F476100

General Info

Members Datasets Scaffolds Average Seq Length
700 322 1400 214

Family's Representative Sequence

Representative Sequence 3300031728|Ga0316578_10180508|Ga0316578_101805082
Length 243
Sequence MLGVGSSVVGAVGVAAGGRILGAMLFRKNAEMVAEADALPGRTDQTMPVPEEHFVNGHPLTGPWPEGMQTVVFGMGCFWGAERKFWQTEGVYSTFAGYAGGYTPNPAYEEVCSGRTGHAEVVGVVFDPEVVTIEQLLKVFWEEHDPTQGMRQGNDVGSQYRSTIYYTDAAHLPAIESSRQMFQQRLAEKGYGEITTEVAPIDFDSAFFYAEPYHQQYLAKNPNGYCGIGGTGVSCPIGVASAD

Samples

Sample ID Description Type Environment
1 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
62 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
63 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
93 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
94 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
105 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
159 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
160 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
161 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
162 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
163 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
164 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
165 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
166 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
167 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
168 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
169 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
170 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
171 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
172 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
173 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
174 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
175 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
176 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
177 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
178 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
179 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
180 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
181 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
182 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
183 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
184 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
185 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
186 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
187 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
188 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
189 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
190 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
191 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
192 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
193 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
194 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
195 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
196 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
197 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
198 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
199 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
200 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
201 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
202 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
203 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
204 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
205 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
206 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
207 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
208 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
209 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
210 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
211 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
212 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
213 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
214 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
215 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
216 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
217 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
218 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
219 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
220 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
221 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
222 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
223 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
224 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
225 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
226 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
227 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
228 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
229 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
230 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
231 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
232 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
233 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
234 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
235 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
236 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
237 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
238 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
239 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
240 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
241 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
242 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
243 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
244 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
245 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
246 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
247 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
248 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
249 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
250 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
251 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
252 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
253 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
254 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
255 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
256 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
257 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
258 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
259 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
260 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
261 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
262 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
263 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
264 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
265 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
266 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
267 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
268 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
269 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
270 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
271 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
272 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
273 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
274 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
275 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
276 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
278 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
