bacteria | 1523 |
| 594 | Ga0496115_0239047 | 3300048918 | Bacteria | 1497 |
| 595 | Ga0501031_0509479 | 3300049568 | Bacteria | 776 |
| 596 | Ga0501033_0334927 | 3300049570 | Bacteria | 1062 |
| 597 | Ga0501036_0198795 | 3300049572 | Bacteria | 1686 |
| 598 | Ga0501036_0309078 | 3300049572 | Bacteria | 1322 |
| 599 | Ga0501037_0251556 | 3300049573 | Bacteria | 1236 |
| 600 | Ga0501038_0002136 | 3300049574 | Bacteria | 18359 |
| 601 | Ga0501038_0116532 | 3300049574 | Bacteria | 2208 |
| 602 | Ga0501040_0017960 | 3300049576 | Bacteria | 4695 |
| 603 | Ga0501040_0411643 | 3300049576 | Bacteria | 971 |
| 604 | Ga0501041_0049684 | 3300049577 | Bacteria | 2555 |
| 605 | Ga0501042_0028026 | 3300049578 | Bacteria | 3964 |
| 606 | Ga0501042_0166993 | 3300049578 | Bacteria | 1588 |
| 607 | Ga0501046_0098296 | 3300049580 | Bacteria | 2248 |
| 608 | Ga0501048_0024302 | 3300049582 | Bacteria | 4424 |
| 609 | Ga0501067_0067008 | 3300049583 | Bacteria | 1987 |
| 610 | Ga0501068_0673276 | 3300049584 | Bacteria | 676 |
| 611 | Ga0501069_0149593 | 3300049585 | Bacteria | 1341 |
| 612 | Ga0501070_0015664 | 3300049586 | Bacteria | 6374 |
| 613 | Ga0501070_0025430 | 3300049586 | Bacteria | 4966 |
| 614 | Ga0501070_0166824 | 3300049586 | Bacteria | 1814 |
| 615 | Ga0501071_0116033 | 3300049587 | Bacteria | 1982 |
| 616 | Ga0501071_0249562 | 3300049587 | Bacteria | 1339 |
| 617 | Ga0501071_0358520 | 3300049587 | Bacteria | 1110 |
| 618 | Ga0501071_0361413 | 3300049587 | Bacteria | 1106 |
| 619 | Ga0501071_0446553 | 3300049587 | Bacteria | 990 |
| 620 | Ga0501072_0022916 | 3300049588 | Bacteria | 4847 |
| 621 | Ga0501072_0049442 | 3300049588 | Bacteria | 3310 |
| 622 | Ga0501072_0157959 | 3300049588 | Bacteria | 1808 |
| 623 | Ga0501073_0053754 | 3300049589 | Bacteria | 2819 |
| 624 | Ga0501073_0365705 | 3300049589 | Bacteria | 996 |
| 625 | Ga0501074_0019741 | 3300049590 | Bacteria | 4895 |
| 626 | Ga0501074_0589979 | 3300049590 | Bacteria | 786 |
| 627 | Ga0501075_0066104 | 3300049591 | Bacteria | 2729 |
| 628 | Ga0501075_0187278 | 3300049591 | Bacteria | 1579 |
| 629 | Ga0501075_0328588 | 3300049591 | Bacteria | 1165 |
| 630 | Ga0501075_0344404 | 3300049591 | Bacteria | 1136 |
| 631 | Ga0501076_0057600 | 3300049592 | Bacteria | 3086 |
| 632 | Ga0501076_0259757 | 3300049592 | Bacteria | 1422 |
| 633 | Ga0501076_0260458 | 3300049592 | Bacteria | 1420 |
| 634 | Ga0501079_0031751 | 3300049741 | Bacteria | 4058 |
| 635 | Ga0501079_0078891 | 3300049741 | Bacteria | 2547 |
| 636 | Ga0501079_0078995 | 3300049741 | Bacteria | 2545 |
| 637 | Ga0501079_0212310 | 3300049741 | Bacteria | 1512 |
| 638 | Ga0501079_0357942 | 3300049741 | Bacteria | 1144 |
| 639 | Ga0501080_0526405 | 3300049742 | Bacteria | 1054 |
| 640 | Ga0501081_0099858 | 3300049743 | Bacteria | 2051 |
| 641 | Ga0501083_0000397 | 3300049744 | Bacteria | 27678 |
| 642 | Ga0501083_0589594 | 3300049744 | Bacteria | 723 |
| 643 | Ga0501083_0626599 | 3300049744 | Bacteria | 700 |
| 644 | Ga0501045_0022116 | 3300049824 | Bacteria | 4550 |
| 645 | nmdc:mga03n38_164977_c1 | 3300050490 | Bacteria | 1124 |
| 646 | nmdc:mga00v17_176641_c1 | 3300050491 | Bacteria | 1377 |
| 647 | nmdc:mga0k408_268102_c1 | 3300050493 | Bacteria | 1019 |
| 648 | nmdc:mga0qj67_183750_c1 | 3300050509 | Bacteria | 1698 |
| 649 | nmdc:mga0qj67_8371_c1 | 3300050509 | Bacteria | 7668 |
| 650 | nmdc:mga08y16_31109_c1 | 3300050511 | Bacteria | 5615 |
| 651 | nmdc:mga08y16_469694_c1 | 3300050511 | Bacteria | 1281 |
| 652 | nmdc:mga08y16_480488_c1 | 3300050511 | Bacteria | 1264 |
| 653 | nmdc:mga0n895_5544_c1 | 3300050512 | Bacteria | 10568 |
| 654 | nmdc:mga0n895_68995_c1 | 3300050512 | Bacteria | 3502 |
| 655 | nmdc:mga0rr50_46989_c1 | 3300050513 | Bacteria | 3181 |
| 656 | nmdc:mga0rr50_94376_c1 | 3300050513 | Bacteria | 2336 |
| 657 | nmdc:mga0rr50_997587_c1 | 3300050513 | Bacteria | 713 |
| 658 | nmdc:mga08x19_11676_c1 | 3300050514 | Bacteria | 5288 |
| 659 | nmdc:mga08x19_317427_c1 | 3300050514 | Bacteria | 1084 |
