F476084
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 700 | 246 | 1400 | 242 |
Family's Representative Sequence
| Representative Sequence | 3300009093|Ga0105240_10231006|Ga0105240_102310062 |
| Length | 261 |
| Sequence | MERAVALGRRILPRGWGHFGVQLGVWLGFYISYLAVRSAVGQNPAKALMKGRKVIRFERQATHHIYELTVQRIVDSSHFLLTAAAWTYWNSEFTVIGLTLLWIYLRRHERFARFRNTILLANLIGLVGYVLMPTAPPWMFPHKGFVGGVNPELIHTFGNQYAAMPSLHAADALIVGYCVALSCRRFWAKALWMMWPLWVWFCVVATANHYVLDVLAGIAVAVVSLLATGAVPKLVRAADEQLVPLSQSCYSRDIAGLRYWR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 2 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 3 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 33 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 37 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 39 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 40 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 41 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 42 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 44 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 48 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 49 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 50 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 51 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 52 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 70 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 73 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 74 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 75 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 76 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 77 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 78 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 79 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 80 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 113 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 114 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 115 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 116 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 117 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 118 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 119 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 120 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 121 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 122 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 123 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 124 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 125 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 126 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 127 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 128 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 129 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 130 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 131 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 132 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 133 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 134 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 135 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 136 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 137 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 138 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 139 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 140 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 141 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 142 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 143 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 144 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 145 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 146 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 147 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 148 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 149 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 150 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 151 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 152 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 153 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 154 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 155 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 156 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 157 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 158 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 159 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 160 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 161 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 162 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 214 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 215 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 216 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 217 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 218 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 219 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 220 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 221 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 222 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 223 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 224 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 225 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 226 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 227 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 228 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 229 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 230 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 231 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 232 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 233 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 234 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 235 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 236 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 237 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 238 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 239 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 240 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 245 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 246 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.71 |
| Metatranscriptomes | 1.29 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.14 |
| Nodule | 0 |
| Rhizoplane | 12.71 |
| Rhizosphere | 86.86 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0105240_10231006 | 3300009093 | Bacteria | 2150 |
| 2 | JGI24750J21931_1016088 | 3300002070 | Bacteria | 1014 |
| 3 | Ga0058861_11795641 | 3300004800 | Bacteria | 1098 |
| 4 | Ga0070658_10024432 | 3300005327 | Bacteria | 4847 |
| 5 | Ga0070658_10027699 | 3300005327 | Bacteria | 4547 |
| 6 | Ga0070658_10056989 | 3300005327 | Bacteria | 3177 |
| 7 | Ga0070658_10165543 | 3300005327 | Unclassified | 1856 |
| 8 | Ga0070683_100087739 | 3300005329 | Bacteria | 2918 |
| 9 | Ga0070683_100228549 | 3300005329 | Bacteria | 1769 |
| 10 | Ga0070683_100524988 | 3300005329 | Bacteria | 1131 |
| 11 | Ga0070680_100085414 | 3300005336 | Bacteria | 2607 |
| 12 | Ga0070680_100200836 | 3300005336 | Bacteria | 1681 |
| 13 | Ga0070682_100073937 | 3300005337 | Bacteria | 2187 |
| 14 | Ga0070682_100076586 | 3300005337 | Bacteria | 2154 |
| 15 | Ga0070682_100167800 | 3300005337 | Bacteria | 1523 |
| 16 | Ga0068868_100160749 | 3300005338 | Bacteria | 1855 |
| 17 | Ga0068868_100382893 | 3300005338 | Bacteria | 1211 |
| 18 | Ga0070660_100012851 | 3300005339 | Bacteria | 5988 |
| 19 | Ga0070660_100019859 | 3300005339 | Bacteria | 4930 |
| 20 | Ga0070660_100032183 | 3300005339 | Bacteria | 3945 |
| 21 | Ga0070660_100307363 | 3300005339 | Bacteria | 1301 |
| 22 | Ga0070691_10137341 | 3300005341 | Bacteria | 1243 |
| 23 | Ga0070687_100457568 | 3300005343 | Unclassified | 850 |
| 24 | Ga0070661_100061509 | 3300005344 | Bacteria | 2756 |
| 25 | Ga0070661_100086063 | 3300005344 | Bacteria | 2323 |
| 26 | Ga0070661_100260067 | 3300005344 | Unclassified | 1342 |
| 27 | Ga0070659_100021251 | 3300005366 | Bacteria | 4938 |
| 28 | Ga0070659_100046551 | 3300005366 | Bacteria | 3400 |
| 29 | Ga0070659_100153962 | 3300005366 | Bacteria | 1876 |
| 30 | Ga0070709_10020213 | 3300005434 | Bacteria | 3861 |
| 31 | Ga0070714_100013488 | 3300005435 | Bacteria | 6550 |
| 32 | Ga0070714_100120682 | 3300005435 | Bacteria | 2331 |
| 33 | Ga0070714_100123413 | 3300005435 | Bacteria | 2306 |
| 34 | Ga0070714_100344961 | 3300005435 | Bacteria | 1397 |
| 35 | Ga0070714_100510270 | 3300005435 | Bacteria | 1147 |
| 36 | Ga0070714_100682279 | 3300005435 | Unclassified | 990 |
| 37 | Ga0070713_100020647 | 3300005436 | Bacteria | 5053 |
| 38 | Ga0070713_100043623 | 3300005436 | Bacteria | 3667 |
| 39 | Ga0070713_100125413 | 3300005436 | Bacteria | 2257 |
| 40 | Ga0070713_100151649 | 3300005436 | Bacteria | 2062 |
| 41 | Ga0070713_100581607 | 3300005436 | Bacteria | 1062 |