284 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
286 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
287 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
288 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
289 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
290 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
291 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
292 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
293 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
294 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
295 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
296 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
297 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
298 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
299 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
300 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
301 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
302 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
303 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
304 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
305 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
306 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
307 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
308 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
309 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
310 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
311 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
312 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
313 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
314 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
315 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
316 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
317 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
318 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
319 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
320 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
321 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
322 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.14
Metatranscriptomes 1.43
Isolates 0.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.14
Nodule 0
Rhizoplane 11.57
Rhizosphere 86.71
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316578_10180508 3300031728 Bacteria 1272
2 SwRhRL2b_contig_691202 2162886007 Bacteria 2202
3 JGI25407J50210_10000443 3300003373 Bacteria 8143
4 Ga0065715_10299150 3300005293 Bacteria 1045
5 Ga0070658_10008891 3300005327 Bacteria 8073
6 Ga0070658_10039908 3300005327 Bacteria 3788
7 Ga0070658_10093274 3300005327 Bacteria 2483
8 Ga0070676_10047134 3300005328 Bacteria 2516
9 Ga0070683_100006661 3300005329 Bacteria 9700
10 Ga0070683_100064468 3300005329 Bacteria 3411
11 Ga0070683_100315916 3300005329 Bacteria 1486
12 Ga0070690_100048183 3300005330 Bacteria 2712
13 Ga0070670_100260341 3300005331 Bacteria 1512
14 Ga0068869_100133013 3300005334 Bacteria 1914
15 Ga0070680_100025210 3300005336 Bacteria 4751
16 Ga0070680_100078313 3300005336 Bacteria 2723
17 Ga0070680_100113005 3300005336 Bacteria 2262
18 Ga0070682_100005235 3300005337 Bacteria 7216
19 Ga0070682_100159918 3300005337 Bacteria 1554
20 Ga0070682_100195917 3300005337 Bacteria 1422
21 Ga0070682_100597107 3300005337 Bacteria 871
22 Ga0068868_100317209 3300005338 Bacteria 1327
23 Ga0070660_100008871 3300005339 Bacteria 7049
24 Ga0070660_100019607 3300005339 Bacteria 4959
25 Ga0070660_100475643 3300005339 Bacteria 1038
26 Ga0070691_10095947 3300005341 Bacteria 1468
27 Ga0070687_100052387 3300005343 Bacteria 2118
28 Ga0070661_100280789 3300005344 Bacteria 1292
29 Ga0070668_100075748 3300005347 Bacteria 2627
30 Ga0070675_100689443 3300005354 Bacteria 930
31 Ga0070674_100065367 3300005356 Bacteria 2553
32 Ga0070688_100030661 3300005365 Bacteria 3229
33 Ga0070659_100011870 3300005366 Bacteria 6448
34 Ga0070659_100287384 3300005366 Bacteria 1369
35 Ga0070659_100291208 3300005366 Bacteria 1360
36 Ga0070667_100009187 3300005367 Bacteria 8184
37 Ga0070667_100206496 3300005367 Bacteria 1744
38 Ga0070709_10006800 3300005434 Bacteria 6242
39 Ga0070714_100013375 3300005435 Bacteria 6577
40 Ga0070714_100030401 3300005435 Bacteria 4495
41 Ga0070714_100042528 3300005435 Bacteria 3839
42 Ga0070714_100053293 3300005435 Bacteria 3452
43 Ga0070714_100209351 3300005435 Bacteria 1787
44 Ga0070714_100628550 3300005435 Bacteria 1033
45 Ga0070714_100752989 3300005435 Bacteria 942
46 Ga0070714_100984050 3300005435 Bacteria 821
47 Ga0070713_100038702 3300005436 Bacteria 3866
48 Ga0070713_100173576 3300005436 Bacteria 1932
49 Ga0070713_100185746 3300005436 Bacteria 1871
50 Ga0070710_10000102 3300005437 Bacteria 39413
51 Ga0070710_10001658 3300005437 Bacteria 10488
52 Ga0070711_100200572 3300005439 Bacteria 1539
53 Ga0070711_100301353 3300005439 Bacteria 1274
54 Ga0070700_100376806 3300005441 Bacteria 1060
55 Ga0070694_100066953 3300005444 Bacteria 2465
56 Ga0070708_100060523 3300005445 Bacteria 3380
57 Ga0070708_100829826 3300005445 Bacteria 869
58 Ga0070678_100517753 3300005456 Bacteria 1055
59 Ga0070662_100005855 3300005457 Bacteria 7891
60 Ga0070681_10022309 3300005458 Bacteria 6356
61 Ga0070681_10041077 3300005458 Bacteria 4635
62 Ga0070681_10110832 3300005458 Bacteria 2684
63 Ga0070681_10211689 3300005458 Bacteria 1854
64 Ga0068867_100260110 3300005459 Bacteria 1414
65 Ga0070685_10270979 3300005466 Bacteria 1133
66 Ga0070706_100211730 3300005467 Bacteria 1810
67 Ga0070707_100000419 3300005468 Bacteria 41972
68 Ga0070707_100072656 3300005468 Bacteria 3316
69 Ga0070707_100275664 3300005468 Bacteria 1635
70 Ga0070698_100087902 3300005471 Bacteria 3093
71 Ga0070699_100047503 3300005518 Bacteria 3714
72 Ga0070679_100030145 3300005530 Bacteria 5354
73 Ga0070679_100044535 3300005530 Bacteria 4421
74 Ga0070684_100045627 3300005535 Bacteria 3795
75 Ga0070684_100217463 3300005535 Bacteria 1743
76 Ga0070686_100072758 3300005544 Bacteria 2255
77 Ga0070686_100075843 3300005544 Bacteria 2213
78 Ga0070686_100343089 3300005544 Bacteria 1120
79 Ga0070695_100000704 3300005545 Bacteria 17855
80 Ga0070696_100007698 3300005546 Bacteria 7194
81 Ga0070665_100860143 3300005548 Bacteria 920
82 Ga0068855_100043637 3300005563 Bacteria 5310
83 Ga0070664_100924933 3300005564 Bacteria 818
84 Ga0068856_100082176 3300005614 Bacteria 3197
85 Ga0068856_100219651 3300005614 Bacteria 1916
86 Ga0068856_100275753 3300005614 Bacteria 1698
87 Ga0070702_100038518 3300005615 Bacteria 2663
88 Ga0070702_100058417 3300005615 Bacteria 2235
89 Ga0070702_100083113 3300005615 Bacteria 1923
90 Ga0068852_100003990 3300005616 Bacteria 10374
91 Ga0068859_100171889 3300005617 Bacteria 2248
92 Ga0068864_100383780 3300005618 Bacteria 1332
93 Ga0068861_100016199 3300005719 Bacteria 5269
94 Ga0068863_101049067 3300005841 Bacteria 819
95 Ga0068860_100024603 3300005843 Bacteria 5815
96 Ga0081455_10121593 3300005937 Bacteria 2056
97 Ga0081538_10000205 3300005981 Bacteria 65480
98 Ga0081539_10019082 3300005985 Bacteria 4714
99 Ga0081539_10026497 3300005985 Bacteria 3698
100 Ga0070717_10002778 3300006028 Bacteria 12387
101 Ga0070717_10003918 3300006028 Bacteria 10714
102 Ga0075365_10644505 3300006038 Bacteria 749
103 Ga0075364_10027959 3300006051 Bacteria 3606
104 Ga0070716_100016624 3300006173 Bacteria 3801
105 Ga0070716_100263790 3300006173 Bacteria 1180
106 Ga0070712_100275257 3300006175 Bacteria 1354
107 Ga0075362_10303863 3300006177 Bacteria 792
108 Ga0097621_100006510 3300006237 Bacteria 8298
109 Ga0075370_10088421 3300006353 Bacteria 1786
110 Ga0068871_100020594 3300006358 Bacteria 5055
111 Ga0075428_100187507 3300006844 Bacteria 2237