| 660 | nmdc:mga0a205_292_c1 | 3300050515 | Bacteria | 29895 |
| 661 | nmdc:mga0a205_520499_c1 | 3300050515 | Bacteria | 1046 |
| 662 | Ga0495601_0000686 | 3300053077 | Bacteria | 18146 |
| 663 | Ga0495601_0024870 | 3300053077 | Bacteria | 3689 |
| 664 | Ga0495601_0110446 | 3300053077 | Bacteria | 1780 |
| 665 | Ga0495601_0231566 | 3300053077 | Bacteria | 1207 |
| 666 | Ga0495612_0018825 | 3300053078 | Bacteria | 2765 |
| 667 | Ga0495612_0138916 | 3300053078 | Bacteria | 1053 |
| 668 | Ga0495655_0032180 | 3300053083 | Bacteria | 1281 |
| 669 | Ga0495595_0017789 | 3300053084 | Bacteria | 3062 |
| 670 | Ga0495595_0043295 | 3300053084 | Bacteria | 2064 |
| 671 | Ga0495595_0051477 | 3300053084 | Bacteria | 1909 |
| 672 | Ga0495595_0162827 | 3300053084 | Bacteria | 1101 |
| 673 | Ga0495619_0001515 | 3300053085 | Bacteria | 15307 |
| 674 | Ga0495619_0006691 | 3300053085 | Bacteria | 7292 |
| 675 | Ga0495619_0023576 | 3300053085 | Bacteria | 3947 |
| 676 | Ga0495619_0045678 | 3300053085 | Bacteria | 2878 |
| 677 | Ga0495619_0088008 | 3300053085 | Bacteria | 2100 |
| 678 | Ga0495619_0220973 | 3300053085 | Bacteria | 1312 |
| 679 | Ga0500566_0100246 | 3300053094 | Bacteria | 1589 |
| 680 | Ga0501084_0046736 | 3300054114 | Bacteria | 3626 |
| 681 | Ga0501084_0804956 | 3300054114 | Bacteria | 791 |
| 682 | Ga0501084_0847977 | 3300054114 | Bacteria | 769 |
| 683 | Ga0501082_0040854 | 3300060353 | Bacteria | 3999 |
| 684 | Ga0501082_0068737 | 3300060353 | Bacteria | 3050 |
| 685 | Ga0501082_0111492 | 3300060353 | Bacteria | 2368 |
| 686 | Ga0501082_0111817 | 3300060353 | Bacteria | 2365 |
| 687 | Ga0501082_0115463 | 3300060353 | Bacteria | 2325 |
| 688 | Ga0501082_0815215 | 3300060353 | Bacteria | 816 |
| 689 | Ga0466962_0000978 | 3300061719 | Bacteria | 12993 |
| 690 | Ga0466962_0007151 | 3300061719 | Bacteria | 5347 |
| 691 | Ga0466962_0023963 | 3300061719 | Bacteria | 2933 |
| 692 | Ga0466962_0045408 | 3300061719 | Bacteria | 2100 |
| 693 | Ga0466962_0236329 | 3300061719 | Bacteria | 896 |
| 694 | Ga0530510_0073911 | 3300061734 | Bacteria | 2475 |
| 695 | Ga0530510_0160963 | 3300061734 | Bacteria | 1660 |
| 696 | Ga0530510_0237088 | 3300061734 | Bacteria | 1358 |
| 697 | Ga0530510_0293244 | 3300061734 | Bacteria | 1216 |
| 698 | 2928147446 | 2928142448 | Bacteria | 5288925 |
| 699 | 2989774537 | 2989771324 | Bacteria | 5605128 |
| 700 | 3003669719 | 3003665799 | Bacteria | 7279786 |
| 701 | Ga0316578_10180508 | |||
| 702 | SwRhRL2b_contig_691202 | |||
| 703 | JGI25407J50210_10000443 | |||
| 704 | Ga0065715_10299150 | |||
| 705 | Ga0070658_10008891 | |||
| 706 | Ga0070658_10039908 | |||
| 707 | Ga0070658_10093274 | |||
| 708 | Ga0070676_10047134 | |||
| 709 | Ga0070683_100006661 | |||
| 710 | Ga0070683_100064468 | |||
| 711 | Ga0070683_100315916 | |||
| 712 | Ga0070690_100048183 | |||
| 713 | Ga0070670_100260341 | |||
| 714 | Ga0068869_100133013 | |||
| 715 | Ga0070680_100025210 | |||
| 716 | Ga0070680_100078313 | |||
| 717 | Ga0070680_100113005 | |||
| 718 | Ga0070682_100005235 | |||
| 719 | Ga0070682_100159918 | |||
| 720 | Ga0070682_100195917 | |||
| 721 | Ga0070682_100597107 | |||
| 722 | Ga0068868_100317209 | |||
| 723 | Ga0070660_100008871 | |||
| 724 | Ga0070660_100019607 | |||
| 725 | Ga0070660_100475643 | |||
| 726 | Ga0070691_10095947 | |||
| 727 | Ga0070687_100052387 | |||
| 728 | Ga0070661_100280789 | |||
| 729 | Ga0070668_100075748 | |||
| 730 | Ga0070675_100689443 | |||
| 731 | Ga0070674_100065367 | |||
| 732 | Ga0070688_100030661 | |||
| 733 | Ga0070659_100011870 | |||
| 734 | Ga0070659_100287384 | |||
| 735 | Ga0070659_100291208 | |||
| 736 | Ga0070667_100009187 | |||
| 737 | Ga0070667_100206496 | |||
| 738 | Ga0070709_10006800 | |||
| 739 | Ga0070714_100013375 | |||
| 740 | Ga0070714_100030401 | |||
| 741 | Ga0070714_100042528 | |||
| 742 | Ga0070714_100053293 | |||
| 743 | Ga0070714_100209351 | |||
| 744 | Ga0070714_100628550 | |||
| 745 | Ga0070714_100752989 | |||
| 746 | Ga0070714_100984050 | |||
| 747 | Ga0070713_100038702 | |||