| 42 | Ga0070710_10031603 | 3300005437 | Bacteria | 2860 |
| 43 | Ga0070710_10376899 | 3300005437 | Unclassified | 945 |
| 44 | Ga0070711_100008323 | 3300005439 | Bacteria | 6349 |
| 45 | Ga0070711_100207041 | 3300005439 | Bacteria | 1517 |
| 46 | Ga0070705_100094011 | 3300005440 | Bacteria | 1876 |
| 47 | Ga0070705_100182621 | 3300005440 | Bacteria | 1422 |
| 48 | Ga0070708_100008860 | 3300005445 | Bacteria | 8097 |
| 49 | Ga0070708_100195292 | 3300005445 | Unclassified | 1893 |
| 50 | Ga0070708_100395208 | 3300005445 | Bacteria | 1304 |
| 51 | Ga0070663_100305060 | 3300005455 | Bacteria | 1276 |
| 52 | Ga0070678_100254021 | 3300005456 | Bacteria | 1475 |
| 53 | Ga0070681_10008727 | 3300005458 | Bacteria | 9945 |
| 54 | Ga0070681_10020145 | 3300005458 | Bacteria | 6685 |
| 55 | Ga0070681_10022373 | 3300005458 | Bacteria | 6348 |
| 56 | Ga0070681_10062862 | 3300005458 | Bacteria | 3685 |
| 57 | Ga0070681_10161124 | 3300005458 | Bacteria | 2168 |
| 58 | Ga0070681_10197265 | 3300005458 | Bacteria | 1931 |
| 59 | Ga0070685_10297942 | 3300005466 | Unclassified | 1086 |
| 60 | Ga0070706_100028844 | 3300005467 | Bacteria | 5112 |
| 61 | Ga0070706_100261306 | 3300005467 | Bacteria | 1616 |
| 62 | Ga0070706_100703574 | 3300005467 | Bacteria | 937 |
| 63 | Ga0070707_100000441 | 3300005468 | Bacteria | 41190 |
| 64 | Ga0070707_100134959 | 3300005468 | Bacteria | 2401 |
| 65 | Ga0070707_100221237 | 3300005468 | Bacteria | 1844 |
| 66 | Ga0070707_100597467 | 3300005468 | Unclassified | 1066 |
| 67 | Ga0070707_100671261 | 3300005468 | Bacteria | 999 |
| 68 | Ga0070698_100101674 | 3300005471 | Bacteria | 2846 |
| 69 | Ga0070698_100168661 | 3300005471 | Bacteria | 2131 |
| 70 | Ga0070698_100358241 | 3300005471 | Bacteria | 1390 |
| 71 | Ga0070698_100523307 | 3300005471 | Bacteria | 1124 |
| 72 | Ga0070698_100538307 | 3300005471 | Bacteria | 1107 |
| 73 | Ga0070699_100160422 | 3300005518 | Bacteria | 1990 |
| 74 | Ga0070699_100230326 | 3300005518 | Bacteria | 1652 |
| 75 | Ga0070699_100713993 | 3300005518 | Bacteria | 916 |
| 76 | Ga0070679_100017413 | 3300005530 | Bacteria | 6954 |
| 77 | Ga0070679_100035170 | 3300005530 | Bacteria | 4969 |
| 78 | Ga0070679_100085191 | 3300005530 | Bacteria | 3147 |
| 79 | Ga0070684_100081287 | 3300005535 | Bacteria | 2867 |
| 80 | Ga0070684_100322014 | 3300005535 | Unclassified | 1420 |
| 81 | Ga0070697_100567645 | 3300005536 | Bacteria | 996 |
| 82 | Ga0068853_100582316 | 3300005539 | Bacteria | 1062 |
| 83 | Ga0070695_100000005 | 3300005545 | Bacteria | 97484 |
| 84 | Ga0070665_100106594 | 3300005548 | Bacteria | 2804 |
| 85 | Ga0070704_100069974 | 3300005549 | Bacteria | 2545 |
| 86 | Ga0068855_100049137 | 3300005563 | Bacteria | 4976 |
| 87 | Ga0068855_100073066 | 3300005563 | Bacteria | 3985 |
| 88 | Ga0068855_100196517 | 3300005563 | Bacteria | 2272 |
| 89 | Ga0068855_100293061 | 3300005563 | Unclassified | 1803 |
| 90 | Ga0070664_100212525 | 3300005564 | Unclassified | 1729 |
| 91 | Ga0068857_100087436 | 3300005577 | Bacteria | 2787 |
| 92 | Ga0068856_100040463 | 3300005614 | Bacteria | 4579 |
| 93 | Ga0068856_100120281 | 3300005614 | Bacteria | 2627 |
| 94 | Ga0068856_100135248 | 3300005614 | Bacteria | 2470 |
| 95 | Ga0068856_100162142 | 3300005614 | Bacteria | 2246 |
| 96 | Ga0068856_100348738 | 3300005614 | Bacteria | 1499 |
| 97 | Ga0068852_100044119 | 3300005616 | Bacteria | 3784 |
| 98 | Ga0068852_100297990 | 3300005616 | Bacteria | 1560 |
| 99 | Ga0068852_100332818 | 3300005616 | Bacteria | 1478 |
| 100 | Ga0081539_10001192 | 3300005985 | Bacteria | 46924 |
| 101 | Ga0070717_10019299 | 3300006028 | Bacteria | 5346 |
| 102 | Ga0070717_10034836 | 3300006028 | Bacteria | 4071 |
| 103 | Ga0070717_10050873 | 3300006028 | Bacteria | 3408 |
| 104 | Ga0070717_10072479 | 3300006028 | Bacteria | 2876 |
| 105 | Ga0070717_10101944 | 3300006028 | Bacteria | 2438 |
| 106 | Ga0070717_10366799 | 3300006028 | Bacteria | 1290 |
| 107 | Ga0070717_10459177 | 3300006028 | Bacteria | 1148 |
| 108 | Ga0075432_10044062 | 3300006058 | Bacteria | 1564 |
| 109 | Ga0070716_100041824 | 3300006173 | Bacteria | 2555 |
| 110 | Ga0070712_100024906 | 3300006175 | Bacteria | 3971 |
| 111 | Ga0070712_100070171 | 3300006175 | Bacteria | 2502 |
| 112 | Ga0070712_100170933 | 3300006175 | Bacteria | 1686 |
| 113 | Ga0070712_100288825 | 3300006175 | Unclassified | 1323 |
| 114 | Ga0097621_100180783 | 3300006237 | Bacteria | 1822 |
| 115 | Ga0068871_100108423 | 3300006358 | Bacteria | 2334 |
| 116 | Ga0075433_10008761 | 3300006852 | Bacteria | 8073 |
| 117 | Ga0075434_100007792 | 3300006871 | Bacteria | 9917 |
| 118 | Ga0075436_100013785 | 3300006914 | Bacteria | 5536 |
| 119 | Ga0075435_100002153 | 3300007076 | Bacteria | 12981 |
| 120 | Ga0075435_100097080 | 3300007076 | Bacteria | 2438 |
| 121 | Ga0105240_10003672 | 3300009093 | Bacteria | 23743 |
| 122 | Ga0105240_10152267 | 3300009093 | Bacteria | 2753 |
| 123 | Ga0105240_10248388 | 3300009093 | Bacteria | 2059 |
| 124 | Ga0111539_10583602 | 3300009094 | Bacteria | 1302 |
| 125 | Ga0105245_10429619 | 3300009098 | Unclassified | 1325 |
| 126 | Ga0105247_10056527 | 3300009101 | Bacteria | 2423 |
| 127 | Ga0105247_10505657 | 3300009101 | Bacteria | 881 |
| 128 | Ga0114129_10010920 | 3300009147 | Bacteria | 12939 |
| 129 | Ga0114129_10084015 | 3300009147 | Bacteria | 4421 |
| 130 | Ga0114129_10173306 | 3300009147 | Bacteria | 2940 |
| 131 | Ga0105241_10762588 | 3300009174 | Unclassified | 888 |
| 132 | Ga0105242_10641106 | 3300009176 | Unclassified | 1032 |
| 133 | Ga0105248_10778137 | 3300009177 | Unclassified | 1080 |
| 134 | Ga0105248_10950813 | 3300009177 | Unclassified | 970 |
| 135 | Ga0105237_10005371 | 3300009545 | Bacteria | 14491 |
| 136 | Ga0105237_10115359 | 3300009545 | Bacteria | 2679 |
| 137 | Ga0105238_10066727 | 3300009551 | Bacteria | 3599 |
| 138 | Ga0105238_10121072 | 3300009551 | Bacteria | 2596 |
| 139 | Ga0105238_10387396 | 3300009551 | Bacteria | 1390 |
| 140 | Ga0105239_10145120 | 3300010375 | Bacteria | 2646 |
| 141 | Ga0105239_10227169 | 3300010375 | Bacteria | 2094 |
| 142 | Ga0157371_10142109 | 3300013102 | Bacteria | 1709 |
| 143 | Ga0157370_10153567 | 3300013104 | Bacteria | 2142 |
| 144 | Ga0157370_10248207 | 3300013104 | Bacteria | 1646 |
| 145 | Ga0157369_10134428 | 3300013105 | Bacteria | 2619 |
| 146 | Ga0157369_10163797 | 3300013105 | Bacteria | 2346 |
| 147 | Ga0157369_10499219 | 3300013105 | Bacteria | 1259 |
| 148 | Ga0157369_10681050 | 3300013105 | Bacteria | 1059 |
| 149 | Ga0157369_10774600 | 3300013105 | Unclassified | 986 |
| 150 | Ga0157369_10806071 | 3300013105 | Bacteria | 965 |
| 151 | Ga0157374_10023602 | 3300013296 | Bacteria | 5504 |
| 152 | Ga0157374_10117664 | 3300013296 | Bacteria | 2562 |
| 153 | Ga0157374_10242616 | 3300013296 | Bacteria | 1772 |
| 154 | Ga0163162_10175643 | 3300013306 | Bacteria | 2267 |
| 155 | Ga0157372_10029509 | 3300013307 | Bacteria | 5990 |
| 156 | Ga0157372_10030921 | 3300013307 | Bacteria | 5859 |
| 157 | Ga0157372_10046412 | 3300013307 | Bacteria | 4822 |
| 158 | Ga0157372_10168880 | 3300013307 | Bacteria | 2530 |
| 159 | Ga0157372_10449034 | 3300013307 | Bacteria | 1503 |
| 160 | Ga0157372_10506095 | 3300013307 | Bacteria | 1408 |
| 161 | Ga0157372_10667764 | 3300013307 | Bacteria | 1210 |
| 162 | Ga0163163_10203665 | 3300014325 | Bacteria | 2027 |
| 163 | Ga0182008_10004681 | 3300014497 | Bacteria | 7945 |
| 164 | Ga0182008_10064564 | 3300014497 | Bacteria | 1802 |
| 165 | Ga0157379_10217025 | 3300014968 | Bacteria | 1733 |
| 166 | Ga0157376_10198666 | 3300014969 | Bacteria | 1843 |
| 167 | Ga0182006_1035423 | 3300015261 | Bacteria | 1990 |
| 168 | Ga0182007_10004571 | 3300015262 | Bacteria | 6252 |
| 169 | Ga0206356_11012070 | 3300020070 | Bacteria | 2307 |
| 170 | Ga0206355_1397364 | 3300020076 | Bacteria | 1163 |
| 171 | Ga0206354_10062336 | 3300020081 | Bacteria | 959 |
| 172 | Ga0206354_11219805 | 3300020081 | Bacteria | 1003 |
| 173 | Ga0154015_1013125 | 3300020610 | Bacteria | 1408 |
| 174 | Ga0213874_10048817 | 3300021377 | Bacteria | 1292 |
| 175 | Ga0224712_10016452 | 3300022467 | Bacteria | 2431 |
| 176 | Ga0224712_10025334 | 3300022467 | Bacteria | 2084 |
| 177 | Ga0224712_10229481 | 3300022467 | Bacteria | 852 |
| 178 | Ga0207692_10054860 | 3300025898 | Bacteria | 2037 |
| 179 | Ga0207647_10190021 | 3300025904 | Bacteria | 1190 |
| 180 | Ga0207699_10002574 | 3300025906 | Bacteria | 8558 |
| 181 | Ga0207705_10120996 | 3300025909 | Bacteria | 1942 |
| 182 | Ga0207705_10261999 | 3300025909 | Unclassified | 1320 |
| 183 | Ga0207684_10032181 | 3300025910 | Bacteria | 4461 |
| 184 | Ga0207654_10225918 | 3300025911 | Bacteria | 1244 |
| 185 | Ga0207707_10008378 | 3300025912 | Bacteria | 8972 |
| 186 | Ga0207707_10013655 | 3300025912 | Bacteria | 7082 |
| 187 | Ga0207707_10038882 | 3300025912 | Bacteria | 4158 |
| 188 | Ga0207707_10092395 | 3300025912 | Bacteria | 2644 |
| 189 | Ga0207707_10134970 | 3300025912 | Bacteria | 2158 |
| 190 | Ga0207707_10151623 | 3300025912 | Bacteria | 2026 |
| 191 | Ga0207707_10505070 | 3300025912 | Bacteria | 1031 |