112 Ga0075431_100046842 3300006847 Bacteria 4459
113 Ga0075433_10020593 3300006852 Bacteria 5520
114 Ga0075433_10261367 3300006852 Bacteria 1534
115 Ga0075433_10696874 3300006852 Bacteria 890
116 Ga0075434_100004477 3300006871 Bacteria 12608
117 Ga0075434_100025037 3300006871 Bacteria 5837
118 Ga0075434_100487407 3300006871 Bacteria 1254
119 Ga0068865_100036109 3300006881 Bacteria 3329
120 Ga0068865_100202519 3300006881 Bacteria 1542
121 Ga0075436_100014265 3300006914 Bacteria 5442
122 Ga0097620_100171884 3300006931 Bacteria 2248
123 Ga0075435_100136203 3300007076 Bacteria 2057
124 Ga0105240_10104239 3300009093 Bacteria 3444
125 Ga0105240_10165416 3300009093 Bacteria 2624
126 Ga0105240_10207104 3300009093 Bacteria 2295
127 Ga0111539_10100043 3300009094 Bacteria 3405
128 Ga0105245_10005674 3300009098 Bacteria 10969
129 Ga0105245_10156989 3300009098 Bacteria 2156
130 Ga0105247_10094572 3300009101 Bacteria 1901
131 Ga0114129_10206002 3300009147 Bacteria 2661
132 Ga0105243_10112435 3300009148 Bacteria 2281
133 Ga0105243_10211016 3300009148 Bacteria 1710
134 Ga0105241_10626481 3300009174 Bacteria 974
135 Ga0105241_11065384 3300009174 Bacteria 759
136 Ga0105242_10029876 3300009176 Bacteria 4349
137 Ga0105242_10057189 3300009176 Bacteria 3193
138 Ga0105248_10547812 3300009177 Bacteria 1305
139 Ga0105248_10751434 3300009177 Bacteria 1100
140 Ga0105237_10040178 3300009545 Bacteria 4719
141 Ga0105237_10428749 3300009545 Bacteria 1328
142 Ga0105238_10425192 3300009551 Bacteria 1323
143 Ga0105249_10003543 3300009553 Bacteria 13501
144 Ga0105249_10674990 3300009553 Bacteria 1092
145 Ga0105030_107553 3300009987 Bacteria 924
146 Ga0105239_10045384 3300010375 Bacteria 4816
147 Ga0105239_10425840 3300010375 Bacteria 1504
148 Ga0105239_10631950 3300010375 Bacteria 1222
149 Ga0105246_10375257 3300011119 Bacteria 1173
150 Ga0157373_10047036 3300013100 Bacteria 3078
151 Ga0157370_10131682 3300013104 Bacteria 2332
152 Ga0157369_10039718 3300013105 Bacteria 5142
153 Ga0157369_10123087 3300013105 Bacteria 2751
154 Ga0157369_10208098 3300013105 Bacteria 2051
155 Ga0157374_10040366 3300013296 Bacteria 4297
156 Ga0157374_10587118 3300013296 Bacteria 1123
157 Ga0157378_10084787 3300013297 Bacteria 2869
158 Ga0163162_10123772 3300013306 Bacteria 2691
159 Ga0163162_10174932 3300013306 Bacteria 2272
160 Ga0157372_10127943 3300013307 Bacteria 2921
161 Ga0157372_10148858 3300013307 Bacteria 2701
162 Ga0157372_10781183 3300013307 Bacteria 1110
163 Ga0157375_10032608 3300013308 Bacteria 4942
164 Ga0157375_10048336 3300013308 Bacteria 4161
165 Ga0157375_10428836 3300013308 Bacteria 1488
166 Ga0157375_10436578 3300013308 Bacteria 1475
167 Ga0163163_10141022 3300014325 Bacteria 2452
168 Ga0182008_10012847 3300014497 Bacteria 4412
169 Ga0157379_10102448 3300014968 Bacteria 2570
170 Ga0157376_10019535 3300014969 Bacteria 5225
171 Ga0157376_10359635 3300014969 Bacteria 1396
172 Ga0157376_10707875 3300014969 Bacteria 1013
173 Ga0182006_1086609 3300015261 Bacteria 1133
174 Ga0182007_10005740 3300015262 Bacteria 5409
175 Ga0163161_10036691 3300017792 Bacteria 3511
176 Ga0197907_10239323 3300020069 Bacteria 779
177 Ga0206356_10210716 3300020070 Bacteria 2899
178 Ga0206356_10874498 3300020070 Bacteria 1120
179 Ga0206354_10222102 3300020081 Bacteria 1213
180 Ga0206354_10456579 3300020081 Bacteria 1418
181 Ga0206353_10469699 3300020082 Bacteria 2849
182 Ga0206353_10475768 3300020082 Bacteria 9040
183 Ga0224712_10175101 3300022467 Bacteria 964
184 Ga0224712_10237863 3300022467 Bacteria 838
185 Ga0224712_10286841 3300022467 Bacteria 767
186 Ga0207692_10002158 3300025898 Bacteria 7516
187 Ga0207692_10101451 3300025898 Bacteria 1580
188 Ga0207642_10171435 3300025899 Bacteria 1174
189 Ga0207688_10026836 3300025901 Bacteria 3168
190 Ga0207685_10197152 3300025905 Bacteria 944
191 Ga0207699_10097222 3300025906 Bacteria 1860
192 Ga0207645_10053431 3300025907 Bacteria 2582
193 Ga0207705_10040487 3300025909 Bacteria 3342
194 Ga0207705_10176125 3300025909 Bacteria 1612
195 Ga0207684_10292356 3300025910 Bacteria 1405
196 Ga0207684_10497953 3300025910 Bacteria 1044
197 Ga0207654_10060409 3300025911 Bacteria 2214
198 Ga0207707_10016657 3300025912 Bacteria 6407
199 Ga0207707_10071646 3300025912 Bacteria 3020
200 Ga0207707_10442976 3300025912 Bacteria 1112
201 Ga0207695_10133223 3300025913 Bacteria 2441
202 Ga0207671_10029673 3300025914 Bacteria 4082
203 Ga0207693_10006840 3300025915 Bacteria 9419
204 Ga0207693_10008431 3300025915 Bacteria 8432
205 Ga0207663_10022084 3300025916 Bacteria 3633
206 Ga0207663_10128312 3300025916 Bacteria 1748
207 Ga0207663_10629307 3300025916 Bacteria 845
208 Ga0207660_10009617 3300025917 Bacteria 6258
209 Ga0207660_10142071 3300025917 Bacteria 1836
210 Ga0207660_10283839 3300025917 Bacteria 1315
211 Ga0207657_10002568 3300025919 Bacteria 19643
212 Ga0207657_10005522 3300025919 Bacteria 13205
213 Ga0207657_10024904 3300025919 Bacteria 5531
214 Ga0207657_10304618 3300025919 Bacteria 1262
215 Ga0207657_10621990 3300025919 Bacteria 842
216 Ga0207649_10149222 3300025920 Bacteria 1608
217 Ga0207652_10011628 3300025921 Bacteria 7100
218 Ga0207652_10054507 3300025921 Bacteria 3438
219 Ga0207652_10146043 3300025921 Bacteria 2117
220 Ga0207652_10320104 3300025921 Bacteria 1400
221 Ga0207652_10546389 3300025921 Bacteria 1041
222 Ga0207646_10008847 3300025922 Bacteria 10033
223 Ga0207646_10193061 3300025922 Bacteria 1839
224 Ga0207694_10019641 3300025924 Bacteria 5111
225 Ga0207687_10015043 3300025927 Bacteria 5068
226 Ga0207687_10119832 3300025927 Bacteria 1966
227 Ga0207687_10157794 3300025927 Bacteria 1738
228 Ga0207700_10030457 3300025928 Bacteria 3822
229 Ga0207700_10041146 3300025928 Bacteria 3379
230 Ga0207700_10223948 3300025928 Bacteria 1596
231 Ga0207700_10731134 3300025928 Bacteria 884
232 Ga0207664_10030721 3300025929 Bacteria 4104
233 Ga0207664_10096733 3300025929 Bacteria 2431
234 Ga0207690_10024176 3300025932 Bacteria 3802
235 Ga0207690_10184605 3300025932 Bacteria 1573
236 Ga0207690_10242189 3300025932 Bacteria 1390
237 Ga0207706_10010223 3300025933 Bacteria 8584
238 Ga0207686_10181374 3300025934 Bacteria 1493
239 Ga0207704_10019816 3300025938 Bacteria 3543
240 Ga0207704_10230536 3300025938 Bacteria 1377
241 Ga0207665_10000946 3300025939 Bacteria 19627
242 Ga0207691_10736877 3300025940 Bacteria 830
243 Ga0207711_10541536 3300025941 Bacteria 1086
244 Ga0207661_10008536 3300025944 Bacteria 7322
245 Ga0207661_10441661 3300025944 Bacteria 1184
246 Ga0207661_10748865 3300025944 Bacteria 899
247 Ga0207667_10416031 3300025949 Bacteria 1368
248 Ga0207667_10676163 3300025949 Bacteria 1036
249 Ga0207651_10114467 3300025960 Bacteria 2032
250 Ga0207668_10008394 3300025972 Bacteria 6154
251 Ga0207658_10005445 3300025986 Bacteria 8729
252 Ga0207658_10324825 3300025986 Bacteria 1333
253 Ga0207677_10152248 3300026023 Bacteria 1786
254 Ga0207677_10194632 3300026023 Bacteria 1606
255 Ga0207708_10026374 3300026075 Bacteria 4397
256 Ga0207708_10416371 3300026075 Bacteria 1114
257 Ga0207702_10055882 3300026078 Bacteria 3349
258 Ga0207702_10100810 3300026078 Bacteria 2548
259 Ga0207702_10267110 3300026078 Bacteria 1613
260 Ga0207702_10572702 3300026078 Bacteria 1106
261 Ga0207641_10157185 3300026088 Bacteria 2064
262 Ga0207641_10919809 3300026088 Bacteria 869
263 Ga0207648_10014326 3300026089 Bacteria 7329
264 Ga0207648_10459384 3300026089 Bacteria 1160
265 Ga0207676_11184744 3300026095 Bacteria 757
266 Ga0207675_100000798 3300026118 Bacteria 31278
267 Ga0207675_100171883 3300026118 Bacteria 2072
268 Ga0207675_100244884 3300026118 Bacteria 1733
269 Ga0207675_100529317 3300026118 Bacteria 1176
270 Ga0207683_10121394 3300026121 Bacteria 2346
271 Ga0207683_11081125 3300026121 Bacteria 744
272 Ga0207698_10348969 3300026142 Bacteria 1397