| 748 | Ga0070713_100173576 | |||
| 749 | Ga0070713_100185746 | |||
| 750 | Ga0070710_10000102 | |||
| 751 | Ga0070710_10001658 | |||
| 752 | Ga0070711_100200572 | |||
| 753 | Ga0070711_100301353 | |||
| 754 | Ga0070700_100376806 | |||
| 755 | Ga0070694_100066953 | |||
| 756 | Ga0070708_100060523 | |||
| 757 | Ga0070708_100829826 | |||
| 758 | Ga0070678_100517753 | |||
| 759 | Ga0070662_100005855 | |||
| 760 | Ga0070681_10022309 | |||
| 761 | Ga0070681_10041077 | |||
| 762 | Ga0070681_10110832 | |||
| 763 | Ga0070681_10211689 | |||
| 764 | Ga0068867_100260110 | |||
| 765 | Ga0070685_10270979 | |||
| 766 | Ga0070706_100211730 | |||
| 767 | Ga0070707_100000419 | |||
| 768 | Ga0070707_100072656 | |||
| 769 | Ga0070707_100275664 | |||
| 770 | Ga0070698_100087902 | |||
| 771 | Ga0070699_100047503 | |||
| 772 | Ga0070679_100030145 | |||
| 773 | Ga0070679_100044535 | |||
| 774 | Ga0070684_100045627 | |||
| 775 | Ga0070684_100217463 | |||
| 776 | Ga0070686_100072758 | |||
| 777 | Ga0070686_100075843 | |||
| 778 | Ga0070686_100343089 | |||
| 779 | Ga0070695_100000704 | |||
| 780 | Ga0070696_100007698 | |||
| 781 | Ga0070665_100860143 | |||
| 782 | Ga0068855_100043637 | |||
| 783 | Ga0070664_100924933 | |||
| 784 | Ga0068856_100082176 | |||
| 785 | Ga0068856_100219651 | |||
| 786 | Ga0068856_100275753 | |||
| 787 | Ga0070702_100038518 | |||
| 788 | Ga0070702_100058417 | |||
| 789 | Ga0070702_100083113 | |||
| 790 | Ga0068852_100003990 | |||
| 791 | Ga0068859_100171889 | |||
| 792 | Ga0068864_100383780 | |||
| 793 | Ga0068861_100016199 | |||
| 794 | Ga0068863_101049067 | |||
| 795 | Ga0068860_100024603 | |||
| 796 | Ga0081455_10121593 | |||
| 797 | Ga0081538_10000205 | |||
| 798 | Ga0081539_10019082 | |||
| 799 | Ga0081539_10026497 | |||
| 800 | Ga0070717_10002778 | |||
| 801 | Ga0070717_10003918 | |||
| 802 | Ga0075365_10644505 | |||
| 803 | Ga0075364_10027959 | |||
| 804 | Ga0070716_100016624 | |||
| 805 | Ga0070716_100263790 | |||
| 806 | Ga0070712_100275257 | |||
| 807 | Ga0075362_10303863 | |||
| 808 | Ga0097621_100006510 | |||
| 809 | Ga0075370_10088421 | |||
| 810 | Ga0068871_100020594 | |||
| 811 | Ga0075428_100187507 | |||
| 812 | Ga0075431_100046842 | |||
| 813 | Ga0075433_10020593 | |||
| 814 | Ga0075433_10261367 | |||
| 815 | Ga0075433_10696874 | |||
| 816 | Ga0075434_100004477 | |||
| 817 | Ga0075434_100025037 | |||
| 818 | Ga0075434_100487407 | |||
| 819 | Ga0068865_100036109 | |||
| 820 | Ga0068865_100202519 | |||
| 821 | Ga0075436_100014265 | |||
| 822 | Ga0097620_100171884 | |||
| 823 | Ga0075435_100136203 | |||
| 824 | Ga0105240_10104239 | |||
| 825 | Ga0105240_10165416 | |||
| 826 | Ga0105240_10207104 | |||
| 827 | Ga0111539_10100043 | |||
| 828 | Ga0105245_10005674 | |||
| 829 | Ga0105245_10156989 | |||
| 830 | Ga0105247_10094572 | |||
| 831 | Ga0114129_10206002 | |||
| 832 | Ga0105243_10112435 | |||
| 833 | Ga0105243_10211016 | |||
| 834 | Ga0105241_10626481 | |||
| 835 | Ga0105241_11065384 | |||
| 836 | Ga0105242_10029876 | |||
| 837 | Ga0105242_10057189 | |||
| 838 | Ga0105248_10547812 | |||
| 839 | Ga0105248_10751434 | |||
| 840 | Ga0105237_10040178 | |||
| 841 | Ga0105237_10428749 | |||
| 842 | Ga0105238_10425192 | |||
| 843 | Ga0105249_10003543 | |||
| 844 | Ga0105249_10674990 | |||
| 845 | Ga0105030_107553 | |||
| 846 | Ga0105239_10045384 | |||
| 847 | Ga0105239_10425840 | |||
| 848 | Ga0105239_10631950 | |||
| 849 | Ga0105246_10375257 | |||
| 850 | Ga0157373_10047036 | |||
| 851 | Ga0157370_10131682 | |||
| 852 | Ga0157369_10039718 | |||
| 853 | Ga0157369_10123087 | |||
| 854 | Ga0157369_10208098 | |||
| 855 | Ga0157374_10040366 | |||
| 856 | Ga0157374_10587118 | |||
| 857 | Ga0157378_10084787 | |||
| 858 | Ga0163162_10123772 | |||
| 859 | Ga0163162_10174932 | |||
| 860 | Ga0157372_10127943 | |||
| 861 | Ga0157372_10148858 | |||
| 862 | Ga0157372_10781183 | |||
| 863 | Ga0157375_10032608 | |||
| 864 | Ga0157375_10048336 | |||
| 865 | Ga0157375_10428836 | |||
| 866 | Ga0157375_10436578 | |||