| 192 | Ga0207695_10033835 | 3300025913 | Bacteria | 5567 |
| 193 | Ga0207695_10223609 | 3300025913 | Bacteria | 1789 |
| 194 | Ga0207695_10546212 | 3300025913 | Bacteria | 1040 |
| 195 | Ga0207671_10024918 | 3300025914 | Bacteria | 4495 |
| 196 | Ga0207693_10000856 | 3300025915 | Bacteria | 27152 |
| 197 | Ga0207693_10050646 | 3300025915 | Bacteria | 3260 |
| 198 | Ga0207693_10105233 | 3300025915 | Bacteria | 2213 |
| 199 | Ga0207693_10184819 | 3300025915 | Bacteria | 1641 |
| 200 | Ga0207663_10005976 | 3300025916 | Bacteria | 6185 |
| 201 | Ga0207663_10059231 | 3300025916 | Bacteria | 2421 |
| 202 | Ga0207663_10062412 | 3300025916 | Bacteria | 2369 |
| 203 | Ga0207663_10221055 | 3300025916 | Bacteria | 1378 |
| 204 | Ga0207660_10007020 | 3300025917 | Bacteria | 7294 |
| 205 | Ga0207660_10091799 | 3300025917 | Bacteria | 2253 |
| 206 | Ga0207660_10331411 | 3300025917 | Bacteria | 1217 |
| 207 | Ga0207662_10176943 | 3300025918 | Bacteria | 1371 |
| 208 | Ga0207657_10020746 | 3300025919 | Bacteria | 6201 |
| 209 | Ga0207657_10023038 | 3300025919 | Bacteria | 5809 |
| 210 | Ga0207657_10024582 | 3300025919 | Bacteria | 5573 |
| 211 | Ga0207657_10033465 | 3300025919 | Bacteria | 4633 |
| 212 | Ga0207649_10042138 | 3300025920 | Bacteria | 2783 |
| 213 | Ga0207649_10116300 | 3300025920 | Bacteria | 1795 |
| 214 | Ga0207649_10128062 | 3300025920 | Unclassified | 1721 |
| 215 | Ga0207652_10009097 | 3300025921 | Bacteria | 7999 |
| 216 | Ga0207652_10021758 | 3300025921 | Bacteria | 5296 |
| 217 | Ga0207652_10097892 | 3300025921 | Bacteria | 2586 |
| 218 | Ga0207652_10319270 | 3300025921 | Bacteria | 1402 |
| 219 | Ga0207652_10446307 | 3300025921 | Unclassified | 1166 |
| 220 | Ga0207646_10003470 | 3300025922 | Bacteria | 17803 |
| 221 | Ga0207646_10045161 | 3300025922 | Bacteria | 3955 |
| 222 | Ga0207646_10182935 | 3300025922 | Bacteria | 1893 |
| 223 | Ga0207646_10208970 | 3300025922 | Bacteria | 1763 |
| 224 | Ga0207646_10519569 | 3300025922 | Unclassified | 1072 |
| 225 | Ga0207694_10102747 | 3300025924 | Bacteria | 2266 |
| 226 | Ga0207694_10636373 | 3300025924 | Bacteria | 898 |
| 227 | Ga0207687_10090491 | 3300025927 | Bacteria | 2230 |
| 228 | Ga0207687_10396102 | 3300025927 | Unclassified | 1135 |
| 229 | Ga0207700_10067535 | 3300025928 | Bacteria | 2737 |
| 230 | Ga0207700_10101197 | 3300025928 | Bacteria | 2298 |
| 231 | Ga0207700_10239990 | 3300025928 | Bacteria | 1544 |
| 232 | Ga0207700_10660510 | 3300025928 | Bacteria | 932 |
| 233 | Ga0207700_10711976 | 3300025928 | Bacteria | 896 |
| 234 | Ga0207664_10002961 | 3300025929 | Bacteria | 11273 |
| 235 | Ga0207664_10009365 | 3300025929 | Bacteria | 6868 |
| 236 | Ga0207664_10026453 | 3300025929 | Bacteria | 4386 |
| 237 | Ga0207664_10044311 | 3300025929 | Bacteria | 3483 |
| 238 | Ga0207664_10144518 | 3300025929 | Bacteria | 2016 |
| 239 | Ga0207664_10172944 | 3300025929 | Bacteria | 1850 |
| 240 | Ga0207664_10271111 | 3300025929 | Bacteria | 1487 |
| 241 | Ga0207664_10346902 | 3300025929 | Bacteria | 1313 |
| 242 | Ga0207690_10021561 | 3300025932 | Bacteria | 3997 |
| 243 | Ga0207690_10067212 | 3300025932 | Bacteria | 2458 |
| 244 | Ga0207690_10221685 | 3300025932 | Bacteria | 1447 |
| 245 | Ga0207665_10000058 | 3300025939 | Bacteria | 72882 |
| 246 | Ga0207665_10157650 | 3300025939 | Bacteria | 1630 |
| 247 | Ga0207665_10458610 | 3300025939 | Unclassified | 979 |
| 248 | Ga0207711_10719490 | 3300025941 | Unclassified | 931 |
| 249 | Ga0207661_10244249 | 3300025944 | Bacteria | 1594 |
| 250 | Ga0207661_10259689 | 3300025944 | Unclassified | 1547 |
| 251 | Ga0207679_10564874 | 3300025945 | Bacteria | 1022 |
| 252 | Ga0207667_10073330 | 3300025949 | Bacteria | 3557 |
| 253 | Ga0207667_10075624 | 3300025949 | Bacteria | 3496 |
| 254 | Ga0207667_10822849 | 3300025949 | Bacteria | 924 |
| 255 | Ga0207677_10252078 | 3300026023 | Archaea | 1434 |
| 256 | Ga0207678_10150255 | 3300026067 | Bacteria | 1988 |
| 257 | Ga0207702_10144393 | 3300026078 | Bacteria | 2158 |
| 258 | Ga0207702_10247340 | 3300026078 | Bacteria | 1673 |
| 259 | Ga0207674_10027937 | 3300026116 | Bacteria | 5961 |
| 260 | Ga0207674_10091516 | 3300026116 | Bacteria | 3031 |
| 261 | Ga0207674_10141414 | 3300026116 | Bacteria | 2366 |
| 262 | Ga0207698_10412009 | 3300026142 | Bacteria | 1294 |
| 263 | Ga0207428_10079558 | 3300027907 | Bacteria | 2563 |
| 264 | Ga0265319_1001514 | 3300028563 | Bacteria | 13787 |
| 265 | Ga0265319_1041912 | 3300028563 | Bacteria | 1542 |
| 266 | Ga0265334_10010211 | 3300028573 | Bacteria | 3962 |
| 267 | Ga0265318_10011249 | 3300028577 | Bacteria | 3860 |
| 268 | Ga0265318_10086411 | 3300028577 | Bacteria | 1156 |
| 269 | Ga0265322_10041106 | 3300028654 | Bacteria | 1316 |
| 270 | Ga0265336_10004674 | 3300028666 | Bacteria | 5138 |
| 271 | Ga0265336_10056872 | 3300028666 | Bacteria | 1175 |
| 272 | Ga0265338_10002640 | 3300028800 | Bacteria | 26412 |
| 273 | Ga0265338_10037515 | 3300028800 | Bacteria | 4610 |
| 274 | Ga0265338_10060242 | 3300028800 | Bacteria | 3337 |
| 275 | Ga0265338_10073490 | 3300028800 | Bacteria | 2913 |
| 276 | Ga0265330_10026100 | 3300031235 | Bacteria | 2646 |
| 277 | Ga0265320_10069751 | 3300031240 | Unclassified | 1658 |
| 278 | Ga0265325_10051342 | 3300031241 | Bacteria | 2120 |
| 279 | Ga0265339_10009789 | 3300031249 | Bacteria | 5990 |
| 280 | Ga0265331_10031125 | 3300031250 | Bacteria | 2653 |
| 281 | Ga0265327_10038167 | 3300031251 | Bacteria | 2624 |
| 282 | Ga0265316_10012502 | 3300031344 | Bacteria | 7609 |
| 283 | Ga0265316_10036185 | 3300031344 | Bacteria | 3992 |
| 284 | Ga0265313_10064272 | 3300031595 | Bacteria | 1707 |
| 285 | Ga0265314_10003898 | 3300031711 | Bacteria | 14178 |
| 286 | Ga0265314_10005113 | 3300031711 | Bacteria | 11945 |
| 287 | Ga0265342_10041510 | 3300031712 | Bacteria | 2785 |
| 288 | Ga0373936_0033382 | 3300035113 | Bacteria | 2040 |
| 289 | Ga0373953_0089746 | 3300035117 | Bacteria | 1285 |
| 290 | Ga0373953_0148727 | 3300035117 | Bacteria | 1003 |
| 291 | Ga0373956_0117283 | 3300035119 | Bacteria | 1242 |
| 292 | Ga0373943_0000490 | 3300035170 | Bacteria | 16855 |
| 293 | Ga0373943_0194389 | 3300035170 | Bacteria | 1120 |
| 294 | Ga0373955_0084471 | 3300035172 | Bacteria | 1800 |
| 295 | Ga0373955_0427496 | 3300035172 | Unclassified | 806 |
| 296 | Ga0373931_0009837 | 3300035691 | Bacteria | 4581 |
| 297 | Ga0373935_0059089 | 3300035692 | Bacteria | 2450 |
| 298 | Ga0373947_0035113 | 3300035725 | Bacteria | 2967 |
| 299 | Ga0373947_0256445 | 3300035725 | Bacteria | 1158 |
| 300 | Ga0373937_0004545 | 3300036401 | Bacteria | 11776 |
| 301 | Ga0373937_0147840 | 3300036401 | Bacteria | 2200 |
| 302 | Ga0373925_0000484 | 3300037068 | Bacteria | 39880 |
| 303 | Ga0395899_0012131 | 3300037312 | Bacteria | 6598 |
| 304 | Ga0395899_0056755 | 3300037312 | Bacteria | 2893 |
| 305 | Ga0395899_0087714 | 3300037312 | Bacteria | 2258 |
| 306 | Ga0395899_0103933 | 3300037312 | Bacteria | 2048 |
| 307 | Ga0395899_0105147 | 3300037312 | Bacteria | 2034 |
| 308 | Ga0395899_0149303 | 3300037312 | Bacteria | 1657 |
| 309 | Ga0395899_0238540 | 3300037312 | Bacteria | 1252 |
| 310 | Ga0395900_0002321 | 3300037418 | Bacteria | 21097 |
| 311 | Ga0395900_0002916 | 3300037418 | Bacteria | 18634 |
| 312 | Ga0395900_0003619 | 3300037418 | Bacteria | 16614 |
| 313 | Ga0395900_0137735 | 3300037418 | Bacteria | 2501 |
| 314 | Ga0395900_0150342 | 3300037418 | Bacteria | 2379 |
| 315 | Ga0395900_0169751 | 3300037418 | Bacteria | 2221 |
| 316 | Ga0395900_0204366 | 3300037418 | Bacteria | 1997 |
| 317 | Ga0395900_0260444 | 3300037418 | Bacteria | 1732 |
| 318 | Ga0395900_0260579 | 3300037418 | Bacteria | 1732 |
| 319 | Ga0395900_0261714 | 3300037418 | Bacteria | 1727 |
| 320 | Ga0395898_0002298 | 3300037466 | Bacteria | 22946 |
| 321 | Ga0395898_0003164 | 3300037466 | Bacteria | 18563 |
| 322 | Ga0395898_0006898 | 3300037466 | Bacteria | 12082 |
| 323 | Ga0395898_0037081 | 3300037466 | Bacteria | 4838 |
| 324 | Ga0395898_0106487 | 3300037466 | Bacteria | 2689 |
| 325 | Ga0395898_0192750 | 3300037466 | Bacteria | 1947 |
| 326 | Ga0395898_0778386 | 3300037466 | Bacteria | 898 |
| 327 | Ga0395905_0002318 | 3300037471 | Bacteria | 21320 |
| 328 | Ga0395905_0015483 | 3300037471 | Bacteria | 7249 |
| 329 | Ga0395905_0026294 | 3300037471 | Bacteria | 5488 |
| 330 | Ga0395905_0041514 | 3300037471 | Bacteria | 4316 |
| 331 | Ga0395905_0049684 | 3300037471 | Bacteria | 3930 |
| 332 | Ga0395905_0115417 | 3300037471 | Bacteria | 2523 |
| 333 | Ga0395905_0312810 | 3300037471 | Bacteria | 1459 |
| 334 | Ga0395901_0002740 | 3300038443 | Bacteria | 17773 |
| 335 | Ga0395901_0011266 | 3300038443 | Bacteria | 9059 |
| 336 | Ga0395901_0016521 | 3300038443 | Bacteria | 7521 |
| 337 | Ga0395901_0107152 | 3300038443 | Bacteria | 2933 |
| 338 | Ga0395901_0209905 | 3300038443 | Bacteria | 2038 |
| 339 | Ga0395901_0422364 | 3300038443 | Bacteria | 1367 |
| 340 | Ga0395901_0528114 | 3300038443 | Bacteria | 1198 |
| 341 | Ga0436360_1319192 | 3300039438 | Bacteria | 19044 |
| 342 | Ga0436363_0202199 | 3300039450 | Bacteria | 719 |
| 343 | Ga0439448_0074522 | 3300042005 | Bacteria | 1134 |