273 Ga0207698_10819469 3300026142 Bacteria 934
274 Ga0207698_11168735 3300026142 Bacteria 783
275 Ga0268265_10270798 3300028380 Bacteria 1515
276 Ga0268264_10278241 3300028381 Bacteria 1566
277 Ga0265331_10084818 3300031250 Bacteria 1468
278 Ga0265327_10002128 3300031251 Bacteria 21899
279 Ga0265327_10005773 3300031251 Bacteria 10188
280 Ga0316579_10104373 3300031691 Bacteria 1359
281 Ga0316576_10024195 3300031727 Bacteria 4239
282 Ga0316576_10130751 3300031727 Bacteria 1889
283 Ga0316576_10197982 3300031727 Bacteria 1514
284 Ga0316576_10373303 3300031727 Bacteria 1059
285 Ga0316578_10025219 3300031728 Bacteria 3341
286 Ga0316578_10072631 3300031728 Bacteria 2038
287 Ga0316578_10191500 3300031728 Bacteria 1232
288 Ga0307405_10104166 3300031731 Bacteria 1909
289 Ga0307413_10034170 3300031824 Bacteria 2903
290 Ga0307407_10226155 3300031903 Bacteria 1268
291 Ga0307409_100150130 3300031995 Bacteria 2022
292 Ga0307409_100177418 3300031995 Bacteria 1882
293 Ga0307416_100215138 3300032002 Bacteria 1837
294 Ga0307416_100938554 3300032002 Bacteria 967
295 Ga0307411_10206879 3300032005 Bacteria 1512
296 Ga0307415_100217807 3300032126 Bacteria 1528
297 Ga0316585_10057529 3300032137 Bacteria 1253
298 Ga0373941_0049426 3300035115 Bacteria 1331
299 Ga0373953_0028854 3300035117 Bacteria 2143
300 Ga0373960_0045608 3300035121 Bacteria 1284
301 Ga0373955_0301647 3300035172 Bacteria 966
302 Ga0373961_0017979 3300035241 Bacteria 1841
303 Ga0373962_0165242 3300035242 Bacteria 732
304 Ga0316574_0002742 3300035398 Bacteria 8931
305 Ga0316574_0018461 3300035398 Bacteria 4099
306 Ga0316574_0030591 3300035398 Bacteria 3262
307 Ga0316574_0083363 3300035398 Bacteria 2032
308 Ga0316574_0117568 3300035398 Bacteria 1706
309 Ga0316574_0125401 3300035398 Bacteria 1650
310 Ga0316574_0198966 3300035398 Bacteria 1287
311 Ga0316574_0199798 3300035398 Bacteria 1284
312 Ga0316574_0569202 3300035398 Bacteria 702
313 Ga0373931_0074508 3300035691 Bacteria 1860
314 Ga0373935_0023503 3300035692 Bacteria 3788
315 Ga0373933_0025413 3300035724 Bacteria 3397
316 Ga0373947_0041375 3300035725 Bacteria 2747
317 Ga0373937_0004396 3300036401 Bacteria 11976
318 Ga0316582_0099244 3300036647 Bacteria 1927
319 Ga0316582_0169116 3300036647 Bacteria 1483
320 Ga0316582_0494347 3300036647 Bacteria 843
321 Ga0316584_0000239 3300036712 Bacteria 27354
322 Ga0316584_0118244 3300036712 Bacteria 1982
323 Ga0316584_0239719 3300036712 Bacteria 1327
324 Ga0316584_0335747 3300036712 Bacteria 1087
325 Ga0373925_0007980 3300037068 Bacteria 7706
326 Ga0395899_0020687 3300037312 Bacteria 4989
327 Ga0395899_0039277 3300037312 Bacteria 3543
328 Ga0395900_0092858 3300037418 Bacteria 3100
329 Ga0395900_0124572 3300037418 Bacteria 2643
330 Ga0395900_0924032 3300037418 Bacteria 795
331 Ga0395898_0036854 3300037466 Bacteria 4853
332 Ga0395898_0552884 3300037466 Bacteria 1093
333 Ga0395898_0673579 3300037466 Bacteria 976
334 Ga0395898_0838246 3300037466 Bacteria 859
335 Ga0395905_0015546 3300037471 Bacteria 7232
336 Ga0395905_0129913 3300037471 Bacteria 2369
337 Ga0395905_0235326 3300037471 Bacteria 1712
338 Ga0395901_0028309 3300038443 Bacteria 5763
339 Ga0395901_0028793 3300038443 Bacteria 5714
340 Ga0395901_0154283 3300038443 Bacteria 2412
341 Ga0395901_0202923 3300038443 Bacteria 2078
342 Ga0395901_0369845 3300038443 Bacteria 1477
343 Ga0395901_0411114 3300038443 Bacteria 1389
344 Ga0439461_0011900 3300041410 Bacteria 1621
345 Ga0451807_0927106 3300041486 Bacteria 1150
346 Ga0451849_0624889 3300041505 Bacteria 1164
347 Ga0451843_1307445 3300041509 Bacteria 869
348 Ga0439463_063506 3300042016 Bacteria 944
349 Ga0439464_0020823 3300042439 Bacteria 1798
350 Ga0451577_0082891 3300042876 Bacteria 2860
351 Ga0451577_0142457 3300042876 Bacteria 2155
352 Ga0451577_0893472 3300042876 Bacteria 800
353 Ga0466969_0112443 3300044656 Bacteria 1273
354 Ga0466965_0129422 3300044683 Bacteria 1308
355 Ga0466966_0039736 3300044684 Bacteria 3029
356 Ga0466966_0043172 3300044684 Bacteria 2891
357 Ga0466961_0035809 3300044693 Bacteria 3186
358 Ga0466961_0035820 3300044693 Bacteria 3186
359 Ga0466961_0055122 3300044693 Bacteria 2535
360 Ga0466961_0058624 3300044693 Bacteria 2449
361 Ga0466963_0001574 3300044694 Bacteria 12377
362 Ga0466963_0001608 3300044694 Bacteria 12290
363 Ga0466963_0002028 3300044694 Bacteria 11134
364 Ga0466963_0004500 3300044694 Bacteria 8108
365 Ga0466963_0055327 3300044694 Bacteria 2638
366 Ga0466963_0055943 3300044694 Bacteria 2624
367 Ga0466963_0082917 3300044694 Bacteria 2174
368 Ga0466963_0106839 3300044694 Bacteria 1919
369 Ga0466963_0181969 3300044694 Bacteria 1467
370 Ga0466964_0000623 3300044706 Bacteria 11276
371 Ga0466964_0008065 3300044706 Bacteria 3949
372 Ga0466964_0011344 3300044706 Bacteria 3365
373 Ga0466964_0016464 3300044706 Bacteria 2824
374 Ga0466964_0041461 3300044706 Bacteria 1862
375 Ga0466964_0140836 3300044706 Bacteria 1108
376 Ga0453684_0027133 3300044712 Bacteria 8230
377 Ga0453684_0143007 3300044712 Bacteria 2853
378 Ga0466971_0001290 3300044719 Bacteria 10463
379 Ga0466971_0101499 3300044719 Bacteria 1322
380 Ga0466968_0000609 3300044735 Bacteria 12198
381 Ga0466968_0003041 3300044735 Bacteria 6200
382 Ga0466968_0021560 3300044735 Bacteria 2610
383 Ga0466970_0002453 3300044765 Bacteria 8963
384 Ga0466970_0032433 3300044765 Bacteria 2760
385 Ga0466957_0004222 3300044842 Bacteria 7967
386 Ga0466957_0008159 3300044842 Bacteria 5945
387 Ga0466957_0013157 3300044842 Bacteria 4797
388 Ga0466957_0042651 3300044842 Bacteria 2745
389 Ga0466957_0097060 3300044842 Bacteria 1853
390 Ga0466957_0115973 3300044842 Bacteria 1703
391 Ga0466957_0129689 3300044842 Bacteria 1614
392 Ga0466957_0324655 3300044842 Bacteria 1039
393 Ga0466960_0207199 3300044901 Bacteria 1074
394 Ga0466959_0000893 3300045049 Bacteria 17563
395 Ga0466959_0029476 3300045049 Bacteria 4065
396 Ga0466959_0221948 3300045049 Bacteria 1310
397 Ga0451576_0411635 3300045051 Bacteria 1418
398 Ga0466958_0006798 3300045836 Bacteria 6251
399 Ga0466958_0007273 3300045836 Bacteria 6076
400 Ga0466958_0011438 3300045836 Bacteria 4998
401 Ga0466958_0023424 3300045836 Bacteria 3625
402 Ga0466958_0026177 3300045836 Bacteria 3446
403 Ga0466958_0028853 3300045836 Bacteria 3292
404 Ga0466958_0079385 3300045836 Bacteria 2018
405 Ga0466958_0083619 3300045836 Bacteria 1967
406 Ga0466958_0122486 3300045836 Bacteria 1629
407 Ga0466967_0000644 3300045976 Bacteria 17538
408 Ga0466967_0004885 3300045976 Bacteria 9157
409 Ga0466967_0013585 3300045976 Bacteria 6300
410 Ga0466967_0018574 3300045976 Bacteria 5561
411 Ga0466967_0020900 3300045976 Bacteria 5303
412 Ga0466967_0037623 3300045976 Bacteria 4143
413 Ga0466967_0044005 3300045976 Bacteria 3869
414 Ga0466967_0061234 3300045976 Bacteria 3338
415 Ga0466967_0123551 3300045976 Bacteria 2395
416 Ga0466967_0160100 3300045976 Bacteria 2112
417 Ga0466967_0175632 3300045976 Bacteria 2018
418 Ga0466967_0186775 3300045976 Bacteria 1957
419 Ga0466967_0234317 3300045976 Bacteria 1749
420 Ga0495592_0002355 3300046454 Bacteria 13343
421 Ga0495592_0022401 3300046454 Bacteria 4806
422 Ga0495592_0070069 3300046454 Bacteria 2556
423 Ga0495592_0237890 3300046454 Bacteria 1209
424 Ga0495603_0002125 3300046455 Bacteria 11652
425 Ga0495629_0028444 3300046459 Bacteria 3968
426 Ga0495629_0269702 3300046459 Bacteria 1169
427 Ga0495641_0003631 3300046461 Bacteria 11422
428 Ga0495641_0032732 3300046461 Bacteria 2472
429 Ga0495641_0041082 3300046461 Bacteria 2149
430 Ga0495651_0000299 3300046462 Bacteria 38596
431 Ga0495651_0239124 3300046462 Bacteria 1246
432 Ga0495653_0008062 3300046463 Bacteria 8627
433 Ga0495653_0009274 3300046463 Bacteria 8053
434 Ga0495653_0137086 3300046463 Bacteria 1725
435 Ga0495653_0464120 3300046463 Bacteria 794
436 Ga0495580_0022747 3300046472 Bacteria 4608