| 867 | Ga0163163_10141022 | |||
| 868 | Ga0182008_10012847 | |||
| 869 | Ga0157379_10102448 | |||
| 870 | Ga0157376_10019535 | |||
| 871 | Ga0157376_10359635 | |||
| 872 | Ga0157376_10707875 | |||
| 873 | Ga0182006_1086609 | |||
| 874 | Ga0182007_10005740 | |||
| 875 | Ga0163161_10036691 | |||
| 876 | Ga0197907_10239323 | |||
| 877 | Ga0206356_10210716 | |||
| 878 | Ga0206356_10874498 | |||
| 879 | Ga0206354_10222102 | |||
| 880 | Ga0206354_10456579 | |||
| 881 | Ga0206353_10469699 | |||
| 882 | Ga0206353_10475768 | |||
| 883 | Ga0224712_10175101 | |||
| 884 | Ga0224712_10237863 | |||
| 885 | Ga0224712_10286841 | |||
| 886 | Ga0207692_10002158 | |||
| 887 | Ga0207692_10101451 | |||
| 888 | Ga0207642_10171435 | |||
| 889 | Ga0207688_10026836 | |||
| 890 | Ga0207685_10197152 | |||
| 891 | Ga0207699_10097222 | |||
| 892 | Ga0207645_10053431 | |||
| 893 | Ga0207705_10040487 | |||
| 894 | Ga0207705_10176125 | |||
| 895 | Ga0207684_10292356 | |||
| 896 | Ga0207684_10497953 | |||
| 897 | Ga0207654_10060409 | |||
| 898 | Ga0207707_10016657 | |||
| 899 | Ga0207707_10071646 | |||
| 900 | Ga0207707_10442976 | |||
| 901 | Ga0207695_10133223 | |||
| 902 | Ga0207671_10029673 | |||
| 903 | Ga0207693_10006840 | |||
| 904 | Ga0207693_10008431 | |||
| 905 | Ga0207663_10022084 | |||
| 906 | Ga0207663_10128312 | |||
| 907 | Ga0207663_10629307 | |||
| 908 | Ga0207660_10009617 | |||
| 909 | Ga0207660_10142071 | |||
| 910 | Ga0207660_10283839 | |||
| 911 | Ga0207657_10002568 | |||
| 912 | Ga0207657_10005522 | |||
| 913 | Ga0207657_10024904 | |||
| 914 | Ga0207657_10304618 | |||
| 915 | Ga0207657_10621990 | |||
| 916 | Ga0207649_10149222 | |||
| 917 | Ga0207652_10011628 | |||
| 918 | Ga0207652_10054507 | |||
| 919 | Ga0207652_10146043 | |||
| 920 | Ga0207652_10320104 | |||
| 921 | Ga0207652_10546389 | |||
| 922 | Ga0207646_10008847 | |||
| 923 | Ga0207646_10193061 | |||
| 924 | Ga0207694_10019641 | |||
| 925 | Ga0207687_10015043 | |||
| 926 | Ga0207687_10119832 | |||
| 927 | Ga0207687_10157794 | |||
| 928 | Ga0207700_10030457 | |||
| 929 | Ga0207700_10041146 | |||
| 930 | Ga0207700_10223948 | |||
| 931 | Ga0207700_10731134 | |||
| 932 | Ga0207664_10030721 | |||
| 933 | Ga0207664_10096733 | |||
| 934 | Ga0207690_10024176 | |||
| 935 | Ga0207690_10184605 | |||
| 936 | Ga0207690_10242189 | |||
| 937 | Ga0207706_10010223 | |||
| 938 | Ga0207686_10181374 | |||
| 939 | Ga0207704_10019816 | |||
| 940 | Ga0207704_10230536 | |||
| 941 | Ga0207665_10000946 | |||
| 942 | Ga0207691_10736877 | |||
| 943 | Ga0207711_10541536 | |||
| 944 | Ga0207661_10008536 | |||
| 945 | Ga0207661_10441661 | |||
| 946 | Ga0207661_10748865 | |||
| 947 | Ga0207667_10416031 | |||
| 948 | Ga0207667_10676163 | |||
| 949 | Ga0207651_10114467 | |||
| 950 | Ga0207668_10008394 | |||
| 951 | Ga0207658_10005445 | |||
| 952 | Ga0207658_10324825 | |||
| 953 | Ga0207677_10152248 | |||
| 954 | Ga0207677_10194632 | |||
| 955 | Ga0207708_10026374 | |||
| 956 | Ga0207708_10416371 | |||
| 957 | Ga0207702_10055882 | |||
| 958 | Ga0207702_10100810 | |||
| 959 | Ga0207702_10267110 | |||
| 960 | Ga0207702_10572702 | |||
| 961 | Ga0207641_10157185 | |||
| 962 | Ga0207641_10919809 | |||
| 963 | Ga0207648_10014326 | |||
| 964 | Ga0207648_10459384 | |||
| 965 | Ga0207676_11184744 | |||
| 966 | Ga0207675_100000798 | |||
| 967 | Ga0207675_100171883 | |||
| 968 | Ga0207675_100244884 | |||
| 969 | Ga0207675_100529317 | |||
| 970 | Ga0207683_10121394 | |||
| 971 | Ga0207683_11081125 | |||
| 972 | Ga0207698_10348969 | |||
| 973 | Ga0207698_10819469 | |||
| 974 | Ga0207698_11168735 | |||
| 975 | Ga0268265_10270798 | |||
| 976 | Ga0268264_10278241 | |||
| 977 | Ga0265331_10084818 | |||
| 978 | Ga0265327_10002128 | |||
| 979 | Ga0265327_10005773 | |||
| 980 | Ga0316579_10104373 | |||
| 981 | Ga0316576_10024195 | |||
| 982 | Ga0316576_10130751 | |||
| 983 | Ga0316576_10197982 | |||
| 984 | Ga0316576_10373303 | |||
| 985 | Ga0316578_10025219 | |||
| 986 | Ga0316578_10072631 | |||
| 987 | Ga0316578_10191500 | |||