| 344 | Ga0466969_0003575 | 3300044656 | Bacteria | 8274 |
| 345 | Ga0466969_0256040 | 3300044656 | Unclassified | 793 |
| 346 | Ga0466972_0165792 | 3300044658 | Bacteria | 1037 |
| 347 | Ga0466965_0040136 | 3300044683 | Bacteria | 2303 |
| 348 | Ga0466965_0095202 | 3300044683 | Bacteria | 1518 |
| 349 | Ga0466965_0171381 | 3300044683 | Bacteria | 1142 |
| 350 | Ga0466965_0275917 | 3300044683 | Bacteria | 907 |
| 351 | Ga0466965_0298955 | 3300044683 | Bacteria | 873 |
| 352 | Ga0466966_0091251 | 3300044684 | Bacteria | 1891 |
| 353 | Ga0466966_0094498 | 3300044684 | Bacteria | 1853 |
| 354 | Ga0466966_0251605 | 3300044684 | Bacteria | 1064 |
| 355 | Ga0466961_0030878 | 3300044693 | Bacteria | 3443 |
| 356 | Ga0466961_0031890 | 3300044693 | Bacteria | 3387 |
| 357 | Ga0466961_0140237 | 3300044693 | Bacteria | 1513 |
| 358 | Ga0466961_0293958 | 3300044693 | Unclassified | 993 |
| 359 | Ga0466963_0000045 | 3300044694 | Bacteria | 40813 |
| 360 | Ga0466963_0003646 | 3300044694 | Bacteria | 8852 |
| 361 | Ga0466963_0004146 | 3300044694 | Bacteria | 8385 |
| 362 | Ga0466963_0009901 | 3300044694 | Bacteria | 5755 |
| 363 | Ga0466963_0012551 | 3300044694 | Bacteria | 5189 |
| 364 | Ga0466963_0014228 | 3300044694 | Bacteria | 4902 |
| 365 | Ga0466963_0016132 | 3300044694 | Bacteria | 4641 |
| 366 | Ga0466963_0018947 | 3300044694 | Bacteria | 4308 |
| 367 | Ga0466963_0020970 | 3300044694 | Bacteria | 4116 |
| 368 | Ga0466963_0030955 | 3300044694 | Bacteria | 3456 |
| 369 | Ga0466963_0041100 | 3300044694 | Bacteria | 3031 |
| 370 | Ga0466963_0041256 | 3300044694 | Bacteria | 3026 |
| 371 | Ga0466963_0049029 | 3300044694 | Bacteria | 2792 |
| 372 | Ga0466963_0061986 | 3300044694 | Bacteria | 2501 |
| 373 | Ga0466963_0105118 | 3300044694 | Bacteria | 1935 |
| 374 | Ga0466963_0161782 | 3300044694 | Bacteria | 1558 |
| 375 | Ga0466963_0171282 | 3300044694 | Bacteria | 1513 |
| 376 | Ga0466964_0001416 | 3300044706 | Bacteria | 8187 |
| 377 | Ga0466964_0008196 | 3300044706 | Bacteria | 3920 |
| 378 | Ga0466964_0013935 | 3300044706 | Bacteria | 3053 |
| 379 | Ga0466964_0046142 | 3300044706 | Bacteria | 1775 |
| 380 | Ga0466964_0048583 | 3300044706 | Bacteria | 1735 |
| 381 | Ga0466964_0050379 | 3300044706 | Bacteria | 1707 |
| 382 | Ga0466964_0076329 | 3300044706 | Bacteria | 1428 |
| 383 | Ga0466964_0107719 | 3300044706 | Unclassified | 1238 |
| 384 | Ga0466964_0118728 | 3300044706 | Bacteria | 1189 |
| 385 | Ga0466964_0173587 | 3300044706 | Bacteria | 1017 |
| 386 | Ga0466971_0006706 | 3300044719 | Bacteria | 5010 |
| 387 | Ga0466971_0011496 | 3300044719 | Bacteria | 3875 |
| 388 | Ga0466971_0060709 | 3300044719 | Bacteria | 1708 |
| 389 | Ga0466971_0099050 | 3300044719 | Bacteria | 1339 |
| 390 | Ga0466968_0002077 | 3300044735 | Bacteria | 7292 |
| 391 | Ga0466968_0010305 | 3300044735 | Bacteria | 3621 |
| 392 | Ga0466968_0031220 | 3300044735 | Bacteria | 2210 |
| 393 | Ga0466968_0032792 | 3300044735 | Bacteria | 2162 |
| 394 | Ga0466968_0064419 | 3300044735 | Bacteria | 1585 |
| 395 | Ga0466968_0071650 | 3300044735 | Bacteria | 1510 |
| 396 | Ga0466970_0006100 | 3300044765 | Bacteria | 6006 |
| 397 | Ga0466970_0235434 | 3300044765 | Unclassified | 1024 |
| 398 | Ga0466957_0005678 | 3300044842 | Bacteria | 7014 |
| 399 | Ga0466957_0014566 | 3300044842 | Bacteria | 4580 |
| 400 | Ga0466957_0025455 | 3300044842 | Bacteria | 3507 |
| 401 | Ga0466957_0026522 | 3300044842 | Bacteria | 3438 |
| 402 | Ga0466957_0027011 | 3300044842 | Bacteria | 3409 |
| 403 | Ga0466957_0044817 | 3300044842 | Bacteria | 2681 |
| 404 | Ga0466957_0054493 | 3300044842 | Bacteria | 2441 |
| 405 | Ga0466957_0070755 | 3300044842 | Bacteria | 2156 |
| 406 | Ga0466957_0173978 | 3300044842 | Bacteria | 1403 |
| 407 | Ga0466960_0026774 | 3300044901 | Bacteria | 2622 |
| 408 | Ga0466960_0031792 | 3300044901 | Bacteria | 2438 |
| 409 | Ga0466960_0073020 | 3300044901 | Bacteria | 1711 |
| 410 | Ga0466959_0012212 | 3300045049 | Bacteria | 6199 |
| 411 | Ga0466959_0099750 | 3300045049 | Bacteria | 2079 |
| 412 | Ga0466959_0158951 | 3300045049 | Bacteria | 1589 |
| 413 | Ga0466959_0253474 | 3300045049 | Bacteria | 1213 |
| 414 | Ga0466958_0009124 | 3300045836 | Bacteria | 5513 |
| 415 | Ga0466958_0014839 | 3300045836 | Bacteria | 4452 |
| 416 | Ga0466958_0023936 | 3300045836 | Bacteria | 3590 |
| 417 | Ga0466958_0034413 | 3300045836 | Bacteria | 3022 |
| 418 | Ga0466958_0039493 | 3300045836 | Bacteria | 2836 |
| 419 | Ga0466958_0051119 | 3300045836 | Bacteria | 2501 |
| 420 | Ga0466958_0060470 | 3300045836 | Bacteria | 2306 |
| 421 | Ga0466958_0063391 | 3300045836 | Bacteria | 2254 |
| 422 | Ga0466958_0467548 | 3300045836 | Bacteria | 817 |
| 423 | Ga0466967_0003258 | 3300045976 | Bacteria | 10514 |
| 424 | Ga0466967_0005055 | 3300045976 | Bacteria | 9044 |
| 425 | Ga0466967_0015184 | 3300045976 | Bacteria | 6029 |
| 426 | Ga0466967_0016056 | 3300045976 | Bacteria | 5891 |
| 427 | Ga0466967_0018134 | 3300045976 | Bacteria | 5615 |
| 428 | Ga0466967_0018492 | 3300045976 | Bacteria | 5571 |
| 429 | Ga0466967_0035993 | 3300045976 | Bacteria | 4221 |
| 430 | Ga0466967_0038444 | 3300045976 | Bacteria | 4105 |
| 431 | Ga0466967_0060071 | 3300045976 | Bacteria | 3367 |
| 432 | Ga0466967_0061106 | 3300045976 | Bacteria | 3341 |
| 433 | Ga0466967_0092894 | 3300045976 | Bacteria | 2745 |
| 434 | Ga0466967_0141382 | 3300045976 | Bacteria | 2242 |
| 435 | Ga0466967_0142166 | 3300045976 | Bacteria | 2236 |
| 436 | Ga0466967_0192812 | 3300045976 | Bacteria | 1926 |
| 437 | Ga0466967_0197569 | 3300045976 | Bacteria | 1903 |
| 438 | Ga0466967_0208146 | 3300045976 | Bacteria | 1854 |
| 439 | Ga0466967_0269609 | 3300045976 | Bacteria | 1631 |
| 440 | Ga0466967_0290406 | 3300045976 | Bacteria | 1571 |
| 441 | Ga0466967_0318078 | 3300045976 | Bacteria | 1500 |
| 442 | Ga0466967_0327404 | 3300045976 | Bacteria | 1479 |
| 443 | Ga0466967_0486495 | 3300045976 | Unclassified | 1209 |
| 444 | Ga0466967_0547028 | 3300045976 | Bacteria | 1139 |
| 445 | Ga0495592_0001695 | 3300046454 | Bacteria | 15479 |
| 446 | Ga0495592_0006827 | 3300046454 | Bacteria | 8521 |
| 447 | Ga0495592_0385954 | 3300046454 | Bacteria | 890 |
| 448 | Ga0495603_0016017 | 3300046455 | Bacteria | 4533 |
| 449 | Ga0495629_0020654 | 3300046459 | Bacteria | 4702 |
| 450 | Ga0495629_0353598 | 3300046459 | Bacteria | 1002 |
| 451 | Ga0495641_0002472 | 3300046461 | Bacteria | 14578 |
| 452 | Ga0495641_0042017 | 3300046461 | Bacteria | 2121 |
| 453 | Ga0495641_0113016 | 3300046461 | Unclassified | 1211 |
| 454 | Ga0495641_0184537 | 3300046461 | Unclassified | 934 |
| 455 | Ga0495651_0000080 | 3300046462 | Bacteria | 70453 |
| 456 | Ga0495651_0037755 | 3300046462 | Bacteria | 3761 |
| 457 | Ga0495651_0135922 | 3300046462 | Bacteria | 1789 |
| 458 | Ga0495653_0015405 | 3300046463 | Bacteria | 6232 |
| 459 | Ga0495653_0017190 | 3300046463 | Bacteria | 5881 |
| 460 | Ga0495653_0102317 | 3300046463 | Bacteria | 2073 |
| 461 | Ga0495653_0189099 | 3300046463 | Bacteria | 1406 |
| 462 | Ga0495580_0054014 | 3300046472 | Bacteria | 2834 |
| 463 | Ga0495639_0000425 | 3300046475 | Bacteria | 20170 |
| 464 | Ga0495639_0071989 | 3300046475 | Bacteria | 1598 |
| 465 | Ga0495662_0025715 | 3300046476 | Bacteria | 2842 |
| 466 | Ga0495664_0047307 | 3300046477 | Bacteria | 2552 |
| 467 | Ga0495664_0069419 | 3300046477 | Bacteria | 2103 |
| 468 | Ga0495664_0169529 | 3300046477 | Bacteria | 1324 |
| 469 | Ga0495584_0020264 | 3300046491 | Bacteria | 3379 |
| 470 | Ga0495607_0015325 | 3300046501 | Bacteria | 4971 |
| 471 | Ga0495608_0010759 | 3300046511 | Bacteria | 6378 |
| 472 | Ga0495608_0017659 | 3300046511 | Bacteria | 4933 |
| 473 | Ga0495608_0201301 | 3300046511 | Bacteria | 1254 |
| 474 | Ga0495608_0209526 | 3300046511 | Bacteria | 1226 |
| 475 | Ga0495618_0001505 | 3300046514 | Bacteria | 15641 |
| 476 | Ga0495618_0010140 | 3300046514 | Bacteria | 5698 |
| 477 | Ga0495618_0097555 | 3300046514 | Bacteria | 1880 |
| 478 | Ga0495618_0210933 | 3300046514 | Bacteria | 1227 |
| 479 | Ga0495628_0001647 | 3300046516 | Bacteria | 20433 |
| 480 | Ga0495628_0203641 | 3300046516 | Unclassified | 1490 |
| 481 | Ga0495630_0001297 | 3300046517 | Bacteria | 17226 |
| 482 | Ga0495630_0041680 | 3300046517 | Bacteria | 3428 |
| 483 | Ga0495630_0120541 | 3300046517 | Bacteria | 1990 |
| 484 | Ga0495630_0249998 | 3300046517 | Bacteria | 1354 |
| 485 | Ga0495630_0261197 | 3300046517 | Archaea | 1323 |
| 486 | Ga0495630_0273017 | 3300046517 | Bacteria | 1292 |
| 487 | Ga0495630_0450288 | 3300046517 | Archaea | 986 |
| 488 | Ga0495630_0554395 | 3300046517 | Unclassified | 881 |
| 489 | Ga0495631_0062080 | 3300046518 | Bacteria | 1620 |
| 490 | Ga0495644_0022590 | 3300046523 | Bacteria | 2397 |
| 491 | Ga0495663_0049160 | 3300046525 | Bacteria | 1302 |
| 492 | Ga0495666_0000168 | 3300046526 | Bacteria | 27728 |
| 493 | Ga0495642_0061697 | 3300046528 | Bacteria | 1556 |
| 494 | Ga0495652_0001035 | 3300046529 | Bacteria | 31758 |
| 495 | Ga0495652_0035030 | 3300046529 | Bacteria | 4370 |
| 496 | Ga0495652_0063512 | 3300046529 | Bacteria | 3108 |