437 Ga0495582_0042539 3300046473 Bacteria 2502
438 Ga0495582_0269376 3300046473 Bacteria 977
439 Ga0495639_0001735 3300046475 Bacteria 9657
440 Ga0495662_0049025 3300046476 Bacteria 2039
441 Ga0495664_0037058 3300046477 Bacteria 2877
442 Ga0495664_0354066 3300046477 Bacteria 884
443 Ga0495584_0022196 3300046491 Bacteria 3222
444 Ga0495594_0402077 3300046499 Bacteria 779
445 Ga0495608_0011135 3300046511 Bacteria 6261
446 Ga0495608_0058564 3300046511 Bacteria 2539
447 Ga0495608_0324441 3300046511 Bacteria 951
448 Ga0495618_0002083 3300046514 Bacteria 13126
449 Ga0495618_0125929 3300046514 Bacteria 1640
450 Ga0495618_0339679 3300046514 Bacteria 927
451 Ga0495628_0000067 3300046516 Bacteria 85377
452 Ga0495628_0083342 3300046516 Bacteria 2482
453 Ga0495628_0335284 3300046516 Bacteria 1114
454 Ga0495630_0061568 3300046517 Bacteria 2818
455 Ga0495630_0617354 3300046517 Bacteria 831
456 Ga0495644_0009907 3300046523 Bacteria 3670
457 Ga0495652_0001269 3300046529 Bacteria 28245
458 Ga0495652_0156288 3300046529 Bacteria 1775
459 Ga0495652_0419531 3300046529 Bacteria 943
460 Ga0495665_0001210 3300046531 Bacteria 13779
461 Ga0495640_0006921 3300046533 Bacteria 8930
462 Ga0495640_0137702 3300046533 Bacteria 1575
463 Ga0495587_0001677 3300046536 Bacteria 14782
464 Ga0495587_0012004 3300046536 Bacteria 5471
465 Ga0495587_0224099 3300046536 Bacteria 1060
466 Ga0495609_0187623 3300046538 Bacteria 868
467 Ga0495645_0000189 3300046543 Bacteria 43923
468 Ga0495645_0021648 3300046543 Bacteria 4646
469 Ga0495656_0003714 3300046615 Bacteria 5180
470 Ga0495634_0020805 3300046642 Bacteria 4648
471 Ga0495635_0018320 3300046663 Bacteria 4886
472 Ga0495635_0317824 3300046663 Bacteria 1042
473 Ga0495659_0001465 3300046664 Bacteria 8010
474 Ga0495659_0034307 3300046664 Bacteria 1784
475 Ga0495657_0007359 3300046675 Bacteria 8513
476 Ga0495657_0128908 3300046675 Bacteria 1586
477 Ga0495657_0176793 3300046675 Bacteria 1312
478 Ga0495599_0000651 3300046678 Bacteria 19603
479 Ga0495599_0003138 3300046678 Bacteria 9632
480 Ga0495599_0217337 3300046678 Bacteria 1170
481 Ga0495623_0000160 3300046679 Bacteria 41833
482 Ga0495623_0039418 3300046679 Bacteria 3019
483 Ga0495646_0019153 3300046680 Bacteria 4334
484 Ga0495646_0038268 3300046680 Bacteria 2962
485 Ga0495647_0000745 3300046681 Bacteria 9670
486 Ga0495658_0002149 3300046683 Bacteria 9974
487 Ga0495613_0011630 3300046689 Bacteria 6542
488 Ga0495613_0218962 3300046689 Bacteria 1337
489 Ga0495624_0051807 3300046690 Bacteria 2595
490 Ga0495624_0056598 3300046690 Bacteria 2467
491 Ga0495671_0120232 3300046692 Bacteria 1282
492 Ga0495600_0139502 3300046809 Bacteria 1573
493 Ga0495581_0015107 3300047315 Bacteria 4482
494 Ga0495604_0000076 3300047317 Bacteria 85332
495 Ga0495604_0215647 3300047317 Bacteria 1324
496 Ga0495604_0228692 3300047317 Bacteria 1277
497 Ga0495604_0286992 3300047317 Bacteria 1110
498 Ga0495674_0024067 3300047319 Bacteria 5603
499 Ga0495674_0182597 3300047319 Bacteria 1746
500 Ga0495674_0266357 3300047319 Bacteria 1407
501 Ga0495674_0328039 3300047319 Bacteria 1245
502 Ga0495680_0006437 3300047322 Bacteria 10911
503 Ga0495680_0259052 3300047322 Bacteria 1230
504 Ga0495675_0002790 3300047444 Bacteria 10479
505 Ga0495675_0155896 3300047444 Bacteria 1409
506 Ga0495677_0085935 3300047445 Bacteria 1182
507 Ga0495684_0051391 3300047471 Bacteria 3145
508 Ga0495684_0244915 3300047471 Bacteria 1306
509 Ga0495684_0335074 3300047471 Bacteria 1078
510 Ga0495593_0002806 3300047673 Bacteria 10493
511 Ga0495602_0007098 3300048088 Bacteria 11759
512 Ga0495602_0097293 3300048088 Bacteria 2425
513 Ga0495602_0104166 3300048088 Bacteria 2322
514 Ga0495602_0360631 3300048088 Bacteria 1046
515 Ga0496100_0049607 3300048903 Bacteria 2715
516 Ga0496100_0053761 3300048903 Bacteria 2624
517 Ga0496100_0165497 3300048903 Bacteria 1588
518 Ga0496100_0274940 3300048903 Bacteria 1254
519 Ga0496101_0030264 3300048904 Bacteria 3794
520 Ga0496101_0071695 3300048904 Bacteria 2540
521 Ga0496102_0029927 3300048905 Bacteria 4872
522 Ga0496102_0085477 3300048905 Bacteria 2913
523 Ga0496102_0106229 3300048905 Bacteria 2612
524 Ga0496102_0131179 3300048905 Bacteria 2346
525 Ga0496102_0600885 3300048905 Bacteria 1023
526 Ga0496103_0174873 3300048906 Bacteria 1379
527 Ga0496104_0004084 3300048907 Bacteria 12670
528 Ga0496104_0009843 3300048907 Bacteria 8529
529 Ga0496104_0016335 3300048907 Bacteria 6741
530 Ga0496104_0017670 3300048907 Bacteria 6501
531 Ga0496104_0029934 3300048907 Bacteria 5056
532 Ga0496104_0071752 3300048907 Bacteria 3292
533 Ga0496104_0081043 3300048907 Bacteria 3094
534 Ga0496104_0393718 3300048907 Bacteria 1297
535 Ga0496105_0012031 3300048908 Bacteria 6850
536 Ga0496105_0027824 3300048908 Bacteria 4622
537 Ga0496105_0029197 3300048908 Bacteria 4514
538 Ga0496105_0034748 3300048908 Bacteria 4147
539 Ga0496105_0048961 3300048908 Bacteria 3488
540 Ga0496105_0073075 3300048908 Bacteria 2833
541 Ga0496105_0116255 3300048908 Bacteria 2206
542 Ga0496106_0003549 3300048909 Bacteria 11613
543 Ga0496106_0014613 3300048909 Bacteria 5801
544 Ga0496106_0057833 3300048909 Bacteria 2933
545 Ga0496106_0566906 3300048909 Bacteria 911
546 Ga0496107_0004029 3300048910 Bacteria 9897
547 Ga0496107_0128992 3300048910 Bacteria 1866
548 Ga0496107_0286414 3300048910 Bacteria 1226
549 Ga0496107_0352742 3300048910 Bacteria 1095
550 Ga0496108_0097948 3300048911 Bacteria 2499
551 Ga0496108_0115800 3300048911 Bacteria 2296
552 Ga0496108_0126869 3300048911 Bacteria 2191
553 Ga0496108_0161194 3300048911 Bacteria 1938
554 Ga0496108_0184127 3300048911 Bacteria 1809
555 Ga0496108_0571890 3300048911 Bacteria 985
556 Ga0496109_0035851 3300048912 Bacteria 4478
557 Ga0496109_0043495 3300048912 Bacteria 4071
558 Ga0496109_0124744 3300048912 Bacteria 2400
559 Ga0496109_0235630 3300048912 Bacteria 1722
560 Ga0496109_0263588 3300048912 Bacteria 1623
561 Ga0496109_0432767 3300048912 Bacteria 1243
562 Ga0496109_0672730 3300048912 Bacteria 972
563 Ga0496109_0675522 3300048912 Bacteria 970
564 Ga0496109_0803431 3300048912 Bacteria 879
565 Ga0496110_0011011 3300048913 Bacteria 7380
566 Ga0496110_0042257 3300048913 Bacteria 3979
567 Ga0496110_0141725 3300048913 Bacteria 2173
568 Ga0496110_0164268 3300048913 Bacteria 2013
569 Ga0496110_0350087 3300048913 Bacteria 1346
570 Ga0496110_0395418 3300048913 Bacteria 1260
571 Ga0496111_0013436 3300048914 Bacteria 5572
572 Ga0496111_0190643 3300048914 Bacteria 1524
573 Ga0496112_0017476 3300048915 Bacteria 6739
574 Ga0496112_0019234 3300048915 Bacteria 6441
575 Ga0496112_0044280 3300048915 Bacteria 4361
576 Ga0496112_0102328 3300048915 Bacteria 2834
577 Ga0496112_0195180 3300048915 Bacteria 1985
578 Ga0496112_0197404 3300048915 Bacteria 1972
579 Ga0496112_0243081 3300048915 Bacteria 1752
580 Ga0496112_0521093 3300048915 Bacteria 1123
581 Ga0496113_0030451 3300048916 Bacteria 3906
582 Ga0496113_0050630 3300048916 Bacteria 3097
583 Ga0496113_0493758 3300048916 Bacteria 983
584 Ga0496113_0800022 3300048916 Bacteria 749
585 Ga0496113_0982877 3300048916 Bacteria 665
586 Ga0496114_0001888 3300048917 Bacteria 15905
587 Ga0496114_0017232 3300048917 Bacteria 5828
588 Ga0496114_0024731 3300048917 Bacteria 4902
589 Ga0496114_0189387 3300048917 Bacteria 1799
590 Ga0496114_0471727 3300048917 Bacteria 1110
591 Ga0496115_0026528 3300048918 Bacteria 4522
592 Ga0496115_0089250 3300048918 Bacteria 2517
593 Ga0496115_0231695 3300048918 Bacteria 1523
594 Ga0496115_0239047 3300048918 Bacteria 1497
595 Ga0501031_0509479 3300049568 Bacteria 776
596 Ga0501033_0334927 3300049570 Bacteria 1062
597 Ga0501036_0198795 3300049572 Bacteria 1686
598 Ga0501036_0309078 3300049572 Bacteria 1322
599 Ga0501037_0251556 3300049573 Bacteria 1236
600 Ga0501038_0002136 3300049574 Bacteria 18359