| 988 | Ga0307405_10104166 | |||
| 989 | Ga0307413_10034170 | |||
| 990 | Ga0307407_10226155 | |||
| 991 | Ga0307409_100150130 | |||
| 992 | Ga0307409_100177418 | |||
| 993 | Ga0307416_100215138 | |||
| 994 | Ga0307416_100938554 | |||
| 995 | Ga0307411_10206879 | |||
| 996 | Ga0307415_100217807 | |||
| 997 | Ga0316585_10057529 | |||
| 998 | Ga0373941_0049426 | |||
| 999 | Ga0373953_0028854 | |||
| 1000 | Ga0373960_0045608 | |||
| 1001 | Ga0373955_0301647 | |||
| 1002 | Ga0373961_0017979 | |||
| 1003 | Ga0373962_0165242 | |||
| 1004 | Ga0316574_0002742 | |||
| 1005 | Ga0316574_0018461 | |||
| 1006 | Ga0316574_0030591 | |||
| 1007 | Ga0316574_0083363 | |||
| 1008 | Ga0316574_0117568 | |||
| 1009 | Ga0316574_0125401 | |||
| 1010 | Ga0316574_0198966 | |||
| 1011 | Ga0316574_0199798 | |||
| 1012 | Ga0316574_0569202 | |||
| 1013 | Ga0373931_0074508 | |||
| 1014 | Ga0373935_0023503 | |||
| 1015 | Ga0373933_0025413 | |||
| 1016 | Ga0373947_0041375 | |||
| 1017 | Ga0373937_0004396 | |||
| 1018 | Ga0316582_0099244 | |||
| 1019 | Ga0316582_0169116 | |||
| 1020 | Ga0316582_0494347 | |||
| 1021 | Ga0316584_0000239 | |||
| 1022 | Ga0316584_0118244 | |||
| 1023 | Ga0316584_0239719 | |||
| 1024 | Ga0316584_0335747 | |||
| 1025 | Ga0373925_0007980 | |||
| 1026 | Ga0395899_0020687 | |||
| 1027 | Ga0395899_0039277 | |||
| 1028 | Ga0395900_0092858 | |||
| 1029 | Ga0395900_0124572 | |||
| 1030 | Ga0395900_0924032 | |||
| 1031 | Ga0395898_0036854 | |||
| 1032 | Ga0395898_0552884 | |||
| 1033 | Ga0395898_0673579 | |||
| 1034 | Ga0395898_0838246 | |||
| 1035 | Ga0395905_0015546 | |||
| 1036 | Ga0395905_0129913 | |||
| 1037 | Ga0395905_0235326 | |||
| 1038 | Ga0395901_0028309 | |||
| 1039 | Ga0395901_0028793 | |||
| 1040 | Ga0395901_0154283 | |||
| 1041 | Ga0395901_0202923 | |||
| 1042 | Ga0395901_0369845 | |||
| 1043 | Ga0395901_0411114 | |||
| 1044 | Ga0439461_0011900 | |||
| 1045 | Ga0451807_0927106 | |||
| 1046 | Ga0451849_0624889 | |||
| 1047 | Ga0451843_1307445 | |||
| 1048 | Ga0439463_063506 | |||
| 1049 | Ga0439464_0020823 | |||
| 1050 | Ga0451577_0082891 | |||
| 1051 | Ga0451577_0142457 | |||
| 1052 | Ga0451577_0893472 | |||
| 1053 | Ga0466969_0112443 | |||
| 1054 | Ga0466965_0129422 | |||
| 1055 | Ga0466966_0039736 | |||
| 1056 | Ga0466966_0043172 | |||
| 1057 | Ga0466961_0035809 | |||
| 1058 | Ga0466961_0035820 | |||
| 1059 | Ga0466961_0055122 | |||
| 1060 | Ga0466961_0058624 | |||
| 1061 | Ga0466963_0001574 | |||
| 1062 | Ga0466963_0001608 | |||
| 1063 | Ga0466963_0002028 | |||
| 1064 | Ga0466963_0004500 | |||
| 1065 | Ga0466963_0055327 | |||
| 1066 | Ga0466963_0055943 | |||
| 1067 | Ga0466963_0082917 | |||
| 1068 | Ga0466963_0106839 | |||
| 1069 | Ga0466963_0181969 | |||
| 1070 | Ga0466964_0000623 | |||
| 1071 | Ga0466964_0008065 | |||
| 1072 | Ga0466964_0011344 | |||
| 1073 | Ga0466964_0016464 | |||
| 1074 | Ga0466964_0041461 | |||
| 1075 | Ga0466964_0140836 | |||
| 1076 | Ga0453684_0027133 | |||
| 1077 | Ga0453684_0143007 | |||
| 1078 | Ga0466971_0001290 | |||
| 1079 | Ga0466971_0101499 | |||
| 1080 | Ga0466968_0000609 | |||
| 1081 | Ga0466968_0003041 | |||
| 1082 | Ga0466968_0021560 | |||
| 1083 | Ga0466970_0002453 | |||
| 1084 | Ga0466970_0032433 | |||
| 1085 | Ga0466957_0004222 | |||
| 1086 | Ga0466957_0008159 | |||
| 1087 | Ga0466957_0013157 | |||
| 1088 | Ga0466957_0042651 | |||
| 1089 | Ga0466957_0097060 | |||
| 1090 | Ga0466957_0115973 | |||
| 1091 | Ga0466957_0129689 | |||
| 1092 | Ga0466957_0324655 | |||
| 1093 | Ga0466960_0207199 | |||
| 1094 | Ga0466959_0000893 | |||
| 1095 | Ga0466959_0029476 | |||
| 1096 | Ga0466959_0221948 | |||
| 1097 | Ga0451576_0411635 | |||
| 1098 | Ga0466958_0006798 | |||
| 1099 | Ga0466958_0007273 | |||
| 1100 | Ga0466958_0011438 | |||
| 1101 | Ga0466958_0023424 | |||
| 1102 | Ga0466958_0026177 | |||
| 1103 | Ga0466958_0028853 | |||
| 1104 | Ga0466958_0079385 | |||
| 1105 | Ga0466958_0083619 | |||
| 1106 | Ga0466958_0122486 | |||
| 1107 | Ga0466967_0000644 | |||
| 1108 | Ga0466967_0004885 | |||