| 497 | Ga0495652_0191224 | 3300046529 | Bacteria | 1562 |
| 498 | Ga0495665_0000038 | 3300046531 | Bacteria | 51967 |
| 499 | Ga0495640_0096781 | 3300046533 | Bacteria | 1941 |
| 500 | Ga0495640_0106859 | 3300046533 | Bacteria | 1832 |
| 501 | Ga0495640_0156117 | 3300046533 | Bacteria | 1464 |
| 502 | Ga0495640_0247398 | 3300046533 | Bacteria | 1118 |
| 503 | Ga0495586_0008220 | 3300046535 | Bacteria | 5560 |
| 504 | Ga0495586_0058486 | 3300046535 | Bacteria | 2093 |
| 505 | Ga0495586_0216561 | 3300046535 | Unclassified | 1087 |
| 506 | Ga0495587_0000270 | 3300046536 | Bacteria | 37255 |
| 507 | Ga0495587_0045904 | 3300046536 | Bacteria | 2595 |
| 508 | Ga0495609_0016594 | 3300046538 | Bacteria | 3430 |
| 509 | Ga0495645_0000038 | 3300046543 | Bacteria | 96124 |
| 510 | Ga0495645_0132990 | 3300046543 | Bacteria | 1741 |
| 511 | Ga0495667_0008106 | 3300046559 | Bacteria | 7130 |
| 512 | Ga0495667_0024980 | 3300046559 | Bacteria | 4026 |
| 513 | Ga0495667_0064203 | 3300046559 | Bacteria | 2402 |
| 514 | Ga0495667_0069725 | 3300046559 | Bacteria | 2294 |
| 515 | Ga0495667_0077952 | 3300046559 | Bacteria | 2154 |
| 516 | Ga0495656_0000407 | 3300046615 | Bacteria | 14198 |
| 517 | Ga0495634_0069163 | 3300046642 | Bacteria | 2330 |
| 518 | Ga0495635_0038952 | 3300046663 | Bacteria | 3291 |
| 519 | Ga0495657_0004533 | 3300046675 | Bacteria | 11101 |
| 520 | Ga0495657_0015410 | 3300046675 | Bacteria | 5594 |
| 521 | Ga0495657_0042630 | 3300046675 | Bacteria | 3097 |
| 522 | Ga0495657_0073972 | 3300046675 | Bacteria | 2218 |
| 523 | Ga0495657_0190927 | 3300046675 | Bacteria | 1252 |
| 524 | Ga0495599_0000142 | 3300046678 | Bacteria | 46621 |
| 525 | Ga0495599_0216966 | 3300046678 | Bacteria | 1172 |
| 526 | Ga0495599_0299452 | 3300046678 | Unclassified | 971 |
| 527 | Ga0495623_0000210 | 3300046679 | Bacteria | 37384 |
| 528 | Ga0495646_0007272 | 3300046680 | Bacteria | 7033 |
| 529 | Ga0495646_0079883 | 3300046680 | Bacteria | 1908 |
| 530 | Ga0495647_0000336 | 3300046681 | Bacteria | 13182 |
| 531 | Ga0495658_0002124 | 3300046683 | Bacteria | 10040 |
| 532 | Ga0495658_0033284 | 3300046683 | Bacteria | 2821 |
| 533 | Ga0495658_0133579 | 3300046683 | Bacteria | 1513 |
| 534 | Ga0495613_0025860 | 3300046689 | Bacteria | 4373 |
| 535 | Ga0495613_0034301 | 3300046689 | Bacteria | 3769 |
| 536 | Ga0495613_0062828 | 3300046689 | Bacteria | 2717 |
| 537 | Ga0495613_0086515 | 3300046689 | Bacteria | 2272 |
| 538 | Ga0495613_0098438 | 3300046689 | Bacteria | 2114 |
| 539 | Ga0495613_0159516 | 3300046689 | Unclassified | 1605 |
| 540 | Ga0495613_0237981 | 3300046689 | Bacteria | 1274 |
| 541 | Ga0495624_0010430 | 3300046690 | Bacteria | 6405 |
| 542 | Ga0495624_0045021 | 3300046690 | Bacteria | 2811 |
| 543 | Ga0495600_0015375 | 3300046809 | Bacteria | 4838 |
| 544 | Ga0495600_0066532 | 3300046809 | Bacteria | 2356 |
| 545 | Ga0495581_0002990 | 3300047315 | Bacteria | 9687 |
| 546 | Ga0495604_0000043 | 3300047317 | Bacteria | 116335 |
| 547 | Ga0495604_0041956 | 3300047317 | Bacteria | 3587 |
| 548 | Ga0495604_0079602 | 3300047317 | Bacteria | 2457 |
| 549 | Ga0495674_0014382 | 3300047319 | Bacteria | 7409 |
| 550 | Ga0495674_0306353 | 3300047319 | Bacteria | 1297 |
| 551 | Ga0495676_0088596 | 3300047321 | Bacteria | 2320 |
| 552 | Ga0495676_0143998 | 3300047321 | Bacteria | 1705 |
| 553 | Ga0495676_0184388 | 3300047321 | Bacteria | 1460 |
| 554 | Ga0495676_0188060 | 3300047321 | Bacteria | 1442 |
| 555 | Ga0495680_0009003 | 3300047322 | Bacteria | 9018 |
| 556 | Ga0495680_0068139 | 3300047322 | Bacteria | 2719 |
| 557 | Ga0495680_0140499 | 3300047322 | Bacteria | 1767 |
| 558 | Ga0495675_0000896 | 3300047444 | Bacteria | 18216 |
| 559 | Ga0495684_0001595 | 3300047471 | Bacteria | 18196 |
| 560 | Ga0495684_0113754 | 3300047471 | Bacteria | 2040 |
| 561 | Ga0495684_0113755 | 3300047471 | Bacteria | 2040 |
| 562 | Ga0495684_0138366 | 3300047471 | Bacteria | 1826 |
| 563 | Ga0495593_0001683 | 3300047673 | Bacteria | 13111 |
| 564 | Ga0495593_0133032 | 3300047673 | Bacteria | 1262 |
| 565 | Ga0495602_0005605 | 3300048088 | Bacteria | 13183 |
| 566 | Ga0495602_0112003 | 3300048088 | Bacteria | 2215 |
| 567 | Ga0495602_0228603 | 3300048088 | Bacteria | 1399 |
| 568 | Ga0495614_0002709 | 3300048089 | Bacteria | 7876 |
| 569 | Ga0496100_0013693 | 3300048903 | Bacteria | 4687 |
| 570 | Ga0496100_0066208 | 3300048903 | Bacteria | 2396 |
| 571 | Ga0496100_0102582 | 3300048903 | Bacteria | 1974 |
| 572 | Ga0496100_0188274 | 3300048903 | Bacteria | 1497 |
| 573 | Ga0496101_0021807 | 3300048904 | Bacteria | 4401 |
| 574 | Ga0496101_0129757 | 3300048904 | Bacteria | 1913 |
| 575 | Ga0496101_0152398 | 3300048904 | Unclassified | 1769 |
| 576 | Ga0496101_0383058 | 3300048904 | Unclassified | 1106 |
| 577 | Ga0496102_0011192 | 3300048905 | Bacteria | 7726 |
| 578 | Ga0496102_0076523 | 3300048905 | Bacteria | 3078 |
| 579 | Ga0496102_0092691 | 3300048905 | Bacteria | 2798 |
| 580 | Ga0496102_0370344 | 3300048905 | Bacteria | 1348 |
| 581 | Ga0496103_0024156 | 3300048906 | Bacteria | 3666 |
| 582 | Ga0496103_0025806 | 3300048906 | Bacteria | 3553 |
| 583 | Ga0496103_0040478 | 3300048906 | Bacteria | 2863 |
| 584 | Ga0496103_0086245 | 3300048906 | Bacteria | 1979 |
| 585 | Ga0496103_0283164 | 3300048906 | Bacteria | 1066 |
| 586 | Ga0496104_0009980 | 3300048907 | Bacteria | 8478 |
| 587 | Ga0496104_0019112 | 3300048907 | Bacteria | 6263 |
| 588 | Ga0496104_0034586 | 3300048907 | Bacteria | 4713 |
| 589 | Ga0496104_0069894 | 3300048907 | Bacteria | 3337 |
| 590 | Ga0496104_0109377 | 3300048907 | Bacteria | 2649 |
| 591 | Ga0496104_0111557 | 3300048907 | Bacteria | 2622 |
| 592 | Ga0496104_0180437 | 3300048907 | Bacteria | 2022 |
| 593 | Ga0496104_0226030 | 3300048907 | Bacteria | 1784 |
| 594 | Ga0496104_0354312 | 3300048907 | Bacteria | 1380 |
| 595 | Ga0496104_0740786 | 3300048907 | Bacteria | 890 |
| 596 | Ga0496105_0007204 | 3300048908 | Bacteria | 8586 |
| 597 | Ga0496105_0017997 | 3300048908 | Bacteria | 5669 |
| 598 | Ga0496105_0056852 | 3300048908 | Bacteria | 3229 |
| 599 | Ga0496105_0062355 | 3300048908 | Bacteria | 3076 |
| 600 | Ga0496105_0608573 | 3300048908 | Unclassified | 847 |
| 601 | Ga0496106_0015136 | 3300048909 | Bacteria | 5708 |
| 602 | Ga0496106_0097026 | 3300048909 | Bacteria | 2282 |
| 603 | Ga0496106_0219321 | 3300048909 | Bacteria | 1517 |
| 604 | Ga0496106_0262946 | 3300048909 | Unclassified | 1381 |
| 605 | Ga0496107_0016813 | 3300048910 | Bacteria | 5143 |
| 606 | Ga0496107_0054443 | 3300048910 | Bacteria | 2887 |
| 607 | Ga0496107_0152585 | 3300048910 | Bacteria | 1709 |
| 608 | Ga0496107_0361469 | 3300048910 | Bacteria | 1080 |
| 609 | Ga0496108_0010693 | 3300048911 | Bacteria | 7446 |
| 610 | Ga0496108_0016216 | 3300048911 | Bacteria | 6075 |
| 611 | Ga0496108_0034634 | 3300048911 | Bacteria | 4195 |
| 612 | Ga0496108_0064623 | 3300048911 | Bacteria | 3083 |
| 613 | Ga0496108_0204505 | 3300048911 | Bacteria | 1713 |
| 614 | Ga0496108_0289322 | 3300048911 | Unclassified | 1426 |
| 615 | Ga0496108_0617785 | 3300048911 | Bacteria | 944 |
| 616 | Ga0496108_0791767 | 3300048911 | Bacteria | 818 |
| 617 | Ga0496109_0000576 | 3300048912 | Bacteria | 30721 |
| 618 | Ga0496109_0010076 | 3300048912 | Bacteria | 8064 |
| 619 | Ga0496109_0020405 | 3300048912 | Bacteria | 5852 |
| 620 | Ga0496109_0023460 | 3300048912 | Bacteria | 5478 |
| 621 | Ga0496109_0101708 | 3300048912 | Bacteria | 2667 |
| 622 | Ga0496109_0109156 | 3300048912 | Bacteria | 2572 |
| 623 | Ga0496109_0142268 | 3300048912 | Bacteria | 2243 |
| 624 | Ga0496109_0335967 | 3300048912 | Unclassified | 1426 |
| 625 | Ga0496110_0186539 | 3300048913 | Bacteria | 1883 |
| 626 | Ga0496110_0519282 | 3300048913 | Bacteria | 1083 |
| 627 | Ga0496110_0552438 | 3300048913 | Bacteria | 1046 |
| 628 | Ga0496110_0795915 | 3300048913 | Bacteria | 850 |
| 629 | Ga0496111_0011531 | 3300048914 | Bacteria | 5959 |
| 630 | Ga0496111_0016158 | 3300048914 | Bacteria | 5140 |
| 631 | Ga0496111_0078916 | 3300048914 | Bacteria | 2401 |
| 632 | Ga0496112_0000273 | 3300048915 | Bacteria | 33471 |
| 633 | Ga0496112_0027531 | 3300048915 | Bacteria | 5481 |
| 634 | Ga0496112_0033709 | 3300048915 | Bacteria | 4979 |
| 635 | Ga0496112_0045238 | 3300048915 | Bacteria | 4315 |
| 636 | Ga0496112_0048303 | 3300048915 | Bacteria | 4173 |
| 637 | Ga0496112_0064830 | 3300048915 | Bacteria | 3605 |
| 638 | Ga0496112_0077785 | 3300048915 | Bacteria | 3281 |
| 639 | Ga0496112_0100608 | 3300048915 | Bacteria | 2860 |
| 640 | Ga0496112_0129921 | 3300048915 | Bacteria | 2490 |
| 641 | Ga0496112_0215046 | 3300048915 | Bacteria | 1879 |
| 642 | Ga0496112_0917843 | 3300048915 | Unclassified | 797 |
| 643 | Ga0496113_0019490 | 3300048916 | Bacteria | 4746 |
| 644 | Ga0496113_0021814 | 3300048916 | Bacteria | 4522 |
| 645 | Ga0496113_0157833 | 3300048916 | Bacteria | 1792 |
| 646 | Ga0496114_0018397 | 3300048917 | Bacteria | 5648 |
| 647 | Ga0496114_0021259 | 3300048917 | Bacteria | 5277 |
| 648 | Ga0496114_0085697 | 3300048917 | Bacteria | 2668 |
| 649 | Ga0496114_0164191 | 3300048917 | Bacteria | 1933 |