601 Ga0501038_0116532 3300049574 Bacteria 2208
602 Ga0501040_0017960 3300049576 Bacteria 4695
603 Ga0501040_0411643 3300049576 Bacteria 971
604 Ga0501041_0049684 3300049577 Bacteria 2555
605 Ga0501042_0028026 3300049578 Bacteria 3964
606 Ga0501042_0166993 3300049578 Bacteria 1588
607 Ga0501046_0098296 3300049580 Bacteria 2248
608 Ga0501048_0024302 3300049582 Bacteria 4424
609 Ga0501067_0067008 3300049583 Bacteria 1987
610 Ga0501068_0673276 3300049584 Bacteria 676
611 Ga0501069_0149593 3300049585 Bacteria 1341
612 Ga0501070_0015664 3300049586 Bacteria 6374
613 Ga0501070_0025430 3300049586 Bacteria 4966
614 Ga0501070_0166824 3300049586 Bacteria 1814
615 Ga0501071_0116033 3300049587 Bacteria 1982
616 Ga0501071_0249562 3300049587 Bacteria 1339
617 Ga0501071_0358520 3300049587 Bacteria 1110
618 Ga0501071_0361413 3300049587 Bacteria 1106
619 Ga0501071_0446553 3300049587 Bacteria 990
620 Ga0501072_0022916 3300049588 Bacteria 4847
621 Ga0501072_0049442 3300049588 Bacteria 3310
622 Ga0501072_0157959 3300049588 Bacteria 1808
623 Ga0501073_0053754 3300049589 Bacteria 2819
624 Ga0501073_0365705 3300049589 Bacteria 996
625 Ga0501074_0019741 3300049590 Bacteria 4895
626 Ga0501074_0589979 3300049590 Bacteria 786
627 Ga0501075_0066104 3300049591 Bacteria 2729
628 Ga0501075_0187278 3300049591 Bacteria 1579
629 Ga0501075_0328588 3300049591 Bacteria 1165
630 Ga0501075_0344404 3300049591 Bacteria 1136
631 Ga0501076_0057600 3300049592 Bacteria 3086
632 Ga0501076_0259757 3300049592 Bacteria 1422
633 Ga0501076_0260458 3300049592 Bacteria 1420
634 Ga0501079_0031751 3300049741 Bacteria 4058
635 Ga0501079_0078891 3300049741 Bacteria 2547
636 Ga0501079_0078995 3300049741 Bacteria 2545
637 Ga0501079_0212310 3300049741 Bacteria 1512
638 Ga0501079_0357942 3300049741 Bacteria 1144
639 Ga0501080_0526405 3300049742 Bacteria 1054
640 Ga0501081_0099858 3300049743 Bacteria 2051
641 Ga0501083_0000397 3300049744 Bacteria 27678
642 Ga0501083_0589594 3300049744 Bacteria 723
643 Ga0501083_0626599 3300049744 Bacteria 700
644 Ga0501045_0022116 3300049824 Bacteria 4550
645 nmdc:mga03n38_164977_c1 3300050490 Bacteria 1124
646 nmdc:mga00v17_176641_c1 3300050491 Bacteria 1377
647 nmdc:mga0k408_268102_c1 3300050493 Bacteria 1019
648 nmdc:mga0qj67_183750_c1 3300050509 Bacteria 1698
649 nmdc:mga0qj67_8371_c1 3300050509 Bacteria 7668
650 nmdc:mga08y16_31109_c1 3300050511 Bacteria 5615
651 nmdc:mga08y16_469694_c1 3300050511 Bacteria 1281
652 nmdc:mga08y16_480488_c1 3300050511 Bacteria 1264
653 nmdc:mga0n895_5544_c1 3300050512 Bacteria 10568
654 nmdc:mga0n895_68995_c1 3300050512 Bacteria 3502
655 nmdc:mga0rr50_46989_c1 3300050513 Bacteria 3181
656 nmdc:mga0rr50_94376_c1 3300050513 Bacteria 2336
657 nmdc:mga0rr50_997587_c1 3300050513 Bacteria 713
658 nmdc:mga08x19_11676_c1 3300050514 Bacteria 5288
659 nmdc:mga08x19_317427_c1 3300050514 Bacteria 1084
660 nmdc:mga0a205_292_c1 3300050515 Bacteria 29895
661 nmdc:mga0a205_520499_c1 3300050515 Bacteria 1046
662 Ga0495601_0000686 3300053077 Bacteria 18146
663 Ga0495601_0024870 3300053077 Bacteria 3689
664 Ga0495601_0110446 3300053077 Bacteria 1780
665 Ga0495601_0231566 3300053077 Bacteria 1207
666 Ga0495612_0018825 3300053078 Bacteria 2765
667 Ga0495612_0138916 3300053078 Bacteria 1053
668 Ga0495655_0032180 3300053083 Bacteria 1281
669 Ga0495595_0017789 3300053084 Bacteria 3062
670 Ga0495595_0043295 3300053084 Bacteria 2064
671 Ga0495595_0051477 3300053084 Bacteria 1909
672 Ga0495595_0162827 3300053084 Bacteria 1101
673 Ga0495619_0001515 3300053085 Bacteria 15307
674 Ga0495619_0006691 3300053085 Bacteria 7292
675 Ga0495619_0023576 3300053085 Bacteria 3947
676 Ga0495619_0045678 3300053085 Bacteria 2878
677 Ga0495619_0088008 3300053085 Bacteria 2100
678 Ga0495619_0220973 3300053085 Bacteria 1312
679 Ga0500566_0100246 3300053094 Bacteria 1589
680 Ga0501084_0046736 3300054114 Bacteria 3626
681 Ga0501084_0804956 3300054114 Bacteria 791
682 Ga0501084_0847977 3300054114 Bacteria 769
683 Ga0501082_0040854 3300060353 Bacteria 3999
684 Ga0501082_0068737 3300060353 Bacteria 3050
685 Ga0501082_0111492 3300060353 Bacteria 2368
686 Ga0501082_0111817 3300060353 Bacteria 2365
687 Ga0501082_0115463 3300060353 Bacteria 2325
688 Ga0501082_0815215 3300060353 Bacteria 816
689 Ga0466962_0000978 3300061719 Bacteria 12993
690 Ga0466962_0007151 3300061719 Bacteria 5347
691 Ga0466962_0023963 3300061719 Bacteria 2933
692 Ga0466962_0045408 3300061719 Bacteria 2100
693 Ga0466962_0236329 3300061719 Bacteria 896
694 Ga0530510_0073911 3300061734 Bacteria 2475
695 Ga0530510_0160963 3300061734 Bacteria 1660
696 Ga0530510_0237088 3300061734 Bacteria 1358
697 Ga0530510_0293244 3300061734 Bacteria 1216
698 2928147446 2928142448 Bacteria 5288925
699 2989774537 2989771324 Bacteria 5605128
700 3003669719 3003665799 Bacteria 7279786
701 Ga0316578_10180508
702 SwRhRL2b_contig_691202
703 JGI25407J50210_10000443
704 Ga0065715_10299150
705 Ga0070658_10008891
706 Ga0070658_10039908
707 Ga0070658_10093274
708 Ga0070676_10047134
709 Ga0070683_100006661
710 Ga0070683_100064468
711 Ga0070683_100315916
712 Ga0070690_100048183
713 Ga0070670_100260341
714 Ga0068869_100133013
715 Ga0070680_100025210
716 Ga0070680_100078313
717 Ga0070680_100113005
718 Ga0070682_100005235
719 Ga0070682_100159918
720 Ga0070682_100195917
721 Ga0070682_100597107
722 Ga0068868_100317209
723 Ga0070660_100008871
724 Ga0070660_100019607
725 Ga0070660_100475643
726 Ga0070691_10095947
727 Ga0070687_100052387
728 Ga0070661_100280789
729 Ga0070668_100075748
730 Ga0070675_100689443
731 Ga0070674_100065367
732 Ga0070688_100030661
733 Ga0070659_100011870
734 Ga0070659_100287384
735 Ga0070659_100291208
736 Ga0070667_100009187
737 Ga0070667_100206496
738 Ga0070709_10006800
739 Ga0070714_100013375
740 Ga0070714_100030401
741 Ga0070714_100042528
742 Ga0070714_100053293
743 Ga0070714_100209351
744 Ga0070714_100628550
745 Ga0070714_100752989
746 Ga0070714_100984050
747 Ga0070713_100038702
748 Ga0070713_100173576
749 Ga0070713_100185746
750 Ga0070710_10000102
751 Ga0070710_10001658
752 Ga0070711_100200572
753 Ga0070711_100301353
754 Ga0070700_100376806
755 Ga0070694_100066953
756 Ga0070708_100060523
757 Ga0070708_100829826
758 Ga0070678_100517753
759 Ga0070662_100005855
760 Ga0070681_10022309
761 Ga0070681_10041077
762 Ga0070681_10110832
763 Ga0070681_10211689
764 Ga0068867_100260110
765 Ga0070685_10270979
766 Ga0070706_100211730
767 Ga0070707_100000419
768 Ga0070707_100072656
769 Ga0070707_100275664
770 Ga0070698_100087902
771 Ga0070699_100047503
772 Ga0070679_100030145
773 Ga0070679_100044535
774 Ga0070684_100045627
775 Ga0070684_100217463
776 Ga0070686_100072758
777 Ga0070686_100075843
778 Ga0070686_100343089
779 Ga0070695_100000704
780 Ga0070696_100007698
781 Ga0070665_100860143
782 Ga0068855_100043637
783 Ga0070664_100924933
784 Ga0068856_100082176
785 Ga0068856_100219651
786 Ga0068856_100275753
787 Ga0070702_100038518
788 Ga0070702_100058417
789 Ga0070702_100083113
790 Ga0068852_100003990
791 Ga0068859_100171889
792 Ga0068864_100383780
793 Ga0068861_100016199
794 Ga0068863_101049067
795 Ga0068860_100024603
796 Ga0081455_10121593
797 Ga0081538_10000205
798 Ga0081539_10019082
799 Ga0081539_10026497
800 Ga0070717_10002778
801 Ga0070717_10003918
802 Ga0075365_10644505
803 Ga0075364_10027959
804 Ga0070716_100016624
805 Ga0070716_100263790
806 Ga0070712_100275257
807 Ga0075362_10303863
808 Ga0097621_100006510
809 Ga0075370_10088421
810 Ga0068871_100020594
811 Ga0075428_100187507
812 Ga0075431_100046842
813 Ga0075433_10020593
814 Ga0075433_10261367
815 Ga0075433_10696874
816 Ga0075434_100004477
817 Ga0075434_100025037
818 Ga0075434_100487407
819 Ga0068865_100036109
820 Ga0068865_100202519
821 Ga0075436_100014265
822 Ga0097620_100171884
823 Ga0075435_100136203
824 Ga0105240_10104239
825 Ga0105240_10165416