| 1109 | Ga0466967_0013585 | |||
| 1110 | Ga0466967_0018574 | |||
| 1111 | Ga0466967_0020900 | |||
| 1112 | Ga0466967_0037623 | |||
| 1113 | Ga0466967_0044005 | |||
| 1114 | Ga0466967_0061234 | |||
| 1115 | Ga0466967_0123551 | |||
| 1116 | Ga0466967_0160100 | |||
| 1117 | Ga0466967_0175632 | |||
| 1118 | Ga0466967_0186775 | |||
| 1119 | Ga0466967_0234317 | |||
| 1120 | Ga0495592_0002355 | |||
| 1121 | Ga0495592_0022401 | |||
| 1122 | Ga0495592_0070069 | |||
| 1123 | Ga0495592_0237890 | |||
| 1124 | Ga0495603_0002125 | |||
| 1125 | Ga0495629_0028444 | |||
| 1126 | Ga0495629_0269702 | |||
| 1127 | Ga0495641_0003631 | |||
| 1128 | Ga0495641_0032732 | |||
| 1129 | Ga0495641_0041082 | |||
| 1130 | Ga0495651_0000299 | |||
| 1131 | Ga0495651_0239124 | |||
| 1132 | Ga0495653_0008062 | |||
| 1133 | Ga0495653_0009274 | |||
| 1134 | Ga0495653_0137086 | |||
| 1135 | Ga0495653_0464120 | |||
| 1136 | Ga0495580_0022747 | |||
| 1137 | Ga0495582_0042539 | |||
| 1138 | Ga0495582_0269376 | |||
| 1139 | Ga0495639_0001735 | |||
| 1140 | Ga0495662_0049025 | |||
| 1141 | Ga0495664_0037058 | |||
| 1142 | Ga0495664_0354066 | |||
| 1143 | Ga0495584_0022196 | |||
| 1144 | Ga0495594_0402077 | |||
| 1145 | Ga0495608_0011135 | |||
| 1146 | Ga0495608_0058564 | |||
| 1147 | Ga0495608_0324441 | |||
| 1148 | Ga0495618_0002083 | |||
| 1149 | Ga0495618_0125929 | |||
| 1150 | Ga0495618_0339679 | |||
| 1151 | Ga0495628_0000067 | |||
| 1152 | Ga0495628_0083342 | |||
| 1153 | Ga0495628_0335284 | |||
| 1154 | Ga0495630_0061568 | |||
| 1155 | Ga0495630_0617354 | |||
| 1156 | Ga0495644_0009907 | |||
| 1157 | Ga0495652_0001269 | |||
| 1158 | Ga0495652_0156288 | |||
| 1159 | Ga0495652_0419531 | |||
| 1160 | Ga0495665_0001210 | |||
| 1161 | Ga0495640_0006921 | |||
| 1162 | Ga0495640_0137702 | |||
| 1163 | Ga0495587_0001677 | |||
| 1164 | Ga0495587_0012004 | |||
| 1165 | Ga0495587_0224099 | |||
| 1166 | Ga0495609_0187623 | |||
| 1167 | Ga0495645_0000189 | |||
| 1168 | Ga0495645_0021648 | |||
| 1169 | Ga0495656_0003714 | |||
| 1170 | Ga0495634_0020805 | |||
| 1171 | Ga0495635_0018320 | |||
| 1172 | Ga0495635_0317824 | |||
| 1173 | Ga0495659_0001465 | |||
| 1174 | Ga0495659_0034307 | |||
| 1175 | Ga0495657_0007359 | |||
| 1176 | Ga0495657_0128908 | |||
| 1177 | Ga0495657_0176793 | |||
| 1178 | Ga0495599_0000651 | |||
| 1179 | Ga0495599_0003138 | |||
| 1180 | Ga0495599_0217337 | |||
| 1181 | Ga0495623_0000160 | |||
| 1182 | Ga0495623_0039418 | |||
| 1183 | Ga0495646_0019153 | |||
| 1184 | Ga0495646_0038268 | |||
| 1185 | Ga0495647_0000745 | |||
| 1186 | Ga0495658_0002149 | |||
| 1187 | Ga0495613_0011630 | |||
| 1188 | Ga0495613_0218962 | |||
| 1189 | Ga0495624_0051807 | |||
| 1190 | Ga0495624_0056598 | |||
| 1191 | Ga0495671_0120232 | |||
| 1192 | Ga0495600_0139502 | |||
| 1193 | Ga0495581_0015107 | |||
| 1194 | Ga0495604_0000076 | |||
| 1195 | Ga0495604_0215647 | |||
| 1196 | Ga0495604_0228692 | |||
| 1197 | Ga0495604_0286992 | |||
| 1198 | Ga0495674_0024067 | |||
| 1199 | Ga0495674_0182597 | |||
| 1200 | Ga0495674_0266357 | |||
| 1201 | Ga0495674_0328039 | |||
| 1202 | Ga0495680_0006437 | |||
| 1203 | Ga0495680_0259052 | |||
| 1204 | Ga0495675_0002790 | |||
| 1205 | Ga0495675_0155896 | |||
| 1206 | Ga0495677_0085935 | |||
| 1207 | Ga0495684_0051391 | |||
| 1208 | Ga0495684_0244915 | |||
| 1209 | Ga0495684_0335074 | |||
| 1210 | Ga0495593_0002806 | |||
| 1211 | Ga0495602_0007098 | |||
| 1212 | Ga0495602_0097293 | |||
| 1213 | Ga0495602_0104166 | |||
| 1214 | Ga0495602_0360631 | |||
| 1215 | Ga0496100_0049607 | |||
| 1216 | Ga0496100_0053761 | |||
| 1217 | Ga0496100_0165497 | |||
| 1218 | Ga0496100_0274940 | |||
| 1219 | Ga0496101_0030264 | |||
| 1220 | Ga0496101_0071695 | |||
| 1221 | Ga0496102_0029927 | |||
| 1222 | Ga0496102_0085477 | |||
| 1223 | Ga0496102_0106229 | |||
| 1224 | Ga0496102_0131179 | |||
| 1225 | Ga0496102_0600885 | |||
| 1226 | Ga0496103_0174873 | |||
| 1227 | Ga0496104_0004084 | |||
| 1228 | Ga0496104_0009843 | |||
| 1229 | Ga0496104_0016335 | |||
| 1230 | Ga0496104_0017670 | |||