| 650 | Ga0496114_0177143 | 3300048917 | Bacteria | 1861 |
| 651 | Ga0496114_0243797 | 3300048917 | Bacteria | 1581 |
| 652 | Ga0496114_0341652 | 3300048917 | Bacteria | 1324 |
| 653 | Ga0496115_0005207 | 3300048918 | Bacteria | 9455 |
| 654 | Ga0496115_0044332 | 3300048918 | Bacteria | 3547 |
| 655 | Ga0496115_0097518 | 3300048918 | Bacteria | 2407 |
| 656 | Ga0496115_0130353 | 3300048918 | Bacteria | 2072 |
| 657 | Ga0496115_0176729 | 3300048918 | Bacteria | 1765 |
| 658 | Ga0501047_0010057 | 3300049581 | Bacteria | 8942 |
| 659 | Ga0501047_0297164 | 3300049581 | Bacteria | 1458 |
| 660 | Ga0501067_0001219 | 3300049583 | Bacteria | 13976 |
| 661 | Ga0501067_0026964 | 3300049583 | Bacteria | 3182 |
| 662 | Ga0501067_0050684 | 3300049583 | Bacteria | 2300 |
| 663 | Ga0501067_0129492 | 3300049583 | Bacteria | 1404 |
| 664 | Ga0501069_0007861 | 3300049585 | Bacteria | 5598 |
| 665 | Ga0501069_0102046 | 3300049585 | Bacteria | 1629 |
| 666 | Ga0501069_0104267 | 3300049585 | Bacteria | 1611 |
| 667 | Ga0501069_0210255 | 3300049585 | Bacteria | 1129 |
| 668 | Ga0501070_0000120 | 3300049586 | Bacteria | 70354 |
| 669 | Ga0501070_0296425 | 3300049586 | Bacteria | 1318 |
| 670 | Ga0501070_0473968 | 3300049586 | Unclassified | 1007 |
| 671 | Ga0501073_0259495 | 3300049589 | Bacteria | 1199 |
| 672 | nmdc:mga05p37_10748_c1 | 3300050507 | Bacteria | 10866 |
| 673 | nmdc:mga05p37_147138_c1 | 3300050507 | Bacteria | 2883 |
| 674 | nmdc:mga06r32_75182_c1 | 3300050510 | Bacteria | 3277 |
| 675 | nmdc:mga0n895_25875_c1 | 3300050512 | Bacteria | 5550 |
| 676 | nmdc:mga0n895_40422_c1 | 3300050512 | Bacteria | 4530 |
| 677 | nmdc:mga0rr50_78807_c1 | 3300050513 | Bacteria | 2536 |
| 678 | nmdc:mga08x19_36535_c1 | 3300050514 | Bacteria | 3112 |
| 679 | nmdc:mga0a205_63929_c1 | 3300050515 | Bacteria | 3555 |
| 680 | Ga0495601_0000462 | 3300053077 | Bacteria | 21348 |
| 681 | Ga0495601_0007102 | 3300053077 | Bacteria | 6558 |
| 682 | Ga0495601_0029007 | 3300053077 | Bacteria | 3430 |
| 683 | Ga0495601_0045478 | 3300053077 | Bacteria | 2761 |
| 684 | Ga0495601_0065477 | 3300053077 | Bacteria | 2313 |
| 685 | Ga0495601_0148406 | 3300053077 | Bacteria | 1530 |
| 686 | Ga0495612_0015817 | 3300053078 | Bacteria | 3024 |
| 687 | Ga0495612_0134724 | 3300053078 | Unclassified | 1069 |
| 688 | Ga0495595_0010031 | 3300053084 | Bacteria | 3929 |
| 689 | Ga0495595_0013773 | 3300053084 | Bacteria | 3420 |
| 690 | Ga0495595_0048268 | 3300053084 | Bacteria | 1965 |
| 691 | Ga0495619_0000930 | 3300053085 | Bacteria | 19269 |
| 692 | Ga0495619_0007777 | 3300053085 | Bacteria | 6786 |
| 693 | Ga0495619_0115937 | 3300053085 | Bacteria | 1833 |
| 694 | Ga0495619_0180324 | 3300053085 | Bacteria | 1461 |
| 695 | Ga0495619_0197603 | 3300053085 | Bacteria | 1392 |
| 696 | Ga0500566_0122819 | 3300053094 | Bacteria | 1398 |
| 697 | Ga0466962_0003377 | 3300061719 | Bacteria | 7598 |
| 698 | Ga0466962_0009040 | 3300061719 | Bacteria | 4772 |
| 699 | Ga0466962_0015185 | 3300061719 | Bacteria | 3713 |
| 700 | Ga0530510_0069148 | 3300061734 | Bacteria | 2562 |
| 701 | Ga0105240_10231006 | |||
| 702 | JGI24750J21931_1016088 | |||
| 703 | Ga0058861_11795641 | |||
| 704 | Ga0070658_10024432 | |||
| 705 | Ga0070658_10027699 | |||
| 706 | Ga0070658_10056989 | |||
| 707 | Ga0070658_10165543 | |||
| 708 | Ga0070683_100087739 | |||
| 709 | Ga0070683_100228549 | |||
| 710 | Ga0070683_100524988 | |||
| 711 | Ga0070680_100085414 | |||
| 712 | Ga0070680_100200836 | |||
| 713 | Ga0070682_100073937 | |||
| 714 | Ga0070682_100076586 | |||
| 715 | Ga0070682_100167800 | |||
| 716 | Ga0068868_100160749 | |||
| 717 | Ga0068868_100382893 | |||
| 718 | Ga0070660_100012851 | |||
| 719 | Ga0070660_100019859 | |||
| 720 | Ga0070660_100032183 | |||
| 721 | Ga0070660_100307363 | |||
| 722 | Ga0070691_10137341 | |||
| 723 | Ga0070687_100457568 | |||
| 724 | Ga0070661_100061509 | |||
| 725 | Ga0070661_100086063 | |||
| 726 | Ga0070661_100260067 | |||
| 727 | Ga0070659_100021251 | |||
| 728 | Ga0070659_100046551 | |||
| 729 | Ga0070659_100153962 | |||
| 730 | Ga0070709_10020213 | |||
| 731 | Ga0070714_100013488 | |||
| 732 | Ga0070714_100120682 | |||
| 733 | Ga0070714_100123413 | |||
| 734 | Ga0070714_100344961 | |||
| 735 | Ga0070714_100510270 | |||
| 736 | Ga0070714_100682279 | |||
| 737 | Ga0070713_100020647 | |||
| 738 | Ga0070713_100043623 | |||
| 739 | Ga0070713_100125413 | |||
| 740 | Ga0070713_100151649 | |||
| 741 | Ga0070713_100581607 | |||
| 742 | Ga0070710_10031603 | |||
| 743 | Ga0070710_10376899 | |||
| 744 | Ga0070711_100008323 | |||
| 745 | Ga0070711_100207041 | |||
| 746 | Ga0070705_100094011 | |||
| 747 | Ga0070705_100182621 | |||
| 748 | Ga0070708_100008860 | |||
| 749 | Ga0070708_100195292 | |||
| 750 | Ga0070708_100395208 | |||
| 751 | Ga0070663_100305060 | |||
| 752 | Ga0070678_100254021 | |||
| 753 | Ga0070681_10008727 | |||
| 754 | Ga0070681_10020145 | |||
| 755 | Ga0070681_10022373 | |||
| 756 | Ga0070681_10062862 | |||
| 757 | Ga0070681_10161124 | |||
| 758 | Ga0070681_10197265 | |||
| 759 | Ga0070685_10297942 | |||
| 760 | Ga0070706_100028844 | |||
| 761 | Ga0070706_100261306 | |||
| 762 | Ga0070706_100703574 | |||
| 763 | Ga0070707_100000441 | |||
| 764 | Ga0070707_100134959 | |||
| 765 | Ga0070707_100221237 | |||
| 766 | Ga0070707_100597467 | |||
| 767 | Ga0070707_100671261 | |||
| 768 | Ga0070698_100101674 | |||
| 769 | Ga0070698_100168661 | |||
| 770 | Ga0070698_100358241 | |||
| 771 | Ga0070698_100523307 | |||
| 772 | Ga0070698_100538307 | |||
| 773 | Ga0070699_100160422 | |||
| 774 | Ga0070699_100230326 | |||
| 775 | Ga0070699_100713993 | |||
| 776 | Ga0070679_100017413 | |||
| 777 | Ga0070679_100035170 | |||
| 778 | Ga0070679_100085191 | |||
| 779 | Ga0070684_100081287 | |||
| 780 | Ga0070684_100322014 | |||
| 781 | Ga0070697_100567645 | |||
| 782 | Ga0068853_100582316 | |||
| 783 | Ga0070695_100000005 | |||
| 784 | Ga0070665_100106594 | |||
| 785 | Ga0070704_100069974 | |||
| 786 | Ga0068855_100049137 | |||
| 787 | Ga0068855_100073066 | |||
| 788 | Ga0068855_100196517 | |||
| 789 | Ga0068855_100293061 | |||
| 790 | Ga0070664_100212525 | |||
| 791 | Ga0068857_100087436 | |||
| 792 | Ga0068856_100040463 | |||
| 793 | Ga0068856_100120281 | |||
| 794 | Ga0068856_100135248 | |||
| 795 | Ga0068856_100162142 | |||
| 796 | Ga0068856_100348738 | |||
| 797 | Ga0068852_100044119 | |||
| 798 | Ga0068852_100297990 | |||
| 799 | Ga0068852_100332818 | |||
| 800 | Ga0081539_10001192 | |||
| 801 | Ga0070717_10019299 | |||
| 802 | Ga0070717_10034836 | |||
| 803 | Ga0070717_10050873 | |||
| 804 | Ga0070717_10072479 | |||
| 805 | Ga0070717_10101944 | |||
| 806 | Ga0070717_10366799 | |||
| 807 | Ga0070717_10459177 | |||
| 808 | Ga0075432_10044062 | |||
| 809 | Ga0070716_100041824 | |||
| 810 | Ga0070712_100024906 | |||
| 811 | Ga0070712_100070171 | |||
| 812 | Ga0070712_100170933 | |||
| 813 | Ga0070712_100288825 | |||
| 814 | Ga0097621_100180783 | |||
| 815 | Ga0068871_100108423 | |||
| 816 | Ga0075433_10008761 | |||
| 817 | Ga0075434_100007792 | |||
| 818 | Ga0075436_100013785 | |||
| 819 | Ga0075435_100002153 | |||
| 820 | Ga0075435_100097080 | |||
| 821 | Ga0105240_10003672 | |||
| 822 | Ga0105240_10152267 | |||
| 823 | Ga0105240_10248388 | |||
| 824 | Ga0111539_10583602 | |||
| 825 | Ga0105245_10429619 | |||
| 826 | Ga0105247_10056527 | |||
| 827 | Ga0105247_10505657 | |||
| 828 | Ga0114129_10010920 | |||
| 829 | Ga0114129_10084015 | |||
| 830 | Ga0114129_10173306 | |||
| 831 | Ga0105241_10762588 | |||
| 832 | Ga0105242_10641106 | |||
| 833 | Ga0105248_10778137 | |||
| 834 | Ga0105248_10950813 | |||
| 835 | Ga0105237_10005371 | |||
| 836 | Ga0105237_10115359 | |||
| 837 | Ga0105238_10066727 | |||
| 838 | Ga0105238_10121072 | |||
| 839 | Ga0105238_10387396 | |||
| 840 | Ga0105239_10145120 | |||
| 841 | Ga0105239_10227169 | |||
| 842 | Ga0157371_10142109 | |||
| 843 | Ga0157370_10153567 | |||
| 844 | Ga0157370_10248207 | |||
| 845 | Ga0157369_10134428 | |||
| 846 | Ga0157369_10163797 | |||
| 847 | Ga0157369_10499219 | |||
| 848 | Ga0157369_10681050 | |||
| 849 | Ga0157369_10774600 | |||
| 850 | Ga0157369_10806071 | |||
| 851 | Ga0157374_10023602 | |||
| 852 | Ga0157374_10117664 | |||
| 853 | Ga0157374_10242616 | |||
| 854 | Ga0163162_10175643 | |||
| 855 | Ga0157372_10029509 | |||
| 856 | Ga0157372_10030921 | |||
| 857 | Ga0157372_10046412 | |||
| 858 | Ga0157372_10168880 | |||
| 859 | Ga0157372_10449034 | |||
| 860 | Ga0157372_10506095 | |||
| 861 | Ga0157372_10667764 | |||
| 862 | Ga0163163_10203665 | |||
| 863 | Ga0182008_10004681 | |||
| 864 | Ga0182008_10064564 | |||
| 865 | Ga0157379_10217025 | |||
| 866 | Ga0157376_10198666 | |||
| 867 | Ga0182006_1035423 | |||
| 868 | Ga0182007_10004571 | |||
| 869 | Ga0206356_11012070 | |||
| 870 | Ga0206355_1397364 | |||
| 871 | Ga0206354_10062336 | |||
| 872 | Ga0206354_11219805 | |||
| 873 | Ga0154015_1013125 | |||
| 874 | Ga0213874_10048817 | |||
| 875 | Ga0224712_10016452 | |||
| 876 | Ga0224712_10025334 | |||
| 877 | Ga0224712_10229481 | |||
| 878 | Ga0207692_10054860 | |||
| 879 | Ga0207647_10190021 | |||
| 880 | Ga0207699_10002574 | |||