826 Ga0105240_10207104
827 Ga0111539_10100043
828 Ga0105245_10005674
829 Ga0105245_10156989
830 Ga0105247_10094572
831 Ga0114129_10206002
832 Ga0105243_10112435
833 Ga0105243_10211016
834 Ga0105241_10626481
835 Ga0105241_11065384
836 Ga0105242_10029876
837 Ga0105242_10057189
838 Ga0105248_10547812
839 Ga0105248_10751434
840 Ga0105237_10040178
841 Ga0105237_10428749
842 Ga0105238_10425192
843 Ga0105249_10003543
844 Ga0105249_10674990
845 Ga0105030_107553
846 Ga0105239_10045384
847 Ga0105239_10425840
848 Ga0105239_10631950
849 Ga0105246_10375257
850 Ga0157373_10047036
851 Ga0157370_10131682
852 Ga0157369_10039718
853 Ga0157369_10123087
854 Ga0157369_10208098
855 Ga0157374_10040366
856 Ga0157374_10587118
857 Ga0157378_10084787
858 Ga0163162_10123772
859 Ga0163162_10174932
860 Ga0157372_10127943
861 Ga0157372_10148858
862 Ga0157372_10781183
863 Ga0157375_10032608
864 Ga0157375_10048336
865 Ga0157375_10428836
866 Ga0157375_10436578
867 Ga0163163_10141022
868 Ga0182008_10012847
869 Ga0157379_10102448
870 Ga0157376_10019535
871 Ga0157376_10359635
872 Ga0157376_10707875
873 Ga0182006_1086609
874 Ga0182007_10005740
875 Ga0163161_10036691
876 Ga0197907_10239323
877 Ga0206356_10210716
878 Ga0206356_10874498
879 Ga0206354_10222102
880 Ga0206354_10456579
881 Ga0206353_10469699
882 Ga0206353_10475768
883 Ga0224712_10175101
884 Ga0224712_10237863
885 Ga0224712_10286841
886 Ga0207692_10002158
887 Ga0207692_10101451
888 Ga0207642_10171435
889 Ga0207688_10026836
890 Ga0207685_10197152
891 Ga0207699_10097222
892 Ga0207645_10053431
893 Ga0207705_10040487
894 Ga0207705_10176125
895 Ga0207684_10292356
896 Ga0207684_10497953
897 Ga0207654_10060409
898 Ga0207707_10016657
899 Ga0207707_10071646
900 Ga0207707_10442976
901 Ga0207695_10133223
902 Ga0207671_10029673
903 Ga0207693_10006840
904 Ga0207693_10008431
905 Ga0207663_10022084
906 Ga0207663_10128312
907 Ga0207663_10629307
908 Ga0207660_10009617
909 Ga0207660_10142071
910 Ga0207660_10283839
911 Ga0207657_10002568
912 Ga0207657_10005522
913 Ga0207657_10024904
914 Ga0207657_10304618
915 Ga0207657_10621990
916 Ga0207649_10149222
917 Ga0207652_10011628
918 Ga0207652_10054507
919 Ga0207652_10146043
920 Ga0207652_10320104
921 Ga0207652_10546389
922 Ga0207646_10008847
923 Ga0207646_10193061
924 Ga0207694_10019641
925 Ga0207687_10015043
926 Ga0207687_10119832
927 Ga0207687_10157794
928 Ga0207700_10030457
929 Ga0207700_10041146
930 Ga0207700_10223948
931 Ga0207700_10731134
932 Ga0207664_10030721
933 Ga0207664_10096733
934 Ga0207690_10024176
935 Ga0207690_10184605
936 Ga0207690_10242189
937 Ga0207706_10010223
938 Ga0207686_10181374
939 Ga0207704_10019816
940 Ga0207704_10230536
941 Ga0207665_10000946
942 Ga0207691_10736877
943 Ga0207711_10541536
944 Ga0207661_10008536
945 Ga0207661_10441661
946 Ga0207661_10748865
947 Ga0207667_10416031
948 Ga0207667_10676163
949 Ga0207651_10114467
950 Ga0207668_10008394
951 Ga0207658_10005445
952 Ga0207658_10324825
953 Ga0207677_10152248
954 Ga0207677_10194632
955 Ga0207708_10026374
956 Ga0207708_10416371
957 Ga0207702_10055882
958 Ga0207702_10100810
959 Ga0207702_10267110
960 Ga0207702_10572702
961 Ga0207641_10157185
962 Ga0207641_10919809
963 Ga0207648_10014326
964 Ga0207648_10459384
965 Ga0207676_11184744
966 Ga0207675_100000798
967 Ga0207675_100171883
968 Ga0207675_100244884
969 Ga0207675_100529317
970 Ga0207683_10121394
971 Ga0207683_11081125
972 Ga0207698_10348969
973 Ga0207698_10819469
974 Ga0207698_11168735
975 Ga0268265_10270798
976 Ga0268264_10278241
977 Ga0265331_10084818
978 Ga0265327_10002128
979 Ga0265327_10005773
980 Ga0316579_10104373
981 Ga0316576_10024195
982 Ga0316576_10130751
983 Ga0316576_10197982
984 Ga0316576_10373303
985 Ga0316578_10025219
986 Ga0316578_10072631
987 Ga0316578_10191500
988 Ga0307405_10104166
989 Ga0307413_10034170
990 Ga0307407_10226155
991 Ga0307409_100150130
992 Ga0307409_100177418
993 Ga0307416_100215138
994 Ga0307416_100938554
995 Ga0307411_10206879
996 Ga0307415_100217807
997 Ga0316585_10057529
998 Ga0373941_0049426
999 Ga0373953_0028854
1000 Ga0373960_0045608
1001 Ga0373955_0301647
1002 Ga0373961_0017979
1003 Ga0373962_0165242
1004 Ga0316574_0002742
1005 Ga0316574_0018461
1006 Ga0316574_0030591
1007 Ga0316574_0083363
1008 Ga0316574_0117568
1009 Ga0316574_0125401
1010 Ga0316574_0198966
1011 Ga0316574_0199798
1012 Ga0316574_0569202
1013 Ga0373931_0074508
1014 Ga0373935_0023503
1015 Ga0373933_0025413
1016 Ga0373947_0041375
1017 Ga0373937_0004396
1018 Ga0316582_0099244
1019 Ga0316582_0169116
1020 Ga0316582_0494347
1021 Ga0316584_0000239
1022 Ga0316584_0118244
1023 Ga0316584_0239719
1024 Ga0316584_0335747
1025 Ga0373925_0007980
1026 Ga0395899_0020687
1027 Ga0395899_0039277
1028 Ga0395900_0092858
1029 Ga0395900_0124572
1030 Ga0395900_0924032
1031 Ga0395898_0036854
1032 Ga0395898_0552884
1033 Ga0395898_0673579
1034 Ga0395898_0838246
1035 Ga0395905_0015546
1036 Ga0395905_0129913
1037 Ga0395905_0235326
1038 Ga0395901_0028309
1039 Ga0395901_0028793
1040 Ga0395901_0154283
1041 Ga0395901_0202923
1042 Ga0395901_0369845
1043 Ga0395901_0411114
1044 Ga0439461_0011900
1045 Ga0451807_0927106
1046 Ga0451849_0624889
1047 Ga0451843_1307445
1048 Ga0439463_063506
1049 Ga0439464_0020823
1050 Ga0451577_0082891
1051 Ga0451577_0142457
1052 Ga0451577_0893472
1053 Ga0466969_0112443
1054 Ga0466965_0129422
1055 Ga0466966_0039736
1056 Ga0466966_0043172
1057 Ga0466961_0035809
1058 Ga0466961_0035820
1059 Ga0466961_0055122
1060 Ga0466961_0058624
1061 Ga0466963_0001574
1062 Ga0466963_0001608
1063 Ga0466963_0002028
1064 Ga0466963_0004500
1065 Ga0466963_0055327
1066 Ga0466963_0055943
1067 Ga0466963_0082917
1068 Ga0466963_0106839
1069 Ga0466963_0181969
1070 Ga0466964_0000623
1071 Ga0466964_0008065
1072 Ga0466964_0011344
1073 Ga0466964_0016464
1074 Ga0466964_0041461
1075 Ga0466964_0140836
1076 Ga0453684_0027133
1077 Ga0453684_0143007
1078 Ga0466971_0001290
1079 Ga0466971_0101499
1080 Ga0466968_0000609
1081 Ga0466968_0003041
1082 Ga0466968_0021560
1083 Ga0466970_0002453
1084 Ga0466970_0032433
1085 Ga0466957_0004222
1086 Ga0466957_0008159
1087 Ga0466957_0013157
1088 Ga0466957_0042651
1089 Ga0466957_0097060
1090 Ga0466957_0115973
1091 Ga0466957_0129689
1092 Ga0466957_0324655
1093 Ga0466960_0207199
1094 Ga0466959_0000893
1095 Ga0466959_0029476
1096 Ga0466959_0221948
1097 Ga0451576_0411635
1098 Ga0466958_0006798
1099 Ga0466958_0007273
1100 Ga0466958_0011438
1101 Ga0466958_0023424
1102 Ga0466958_0026177
1103 Ga0466958_0028853
1104 Ga0466958_0079385
1105 Ga0466958_0083619
1106 Ga0466958_0122486
1107 Ga0466967_0000644
1108 Ga0466967_0004885
1109 Ga0466967_0013585
1110 Ga0466967_0018574
1111 Ga0466967_0020900
1112 Ga0466967_0037623
1113 Ga0466967_0044005
1114 Ga0466967_0061234
1115 Ga0466967_0123551
1116 Ga0466967_0160100
1117 Ga0466967_0175632
1118 Ga0466967_0186775
1119 Ga0466967_0234317
1120 Ga0495592_0002355
1121 Ga0495592_0022401
1122 Ga0495592_0070069
1123 Ga0495592_0237890
1124 Ga0495603_0002125
1125 Ga0495629_0028444
1126 Ga0495629_0269702
1127 Ga0495641_0003631
1128 Ga0495641_0032732
1129 Ga0495641_0041082
1130 Ga0495651_0000299
1131 Ga0495651_0239124
1132 Ga0495653_0008062
1133 Ga0495653_0009274
1134 Ga0495653_0137086
1135 Ga0495653_0464120
1136 Ga0495580_0022747
1137 Ga0495582_0042539
1138 Ga0495582_0269376
1139 Ga0495639_0001735
1140 Ga0495662_0049025
1141 Ga0495664_0037058
1142 Ga0495664_0354066
1143 Ga0495584_0022196
1144 Ga0495594_0402077
1145 Ga0495608_0011135
1146 Ga0495608_0058564
1147 Ga0495608_0324441
1148 Ga0495618_0002083
1149 Ga0495618_0125929
1150 Ga0495618_0339679
1151 Ga0495628_0000067
1152 Ga0495628_0083342
1153 Ga0495628_0335284
1154 Ga0495630_0061568
1155 Ga0495630_0617354
1156 Ga0495644_0009907
1157 Ga0495652_0001269
1158 Ga0495652_0156288
1159 Ga0495652_0419531
1160 Ga0495665_0001210
1161 Ga0495640_0006921