| 1231 | Ga0496104_0029934 | |||
| 1232 | Ga0496104_0071752 | |||
| 1233 | Ga0496104_0081043 | |||
| 1234 | Ga0496104_0393718 | |||
| 1235 | Ga0496105_0012031 | |||
| 1236 | Ga0496105_0027824 | |||
| 1237 | Ga0496105_0029197 | |||
| 1238 | Ga0496105_0034748 | |||
| 1239 | Ga0496105_0048961 | |||
| 1240 | Ga0496105_0073075 | |||
| 1241 | Ga0496105_0116255 | |||
| 1242 | Ga0496106_0003549 | |||
| 1243 | Ga0496106_0014613 | |||
| 1244 | Ga0496106_0057833 | |||
| 1245 | Ga0496106_0566906 | |||
| 1246 | Ga0496107_0004029 | |||
| 1247 | Ga0496107_0128992 | |||
| 1248 | Ga0496107_0286414 | |||
| 1249 | Ga0496107_0352742 | |||
| 1250 | Ga0496108_0097948 | |||
| 1251 | Ga0496108_0115800 | |||
| 1252 | Ga0496108_0126869 | |||
| 1253 | Ga0496108_0161194 | |||
| 1254 | Ga0496108_0184127 | |||
| 1255 | Ga0496108_0571890 | |||
| 1256 | Ga0496109_0035851 | |||
| 1257 | Ga0496109_0043495 | |||
| 1258 | Ga0496109_0124744 | |||
| 1259 | Ga0496109_0235630 | |||
| 1260 | Ga0496109_0263588 | |||
| 1261 | Ga0496109_0432767 | |||
| 1262 | Ga0496109_0672730 | |||
| 1263 | Ga0496109_0675522 | |||
| 1264 | Ga0496109_0803431 | |||
| 1265 | Ga0496110_0011011 | |||
| 1266 | Ga0496110_0042257 | |||
| 1267 | Ga0496110_0141725 | |||
| 1268 | Ga0496110_0164268 | |||
| 1269 | Ga0496110_0350087 | |||
| 1270 | Ga0496110_0395418 | |||
| 1271 | Ga0496111_0013436 | |||
| 1272 | Ga0496111_0190643 | |||
| 1273 | Ga0496112_0017476 | |||
| 1274 | Ga0496112_0019234 | |||
| 1275 | Ga0496112_0044280 | |||
| 1276 | Ga0496112_0102328 | |||
| 1277 | Ga0496112_0195180 | |||
| 1278 | Ga0496112_0197404 | |||
| 1279 | Ga0496112_0243081 | |||
| 1280 | Ga0496112_0521093 | |||
| 1281 | Ga0496113_0030451 | |||
| 1282 | Ga0496113_0050630 | |||
| 1283 | Ga0496113_0493758 | |||
| 1284 | Ga0496113_0800022 | |||
| 1285 | Ga0496113_0982877 | |||
| 1286 | Ga0496114_0001888 | |||
| 1287 | Ga0496114_0017232 | |||
| 1288 | Ga0496114_0024731 | |||
| 1289 | Ga0496114_0189387 | |||
| 1290 | Ga0496114_0471727 | |||
| 1291 | Ga0496115_0026528 | |||
| 1292 | Ga0496115_0089250 | |||
| 1293 | Ga0496115_0231695 | |||
| 1294 | Ga0496115_0239047 | |||
| 1295 | Ga0501031_0509479 | |||
| 1296 | Ga0501033_0334927 | |||
| 1297 | Ga0501036_0198795 | |||
| 1298 | Ga0501036_0309078 | |||
| 1299 | Ga0501037_0251556 | |||
| 1300 | Ga0501038_0002136 | |||
| 1301 | Ga0501038_0116532 | |||
| 1302 | Ga0501040_0017960 | |||
| 1303 | Ga0501040_0411643 | |||
| 1304 | Ga0501041_0049684 | |||
| 1305 | Ga0501042_0028026 | |||
| 1306 | Ga0501042_0166993 | |||
| 1307 | Ga0501046_0098296 | |||
| 1308 | Ga0501048_0024302 | |||
| 1309 | Ga0501067_0067008 | |||
| 1310 | Ga0501068_0673276 | |||
| 1311 | Ga0501069_0149593 | |||
| 1312 | Ga0501070_0015664 | |||
| 1313 | Ga0501070_0025430 | |||
| 1314 | Ga0501070_0166824 | |||
| 1315 | Ga0501071_0116033 | |||
| 1316 | Ga0501071_0249562 | |||
| 1317 | Ga0501071_0358520 | |||
| 1318 | Ga0501071_0361413 | |||
| 1319 | Ga0501071_0446553 | |||
| 1320 | Ga0501072_0022916 | |||
| 1321 | Ga0501072_0049442 | |||
| 1322 | Ga0501072_0157959 | |||
| 1323 | Ga0501073_0053754 | |||
| 1324 | Ga0501073_0365705 | |||
| 1325 | Ga0501074_0019741 | |||
| 1326 | Ga0501074_0589979 | |||
| 1327 | Ga0501075_0066104 | |||
| 1328 | Ga0501075_0187278 | |||
| 1329 | Ga0501075_0328588 | |||
| 1330 | Ga0501075_0344404 | |||
| 1331 | Ga0501076_0057600 | |||
| 1332 | Ga0501076_0259757 | |||
| 1333 | Ga0501076_0260458 | |||
| 1334 | Ga0501079_0031751 | |||
| 1335 | Ga0501079_0078891 | |||
| 1336 | Ga0501079_0078995 | |||
| 1337 | Ga0501079_0212310 | |||
| 1338 | Ga0501079_0357942 | |||
| 1339 | Ga0501080_0526405 | |||
| 1340 | Ga0501081_0099858 | |||
| 1341 | Ga0501083_0000397 | |||
| 1342 | Ga0501083_0589594 | |||
| 1343 | Ga0501083_0626599 | |||
| 1344 | Ga0501045_0022116 | |||
| 1345 | nmdc:mga03n38_164977_c1 | |||
| 1346 | nmdc:mga00v17_176641_c1 | |||
| 1347 | nmdc:mga0k408_268102_c1 | |||
| 1348 | nmdc:mga0qj67_183750_c1 | |||
| 1349 | nmdc:mga0qj67_8371_c1 | |||
| 1350 | nmdc:mga08y16_31109_c1 | |||