| 881 | Ga0207705_10120996 | |||
| 882 | Ga0207705_10261999 | |||
| 883 | Ga0207684_10032181 | |||
| 884 | Ga0207654_10225918 | |||
| 885 | Ga0207707_10008378 | |||
| 886 | Ga0207707_10013655 | |||
| 887 | Ga0207707_10038882 | |||
| 888 | Ga0207707_10092395 | |||
| 889 | Ga0207707_10134970 | |||
| 890 | Ga0207707_10151623 | |||
| 891 | Ga0207707_10505070 | |||
| 892 | Ga0207695_10033835 | |||
| 893 | Ga0207695_10223609 | |||
| 894 | Ga0207695_10546212 | |||
| 895 | Ga0207671_10024918 | |||
| 896 | Ga0207693_10000856 | |||
| 897 | Ga0207693_10050646 | |||
| 898 | Ga0207693_10105233 | |||
| 899 | Ga0207693_10184819 | |||
| 900 | Ga0207663_10005976 | |||
| 901 | Ga0207663_10059231 | |||
| 902 | Ga0207663_10062412 | |||
| 903 | Ga0207663_10221055 | |||
| 904 | Ga0207660_10007020 | |||
| 905 | Ga0207660_10091799 | |||
| 906 | Ga0207660_10331411 | |||
| 907 | Ga0207662_10176943 | |||
| 908 | Ga0207657_10020746 | |||
| 909 | Ga0207657_10023038 | |||
| 910 | Ga0207657_10024582 | |||
| 911 | Ga0207657_10033465 | |||
| 912 | Ga0207649_10042138 | |||
| 913 | Ga0207649_10116300 | |||
| 914 | Ga0207649_10128062 | |||
| 915 | Ga0207652_10009097 | |||
| 916 | Ga0207652_10021758 | |||
| 917 | Ga0207652_10097892 | |||
| 918 | Ga0207652_10319270 | |||
| 919 | Ga0207652_10446307 | |||
| 920 | Ga0207646_10003470 | |||
| 921 | Ga0207646_10045161 | |||
| 922 | Ga0207646_10182935 | |||
| 923 | Ga0207646_10208970 | |||
| 924 | Ga0207646_10519569 | |||
| 925 | Ga0207694_10102747 | |||
| 926 | Ga0207694_10636373 | |||
| 927 | Ga0207687_10090491 | |||
| 928 | Ga0207687_10396102 | |||
| 929 | Ga0207700_10067535 | |||
| 930 | Ga0207700_10101197 | |||
| 931 | Ga0207700_10239990 | |||
| 932 | Ga0207700_10660510 | |||
| 933 | Ga0207700_10711976 | |||
| 934 | Ga0207664_10002961 | |||
| 935 | Ga0207664_10009365 | |||
| 936 | Ga0207664_10026453 | |||
| 937 | Ga0207664_10044311 | |||
| 938 | Ga0207664_10144518 | |||
| 939 | Ga0207664_10172944 | |||
| 940 | Ga0207664_10271111 | |||
| 941 | Ga0207664_10346902 | |||
| 942 | Ga0207690_10021561 | |||
| 943 | Ga0207690_10067212 | |||
| 944 | Ga0207690_10221685 | |||
| 945 | Ga0207665_10000058 | |||
| 946 | Ga0207665_10157650 | |||
| 947 | Ga0207665_10458610 | |||
| 948 | Ga0207711_10719490 | |||
| 949 | Ga0207661_10244249 | |||
| 950 | Ga0207661_10259689 | |||
| 951 | Ga0207679_10564874 | |||
| 952 | Ga0207667_10073330 | |||
| 953 | Ga0207667_10075624 | |||
| 954 | Ga0207667_10822849 | |||
| 955 | Ga0207677_10252078 | |||
| 956 | Ga0207678_10150255 | |||
| 957 | Ga0207702_10144393 | |||
| 958 | Ga0207702_10247340 | |||
| 959 | Ga0207674_10027937 | |||
| 960 | Ga0207674_10091516 | |||
| 961 | Ga0207674_10141414 | |||
| 962 | Ga0207698_10412009 | |||
| 963 | Ga0207428_10079558 | |||
| 964 | Ga0265319_1001514 | |||
| 965 | Ga0265319_1041912 | |||
| 966 | Ga0265334_10010211 | |||
| 967 | Ga0265318_10011249 | |||
| 968 | Ga0265318_10086411 | |||
| 969 | Ga0265322_10041106 | |||
| 970 | Ga0265336_10004674 | |||
| 971 | Ga0265336_10056872 | |||
| 972 | Ga0265338_10002640 | |||
| 973 | Ga0265338_10037515 | |||
| 974 | Ga0265338_10060242 | |||
| 975 | Ga0265338_10073490 | |||
| 976 | Ga0265330_10026100 | |||
| 977 | Ga0265320_10069751 | |||
| 978 | Ga0265325_10051342 | |||
| 979 | Ga0265339_10009789 | |||
| 980 | Ga0265331_10031125 | |||
| 981 | Ga0265327_10038167 | |||
| 982 | Ga0265316_10012502 | |||
| 983 | Ga0265316_10036185 | |||
| 984 | Ga0265313_10064272 | |||
| 985 | Ga0265314_10003898 | |||
| 986 | Ga0265314_10005113 | |||
| 987 | Ga0265342_10041510 | |||
| 988 | Ga0373936_0033382 | |||
| 989 | Ga0373953_0089746 | |||
| 990 | Ga0373953_0148727 | |||
| 991 | Ga0373956_0117283 | |||
| 992 | Ga0373943_0000490 | |||
| 993 | Ga0373943_0194389 | |||
| 994 | Ga0373955_0084471 | |||
| 995 | Ga0373955_0427496 | |||
| 996 | Ga0373931_0009837 | |||
| 997 | Ga0373935_0059089 | |||
| 998 | Ga0373947_0035113 | |||
| 999 | Ga0373947_0256445 | |||
| 1000 | Ga0373937_0004545 | |||
| 1001 | Ga0373937_0147840 | |||
| 1002 | Ga0373925_0000484 | |||
| 1003 | Ga0395899_0012131 | |||
| 1004 | Ga0395899_0056755 | |||
| 1005 | Ga0395899_0087714 | |||
| 1006 | Ga0395899_0103933 | |||
| 1007 | Ga0395899_0105147 | |||
| 1008 | Ga0395899_0149303 | |||
| 1009 | Ga0395899_0238540 | |||
| 1010 | Ga0395900_0002321 | |||
| 1011 | Ga0395900_0002916 | |||
| 1012 | Ga0395900_0003619 | |||
| 1013 | Ga0395900_0137735 | |||
| 1014 | Ga0395900_0150342 | |||
| 1015 | Ga0395900_0169751 | |||
| 1016 | Ga0395900_0204366 | |||
| 1017 | Ga0395900_0260444 | |||
| 1018 | Ga0395900_0260579 | |||
| 1019 | Ga0395900_0261714 | |||
| 1020 | Ga0395898_0002298 | |||
| 1021 | Ga0395898_0003164 | |||
| 1022 | Ga0395898_0006898 | |||
| 1023 | Ga0395898_0037081 | |||
| 1024 | Ga0395898_0106487 | |||
| 1025 | Ga0395898_0192750 | |||
| 1026 | Ga0395898_0778386 | |||
| 1027 | Ga0395905_0002318 | |||
| 1028 | Ga0395905_0015483 | |||
| 1029 | Ga0395905_0026294 | |||
| 1030 | Ga0395905_0041514 | |||
| 1031 | Ga0395905_0049684 | |||
| 1032 | Ga0395905_0115417 | |||
| 1033 | Ga0395905_0312810 | |||
| 1034 | Ga0395901_0002740 | |||
| 1035 | Ga0395901_0011266 | |||
| 1036 | Ga0395901_0016521 | |||
| 1037 | Ga0395901_0107152 | |||
| 1038 | Ga0395901_0209905 | |||
| 1039 | Ga0395901_0422364 | |||
| 1040 | Ga0395901_0528114 | |||
| 1041 | Ga0436360_1319192 | |||
| 1042 | Ga0436363_0202199 | |||
| 1043 | Ga0439448_0074522 | |||
| 1044 | Ga0466969_0003575 | |||
| 1045 | Ga0466969_0256040 | |||
| 1046 | Ga0466972_0165792 | |||
| 1047 | Ga0466965_0040136 | |||
| 1048 | Ga0466965_0095202 | |||
| 1049 | Ga0466965_0171381 | |||
| 1050 | Ga0466965_0275917 | |||
| 1051 | Ga0466965_0298955 | |||
| 1052 | Ga0466966_0091251 | |||
| 1053 | Ga0466966_0094498 | |||
| 1054 | Ga0466966_0251605 | |||
| 1055 | Ga0466961_0030878 | |||
| 1056 | Ga0466961_0031890 | |||
| 1057 | Ga0466961_0140237 | |||
| 1058 | Ga0466961_0293958 | |||
| 1059 | Ga0466963_0000045 | |||
| 1060 | Ga0466963_0003646 | |||
| 1061 | Ga0466963_0004146 | |||
| 1062 | Ga0466963_0009901 | |||
| 1063 | Ga0466963_0012551 | |||
| 1064 | Ga0466963_0014228 | |||
| 1065 | Ga0466963_0016132 | |||
| 1066 | Ga0466963_0018947 | |||
| 1067 | Ga0466963_0020970 | |||
| 1068 | Ga0466963_0030955 | |||
| 1069 | Ga0466963_0041100 | |||
| 1070 | Ga0466963_0041256 | |||
| 1071 | Ga0466963_0049029 | |||
| 1072 | Ga0466963_0061986 | |||
| 1073 | Ga0466963_0105118 | |||
| 1074 | Ga0466963_0161782 | |||
| 1075 | Ga0466963_0171282 | |||
| 1076 | Ga0466964_0001416 | |||
| 1077 | Ga0466964_0008196 | |||
| 1078 | Ga0466964_0013935 | |||
| 1079 | Ga0466964_0046142 | |||
| 1080 | Ga0466964_0048583 | |||
| 1081 | Ga0466964_0050379 | |||
| 1082 | Ga0466964_0076329 | |||
| 1083 | Ga0466964_0107719 | |||
| 1084 | Ga0466964_0118728 | |||
| 1085 | Ga0466964_0173587 | |||
| 1086 | Ga0466971_0006706 | |||
| 1087 | Ga0466971_0011496 | |||
| 1088 | Ga0466971_0060709 | |||
| 1089 | Ga0466971_0099050 | |||
| 1090 | Ga0466968_0002077 | |||
| 1091 | Ga0466968_0010305 | |||
| 1092 | Ga0466968_0031220 | |||
| 1093 | Ga0466968_0032792 | |||
| 1094 | Ga0466968_0064419 | |||
| 1095 | Ga0466968_0071650 | |||
| 1096 | Ga0466970_0006100 | |||
| 1097 | Ga0466970_0235434 | |||
| 1098 | Ga0466957_0005678 | |||
| 1099 | Ga0466957_0014566 | |||
| 1100 | Ga0466957_0025455 | |||
| 1101 | Ga0466957_0026522 | |||
| 1102 | Ga0466957_0027011 | |||
| 1103 | Ga0466957_0044817 | |||
| 1104 | Ga0466957_0054493 | |||
| 1105 | Ga0466957_0070755 | |||
| 1106 | Ga0466957_0173978 | |||
| 1107 | Ga0466960_0026774 | |||
| 1108 | Ga0466960_0031792 | |||
| 1109 | Ga0466960_0073020 | |||
| 1110 | Ga0466959_0012212 | |||
| 1111 | Ga0466959_0099750 | |||
| 1112 | Ga0466959_0158951 | |||
| 1113 | Ga0466959_0253474 | |||
| 1114 | Ga0466958_0009124 | |||
| 1115 | Ga0466958_0014839 | |||
| 1116 | Ga0466958_0023936 | |||
| 1117 | Ga0466958_0034413 | |||
| 1118 | Ga0466958_0039493 | |||
| 1119 | Ga0466958_0051119 | |||
| 1120 | Ga0466958_0060470 | |||
| 1121 | Ga0466958_0063391 | |||
| 1122 | Ga0466958_0467548 | |||
| 1123 | Ga0466967_0003258 | |||
| 1124 | Ga0466967_0005055 | |||
| 1125 | Ga0466967_0015184 | |||
| 1126 | Ga0466967_0016056 | |||
| 1127 | Ga0466967_0018134 | |||
| 1128 | Ga0466967_0018492 | |||
| 1129 | Ga0466967_0035993 | |||
| 1130 | Ga0466967_0038444 | |||
| 1131 | Ga0466967_0060071 | |||
| 1132 | Ga0466967_0061106 | |||
| 1133 | Ga0466967_0092894 | |||
| 1134 | Ga0466967_0141382 | |||
| 1135 | Ga0466967_0142166 | |||
| 1136 | Ga0466967_0192812 | |||
| 1137 | Ga0466967_0197569 | |||
| 1138 | Ga0466967_0208146 | |||
| 1139 | Ga0466967_0269609 | |||
| 1140 | Ga0466967_0290406 | |||
| 1141 | Ga0466967_0318078 | |||
| 1142 | Ga0466967_0327404 | |||
| 1143 | Ga0466967_0486495 | |||
| 1144 | Ga0466967_0547028 | |||
| 1145 | Ga0495592_0001695 | |||
| 1146 | Ga0495592_0006827 | |||
| 1147 | Ga0495592_0385954 | |||
| 1148 | Ga0495603_0016017 | |||
| 1149 | Ga0495629_0020654 | |||
| 1150 | Ga0495629_0353598 | |||
| 1151 | Ga0495641_0002472 | |||
| 1152 | Ga0495641_0042017 | |||
| 1153 | Ga0495641_0113016 | |||
| 1154 | Ga0495641_0184537 | |||
| 1155 | Ga0495651_0000080 | |||