1162 Ga0495640_0137702
1163 Ga0495587_0001677
1164 Ga0495587_0012004
1165 Ga0495587_0224099
1166 Ga0495609_0187623
1167 Ga0495645_0000189
1168 Ga0495645_0021648
1169 Ga0495656_0003714
1170 Ga0495634_0020805
1171 Ga0495635_0018320
1172 Ga0495635_0317824
1173 Ga0495659_0001465
1174 Ga0495659_0034307
1175 Ga0495657_0007359
1176 Ga0495657_0128908
1177 Ga0495657_0176793
1178 Ga0495599_0000651
1179 Ga0495599_0003138
1180 Ga0495599_0217337
1181 Ga0495623_0000160
1182 Ga0495623_0039418
1183 Ga0495646_0019153
1184 Ga0495646_0038268
1185 Ga0495647_0000745
1186 Ga0495658_0002149
1187 Ga0495613_0011630
1188 Ga0495613_0218962
1189 Ga0495624_0051807
1190 Ga0495624_0056598
1191 Ga0495671_0120232
1192 Ga0495600_0139502
1193 Ga0495581_0015107
1194 Ga0495604_0000076
1195 Ga0495604_0215647
1196 Ga0495604_0228692
1197 Ga0495604_0286992
1198 Ga0495674_0024067
1199 Ga0495674_0182597
1200 Ga0495674_0266357
1201 Ga0495674_0328039
1202 Ga0495680_0006437
1203 Ga0495680_0259052
1204 Ga0495675_0002790
1205 Ga0495675_0155896
1206 Ga0495677_0085935
1207 Ga0495684_0051391
1208 Ga0495684_0244915
1209 Ga0495684_0335074
1210 Ga0495593_0002806
1211 Ga0495602_0007098
1212 Ga0495602_0097293
1213 Ga0495602_0104166
1214 Ga0495602_0360631
1215 Ga0496100_0049607
1216 Ga0496100_0053761
1217 Ga0496100_0165497
1218 Ga0496100_0274940
1219 Ga0496101_0030264
1220 Ga0496101_0071695
1221 Ga0496102_0029927
1222 Ga0496102_0085477
1223 Ga0496102_0106229
1224 Ga0496102_0131179
1225 Ga0496102_0600885
1226 Ga0496103_0174873
1227 Ga0496104_0004084
1228 Ga0496104_0009843
1229 Ga0496104_0016335
1230 Ga0496104_0017670
1231 Ga0496104_0029934
1232 Ga0496104_0071752
1233 Ga0496104_0081043
1234 Ga0496104_0393718
1235 Ga0496105_0012031
1236 Ga0496105_0027824
1237 Ga0496105_0029197
1238 Ga0496105_0034748
1239 Ga0496105_0048961
1240 Ga0496105_0073075
1241 Ga0496105_0116255
1242 Ga0496106_0003549
1243 Ga0496106_0014613
1244 Ga0496106_0057833
1245 Ga0496106_0566906
1246 Ga0496107_0004029
1247 Ga0496107_0128992
1248 Ga0496107_0286414
1249 Ga0496107_0352742
1250 Ga0496108_0097948
1251 Ga0496108_0115800
1252 Ga0496108_0126869
1253 Ga0496108_0161194
1254 Ga0496108_0184127
1255 Ga0496108_0571890
1256 Ga0496109_0035851
1257 Ga0496109_0043495
1258 Ga0496109_0124744
1259 Ga0496109_0235630
1260 Ga0496109_0263588
1261 Ga0496109_0432767
1262 Ga0496109_0672730
1263 Ga0496109_0675522
1264 Ga0496109_0803431
1265 Ga0496110_0011011
1266 Ga0496110_0042257
1267 Ga0496110_0141725
1268 Ga0496110_0164268
1269 Ga0496110_0350087
1270 Ga0496110_0395418
1271 Ga0496111_0013436
1272 Ga0496111_0190643
1273 Ga0496112_0017476
1274 Ga0496112_0019234
1275 Ga0496112_0044280
1276 Ga0496112_0102328
1277 Ga0496112_0195180
1278 Ga0496112_0197404
1279 Ga0496112_0243081
1280 Ga0496112_0521093
1281 Ga0496113_0030451
1282 Ga0496113_0050630
1283 Ga0496113_0493758
1284 Ga0496113_0800022
1285 Ga0496113_0982877
1286 Ga0496114_0001888
1287 Ga0496114_0017232
1288 Ga0496114_0024731
1289 Ga0496114_0189387
1290 Ga0496114_0471727
1291 Ga0496115_0026528
1292 Ga0496115_0089250
1293 Ga0496115_0231695
1294 Ga0496115_0239047
1295 Ga0501031_0509479
1296 Ga0501033_0334927
1297 Ga0501036_0198795
1298 Ga0501036_0309078
1299 Ga0501037_0251556
1300 Ga0501038_0002136
1301 Ga0501038_0116532
1302 Ga0501040_0017960
1303 Ga0501040_0411643
1304 Ga0501041_0049684
1305 Ga0501042_0028026
1306 Ga0501042_0166993
1307 Ga0501046_0098296
1308 Ga0501048_0024302
1309 Ga0501067_0067008
1310 Ga0501068_0673276
1311 Ga0501069_0149593
1312 Ga0501070_0015664
1313 Ga0501070_0025430
1314 Ga0501070_0166824
1315 Ga0501071_0116033
1316 Ga0501071_0249562
1317 Ga0501071_0358520
1318 Ga0501071_0361413
1319 Ga0501071_0446553
1320 Ga0501072_0022916
1321 Ga0501072_0049442
1322 Ga0501072_0157959
1323 Ga0501073_0053754
1324 Ga0501073_0365705
1325 Ga0501074_0019741
1326 Ga0501074_0589979
1327 Ga0501075_0066104
1328 Ga0501075_0187278
1329 Ga0501075_0328588
1330 Ga0501075_0344404
1331 Ga0501076_0057600
1332 Ga0501076_0259757
1333 Ga0501076_0260458
1334 Ga0501079_0031751
1335 Ga0501079_0078891
1336 Ga0501079_0078995
1337 Ga0501079_0212310
1338 Ga0501079_0357942
1339 Ga0501080_0526405
1340 Ga0501081_0099858
1341 Ga0501083_0000397
1342 Ga0501083_0589594
1343 Ga0501083_0626599
1344 Ga0501045_0022116
1345 nmdc:mga03n38_164977_c1
1346 nmdc:mga00v17_176641_c1
1347 nmdc:mga0k408_268102_c1
1348 nmdc:mga0qj67_183750_c1
1349 nmdc:mga0qj67_8371_c1
1350 nmdc:mga08y16_31109_c1
1351 nmdc:mga08y16_469694_c1
1352 nmdc:mga08y16_480488_c1
1353 nmdc:mga0n895_5544_c1
1354 nmdc:mga0n895_68995_c1
1355 nmdc:mga0rr50_46989_c1
1356 nmdc:mga0rr50_94376_c1
1357 nmdc:mga0rr50_997587_c1
1358 nmdc:mga08x19_11676_c1
1359 nmdc:mga08x19_317427_c1
1360 nmdc:mga0a205_292_c1
1361 nmdc:mga0a205_520499_c1
1362 Ga0495601_0000686
1363 Ga0495601_0024870
1364 Ga0495601_0110446
1365 Ga0495601_0231566
1366 Ga0495612_0018825
1367 Ga0495612_0138916
1368 Ga0495655_0032180
1369 Ga0495595_0017789
1370 Ga0495595_0043295
1371 Ga0495595_0051477
1372 Ga0495595_0162827
1373 Ga0495619_0001515
1374 Ga0495619_0006691
1375 Ga0495619_0023576
1376 Ga0495619_0045678
1377 Ga0495619_0088008
1378 Ga0495619_0220973
1379 Ga0500566_0100246
1380 Ga0501084_0046736
1381 Ga0501084_0804956
1382 Ga0501084_0847977
1383 Ga0501082_0040854
1384 Ga0501082_0068737
1385 Ga0501082_0111492
1386 Ga0501082_0111817
1387 Ga0501082_0115463
1388 Ga0501082_0815215
1389 Ga0466962_0000978
1390 Ga0466962_0007151
1391 Ga0466962_0023963
1392 Ga0466962_0045408
1393 Ga0466962_0236329
1394 Ga0530510_0073911
1395 Ga0530510_0160963
1396 Ga0530510_0237088
1397 Ga0530510_0293244
1398 2928147446
1399 2989774537
1400 3003669719

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01625

PMSR

Peptide methionine sulfoxide reductase

70

227

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1fva-assembly2.cif.gz_B crystal structure of bovine methionine sulfoxide reductase 0.9923 1 201
6agv-assembly1.cif.gz_A crystal structure of apo mouse msra 0.992 3 189
1fva-assembly2.cif.gz_B crystal structure of bovine methionine sulfoxide reductase 0.9874 1 201
2j89-assembly1.cif.gz_A functional and structural aspects of poplar cytosolic and plastidial type a methionine sulfoxide reductases 0.9814 29 185
1ff3-assembly3.cif.gz_C structure of the peptide methionine sulfoxide reductase from escherichia coli 0.9802 1 184
ID Description Score Start End Superfamily
1ff3B00 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9785 1 187 3.30.1060.10
af_P0A084_1_166_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9729 35 188 3.30.1060.10
af_Q551H3_1_147_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9652 37 185 3.30.1060.10
af_Q551H3_1_147_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9459 37 185 3.30.1060.10
1ff3B00 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9386 1 187 3.30.1060.10
ID Description Score Start End GO Terms
AF-A0A1G0KCH0-F1-model_v4 Peptide methionine sulfoxide reductase MsrA (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) 1.001 25 175 GO:0005737
GO:0008113
GO:0034599
GO:0036456
AF-A0A2D5CGW7-F1-model_v4 deleted 0.9993 1 189
AF-H1G068-F1-model_v4 Peptide methionine sulfoxide reductase MsrA (Protein-methionine-S-oxide reductase) (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Peptide Met(O) reductase) 0.9991 1 201 GO:0005737
GO:0008113
GO:0034599
GO:0036211
GO:0036456
AF-A0A7K8APT2-F1-model_v4 peptide-methionine (S)-S-oxide reductase (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Protein-methionine-S-oxide reductase) 0.999 1 151 GO:0005737
GO:0008113
GO:0034599
GO:0036456
AF-A0A672UKY2-F1-model_v4 peptide-methionine (S)-S-oxide reductase (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Protein-methionine-S-oxide reductase) 0.9988 2 183 GO:0004252
GO:0005737
GO:0006508
GO:0008113
GO:0034599
GO:0036456

Map