| 1351 | nmdc:mga08y16_469694_c1 | |||
| 1352 | nmdc:mga08y16_480488_c1 | |||
| 1353 | nmdc:mga0n895_5544_c1 | |||
| 1354 | nmdc:mga0n895_68995_c1 | |||
| 1355 | nmdc:mga0rr50_46989_c1 | |||
| 1356 | nmdc:mga0rr50_94376_c1 | |||
| 1357 | nmdc:mga0rr50_997587_c1 | |||
| 1358 | nmdc:mga08x19_11676_c1 | |||
| 1359 | nmdc:mga08x19_317427_c1 | |||
| 1360 | nmdc:mga0a205_292_c1 | |||
| 1361 | nmdc:mga0a205_520499_c1 | |||
| 1362 | Ga0495601_0000686 | |||
| 1363 | Ga0495601_0024870 | |||
| 1364 | Ga0495601_0110446 | |||
| 1365 | Ga0495601_0231566 | |||
| 1366 | Ga0495612_0018825 | |||
| 1367 | Ga0495612_0138916 | |||
| 1368 | Ga0495655_0032180 | |||
| 1369 | Ga0495595_0017789 | |||
| 1370 | Ga0495595_0043295 | |||
| 1371 | Ga0495595_0051477 | |||
| 1372 | Ga0495595_0162827 | |||
| 1373 | Ga0495619_0001515 | |||
| 1374 | Ga0495619_0006691 | |||
| 1375 | Ga0495619_0023576 | |||
| 1376 | Ga0495619_0045678 | |||
| 1377 | Ga0495619_0088008 | |||
| 1378 | Ga0495619_0220973 | |||
| 1379 | Ga0500566_0100246 | |||
| 1380 | Ga0501084_0046736 | |||
| 1381 | Ga0501084_0804956 | |||
| 1382 | Ga0501084_0847977 | |||
| 1383 | Ga0501082_0040854 | |||
| 1384 | Ga0501082_0068737 | |||
| 1385 | Ga0501082_0111492 | |||
| 1386 | Ga0501082_0111817 | |||
| 1387 | Ga0501082_0115463 | |||
| 1388 | Ga0501082_0815215 | |||
| 1389 | Ga0466962_0000978 | |||
| 1390 | Ga0466962_0007151 | |||
| 1391 | Ga0466962_0023963 | |||
| 1392 | Ga0466962_0045408 | |||
| 1393 | Ga0466962_0236329 | |||
| 1394 | Ga0530510_0073911 | |||
| 1395 | Ga0530510_0160963 | |||
| 1396 | Ga0530510_0237088 | |||
| 1397 | Ga0530510_0293244 | |||
| 1398 | 2928147446 | |||
| 1399 | 2989774537 | |||
| 1400 | 3003669719 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1fva-assembly2.cif.gz_B | crystal structure of bovine methionine sulfoxide reductase | 0.9923 | 1 | 201 |
| 6agv-assembly1.cif.gz_A | crystal structure of apo mouse msra | 0.992 | 3 | 189 |
| 1fva-assembly2.cif.gz_B | crystal structure of bovine methionine sulfoxide reductase | 0.9874 | 1 | 201 |
| 2j89-assembly1.cif.gz_A | functional and structural aspects of poplar cytosolic and plastidial type a methionine sulfoxide reductases | 0.9814 | 29 | 185 |
| 1ff3-assembly3.cif.gz_C | structure of the peptide methionine sulfoxide reductase from escherichia coli | 0.9802 | 1 | 184 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1ff3B00 | Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA | 0.9785 | 1 | 187 | 3.30.1060.10 |
| af_P0A084_1_166_3.30.1060.10 | Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA | 0.9729 | 35 | 188 | 3.30.1060.10 |
| af_Q551H3_1_147_3.30.1060.10 | Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA | 0.9652 | 37 | 185 | 3.30.1060.10 |
| af_Q551H3_1_147_3.30.1060.10 | Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA | 0.9459 | 37 | 185 | 3.30.1060.10 |
| 1ff3B00 | Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA | 0.9386 | 1 | 187 | 3.30.1060.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1G0KCH0-F1-model_v4 | Peptide methionine sulfoxide reductase MsrA (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) | 1.001 | 25 | 175 |
GO:0005737
GO:0008113 GO:0034599 GO:0036456 |
| AF-A0A2D5CGW7-F1-model_v4 | deleted | 0.9993 | 1 | 189 |
|
| AF-H1G068-F1-model_v4 | Peptide methionine sulfoxide reductase MsrA (Protein-methionine-S-oxide reductase) (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Peptide Met(O) reductase) | 0.9991 | 1 | 201 |
GO:0005737
GO:0008113 GO:0034599 GO:0036211 GO:0036456 |
| AF-A0A7K8APT2-F1-model_v4 | peptide-methionine (S)-S-oxide reductase (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Protein-methionine-S-oxide reductase) | 0.999 | 1 | 151 |
GO:0005737
GO:0008113 GO:0034599 GO:0036456 |
| AF-A0A672UKY2-F1-model_v4 | peptide-methionine (S)-S-oxide reductase (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Protein-methionine-S-oxide reductase) | 0.9988 | 2 | 183 |
GO:0004252
GO:0005737 GO:0006508 GO:0008113 GO:0034599 GO:0036456 |