| 1156 | Ga0495651_0037755 | |||
| 1157 | Ga0495651_0135922 | |||
| 1158 | Ga0495653_0015405 | |||
| 1159 | Ga0495653_0017190 | |||
| 1160 | Ga0495653_0102317 | |||
| 1161 | Ga0495653_0189099 | |||
| 1162 | Ga0495580_0054014 | |||
| 1163 | Ga0495639_0000425 | |||
| 1164 | Ga0495639_0071989 | |||
| 1165 | Ga0495662_0025715 | |||
| 1166 | Ga0495664_0047307 | |||
| 1167 | Ga0495664_0069419 | |||
| 1168 | Ga0495664_0169529 | |||
| 1169 | Ga0495584_0020264 | |||
| 1170 | Ga0495607_0015325 | |||
| 1171 | Ga0495608_0010759 | |||
| 1172 | Ga0495608_0017659 | |||
| 1173 | Ga0495608_0201301 | |||
| 1174 | Ga0495608_0209526 | |||
| 1175 | Ga0495618_0001505 | |||
| 1176 | Ga0495618_0010140 | |||
| 1177 | Ga0495618_0097555 | |||
| 1178 | Ga0495618_0210933 | |||
| 1179 | Ga0495628_0001647 | |||
| 1180 | Ga0495628_0203641 | |||
| 1181 | Ga0495630_0001297 | |||
| 1182 | Ga0495630_0041680 | |||
| 1183 | Ga0495630_0120541 | |||
| 1184 | Ga0495630_0249998 | |||
| 1185 | Ga0495630_0261197 | |||
| 1186 | Ga0495630_0273017 | |||
| 1187 | Ga0495630_0450288 | |||
| 1188 | Ga0495630_0554395 | |||
| 1189 | Ga0495631_0062080 | |||
| 1190 | Ga0495644_0022590 | |||
| 1191 | Ga0495663_0049160 | |||
| 1192 | Ga0495666_0000168 | |||
| 1193 | Ga0495642_0061697 | |||
| 1194 | Ga0495652_0001035 | |||
| 1195 | Ga0495652_0035030 | |||
| 1196 | Ga0495652_0063512 | |||
| 1197 | Ga0495652_0191224 | |||
| 1198 | Ga0495665_0000038 | |||
| 1199 | Ga0495640_0096781 | |||
| 1200 | Ga0495640_0106859 | |||
| 1201 | Ga0495640_0156117 | |||
| 1202 | Ga0495640_0247398 | |||
| 1203 | Ga0495586_0008220 | |||
| 1204 | Ga0495586_0058486 | |||
| 1205 | Ga0495586_0216561 | |||
| 1206 | Ga0495587_0000270 | |||
| 1207 | Ga0495587_0045904 | |||
| 1208 | Ga0495609_0016594 | |||
| 1209 | Ga0495645_0000038 | |||
| 1210 | Ga0495645_0132990 | |||
| 1211 | Ga0495667_0008106 | |||
| 1212 | Ga0495667_0024980 | |||
| 1213 | Ga0495667_0064203 | |||
| 1214 | Ga0495667_0069725 | |||
| 1215 | Ga0495667_0077952 | |||
| 1216 | Ga0495656_0000407 | |||
| 1217 | Ga0495634_0069163 | |||
| 1218 | Ga0495635_0038952 | |||
| 1219 | Ga0495657_0004533 | |||
| 1220 | Ga0495657_0015410 | |||
| 1221 | Ga0495657_0042630 | |||
| 1222 | Ga0495657_0073972 | |||
| 1223 | Ga0495657_0190927 | |||
| 1224 | Ga0495599_0000142 | |||
| 1225 | Ga0495599_0216966 | |||
| 1226 | Ga0495599_0299452 | |||
| 1227 | Ga0495623_0000210 | |||
| 1228 | Ga0495646_0007272 | |||
| 1229 | Ga0495646_0079883 | |||
| 1230 | Ga0495647_0000336 | |||
| 1231 | Ga0495658_0002124 | |||
| 1232 | Ga0495658_0033284 | |||
| 1233 | Ga0495658_0133579 | |||
| 1234 | Ga0495613_0025860 | |||
| 1235 | Ga0495613_0034301 | |||
| 1236 | Ga0495613_0062828 | |||
| 1237 | Ga0495613_0086515 | |||
| 1238 | Ga0495613_0098438 | |||
| 1239 | Ga0495613_0159516 | |||
| 1240 | Ga0495613_0237981 | |||
| 1241 | Ga0495624_0010430 | |||
| 1242 | Ga0495624_0045021 | |||
| 1243 | Ga0495600_0015375 | |||
| 1244 | Ga0495600_0066532 | |||
| 1245 | Ga0495581_0002990 | |||
| 1246 | Ga0495604_0000043 | |||
| 1247 | Ga0495604_0041956 | |||
| 1248 | Ga0495604_0079602 | |||
| 1249 | Ga0495674_0014382 | |||
| 1250 | Ga0495674_0306353 | |||
| 1251 | Ga0495676_0088596 | |||
| 1252 | Ga0495676_0143998 | |||
| 1253 | Ga0495676_0184388 | |||
| 1254 | Ga0495676_0188060 | |||
| 1255 | Ga0495680_0009003 | |||
| 1256 | Ga0495680_0068139 | |||
| 1257 | Ga0495680_0140499 | |||
| 1258 | Ga0495675_0000896 | |||
| 1259 | Ga0495684_0001595 | |||
| 1260 | Ga0495684_0113754 | |||
| 1261 | Ga0495684_0113755 | |||
| 1262 | Ga0495684_0138366 | |||
| 1263 | Ga0495593_0001683 | |||
| 1264 | Ga0495593_0133032 | |||
| 1265 | Ga0495602_0005605 | |||
| 1266 | Ga0495602_0112003 | |||
| 1267 | Ga0495602_0228603 | |||
| 1268 | Ga0495614_0002709 | |||
| 1269 | Ga0496100_0013693 | |||
| 1270 | Ga0496100_0066208 | |||
| 1271 | Ga0496100_0102582 | |||
| 1272 | Ga0496100_0188274 | |||
| 1273 | Ga0496101_0021807 | |||
| 1274 | Ga0496101_0129757 | |||
| 1275 | Ga0496101_0152398 | |||
| 1276 | Ga0496101_0383058 | |||
| 1277 | Ga0496102_0011192 | |||
| 1278 | Ga0496102_0076523 | |||
| 1279 | Ga0496102_0092691 | |||
| 1280 | Ga0496102_0370344 | |||
| 1281 | Ga0496103_0024156 | |||
| 1282 | Ga0496103_0025806 | |||
| 1283 | Ga0496103_0040478 | |||
| 1284 | Ga0496103_0086245 | |||
| 1285 | Ga0496103_0283164 | |||
| 1286 | Ga0496104_0009980 | |||
| 1287 | Ga0496104_0019112 | |||
| 1288 | Ga0496104_0034586 | |||
| 1289 | Ga0496104_0069894 | |||
| 1290 | Ga0496104_0109377 | |||
| 1291 | Ga0496104_0111557 | |||
| 1292 | Ga0496104_0180437 | |||
| 1293 | Ga0496104_0226030 | |||
| 1294 | Ga0496104_0354312 | |||
| 1295 | Ga0496104_0740786 | |||
| 1296 | Ga0496105_0007204 | |||
| 1297 | Ga0496105_0017997 | |||
| 1298 | Ga0496105_0056852 | |||
| 1299 | Ga0496105_0062355 | |||
| 1300 | Ga0496105_0608573 | |||
| 1301 | Ga0496106_0015136 | |||
| 1302 | Ga0496106_0097026 | |||
| 1303 | Ga0496106_0219321 | |||
| 1304 | Ga0496106_0262946 | |||
| 1305 | Ga0496107_0016813 | |||
| 1306 | Ga0496107_0054443 | |||
| 1307 | Ga0496107_0152585 | |||
| 1308 | Ga0496107_0361469 | |||
| 1309 | Ga0496108_0010693 | |||
| 1310 | Ga0496108_0016216 | |||
| 1311 | Ga0496108_0034634 | |||
| 1312 | Ga0496108_0064623 | |||
| 1313 | Ga0496108_0204505 | |||
| 1314 | Ga0496108_0289322 | |||
| 1315 | Ga0496108_0617785 | |||
| 1316 | Ga0496108_0791767 | |||
| 1317 | Ga0496109_0000576 | |||
| 1318 | Ga0496109_0010076 | |||
| 1319 | Ga0496109_0020405 | |||
| 1320 | Ga0496109_0023460 | |||
| 1321 | Ga0496109_0101708 | |||
| 1322 | Ga0496109_0109156 | |||
| 1323 | Ga0496109_0142268 | |||
| 1324 | Ga0496109_0335967 | |||
| 1325 | Ga0496110_0186539 | |||
| 1326 | Ga0496110_0519282 | |||
| 1327 | Ga0496110_0552438 | |||
| 1328 | Ga0496110_0795915 | |||
| 1329 | Ga0496111_0011531 | |||
| 1330 | Ga0496111_0016158 | |||
| 1331 | Ga0496111_0078916 | |||
| 1332 | Ga0496112_0000273 | |||
| 1333 | Ga0496112_0027531 | |||
| 1334 | Ga0496112_0033709 | |||
| 1335 | Ga0496112_0045238 | |||
| 1336 | Ga0496112_0048303 | |||
| 1337 | Ga0496112_0064830 | |||
| 1338 | Ga0496112_0077785 | |||
| 1339 | Ga0496112_0100608 | |||
| 1340 | Ga0496112_0129921 | |||
| 1341 | Ga0496112_0215046 | |||
| 1342 | Ga0496112_0917843 | |||
| 1343 | Ga0496113_0019490 | |||
| 1344 | Ga0496113_0021814 | |||
| 1345 | Ga0496113_0157833 | |||
| 1346 | Ga0496114_0018397 | |||
| 1347 | Ga0496114_0021259 | |||
| 1348 | Ga0496114_0085697 | |||
| 1349 | Ga0496114_0164191 | |||
| 1350 | Ga0496114_0177143 | |||
| 1351 | Ga0496114_0243797 | |||
| 1352 | Ga0496114_0341652 | |||
| 1353 | Ga0496115_0005207 | |||
| 1354 | Ga0496115_0044332 | |||
| 1355 | Ga0496115_0097518 | |||
| 1356 | Ga0496115_0130353 | |||
| 1357 | Ga0496115_0176729 | |||
| 1358 | Ga0501047_0010057 | |||
| 1359 | Ga0501047_0297164 | |||
| 1360 | Ga0501067_0001219 | |||
| 1361 | Ga0501067_0026964 | |||
| 1362 | Ga0501067_0050684 | |||
| 1363 | Ga0501067_0129492 | |||
| 1364 | Ga0501069_0007861 | |||
| 1365 | Ga0501069_0102046 | |||
| 1366 | Ga0501069_0104267 | |||
| 1367 | Ga0501069_0210255 | |||
| 1368 | Ga0501070_0000120 | |||
| 1369 | Ga0501070_0296425 | |||
| 1370 | Ga0501070_0473968 | |||
| 1371 | Ga0501073_0259495 | |||
| 1372 | nmdc:mga05p37_10748_c1 | |||
| 1373 | nmdc:mga05p37_147138_c1 | |||
| 1374 | nmdc:mga06r32_75182_c1 | |||
| 1375 | nmdc:mga0n895_25875_c1 | |||
| 1376 | nmdc:mga0n895_40422_c1 | |||
| 1377 | nmdc:mga0rr50_78807_c1 | |||
| 1378 | nmdc:mga08x19_36535_c1 | |||
| 1379 | nmdc:mga0a205_63929_c1 | |||
| 1380 | Ga0495601_0000462 | |||
| 1381 | Ga0495601_0007102 | |||
| 1382 | Ga0495601_0029007 | |||
| 1383 | Ga0495601_0045478 | |||
| 1384 | Ga0495601_0065477 | |||
| 1385 | Ga0495601_0148406 | |||
| 1386 | Ga0495612_0015817 | |||
| 1387 | Ga0495612_0134724 | |||
| 1388 | Ga0495595_0010031 | |||
| 1389 | Ga0495595_0013773 | |||
| 1390 | Ga0495595_0048268 | |||
| 1391 | Ga0495619_0000930 | |||
| 1392 | Ga0495619_0007777 | |||
| 1393 | Ga0495619_0115937 | |||
| 1394 | Ga0495619_0180324 | |||
| 1395 | Ga0495619_0197603 | |||
| 1396 | Ga0500566_0122819 | |||
| 1397 | Ga0466962_0003377 | |||
| 1398 | Ga0466962_0009040 | |||
| 1399 | Ga0466962_0015185 | |||
| 1400 | Ga0530510_0069148 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6ebu-assembly1.cif.gz_A | crystal structure of aquifex aeolicus lpxe | 0.8111 | 76 | 237 |
| 7f18-assembly3.cif.gz_C | crystal structure of a mutant of acid phosphatase from pseudomonas aeruginosa (q57h/w58p/d135r) | 0.7768 | 109 | 240 |
| 2ipb-assembly2.cif.gz_D | crystal structure of t159d mutant of s. typhimurium phon protein | 0.7129 | 108 | 237 |
| 6ebu-assembly1.cif.gz_A | crystal structure of aquifex aeolicus lpxe | 0.7115 | 76 | 237 |
| 4usz-assembly1.cif.gz_A | crystal structure of the first bacterial vanadium dependant iodoperoxidase | 0.6498 | 64 | 237 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0R4J2K6_172_243_1.20.144.10 | Mainly Alpha;Up-down Bundle;Vanadium-containing Chloroperoxidase; domain 1;Phosphatidic acid phosphatase type 2/haloperoxidase | 0.8785 | 169 | 232 | 1.20.144.10 |
| af_I1N2R0_172_243_1.20.144.10 | Mainly Alpha;Up-down Bundle;Vanadium-containing Chloroperoxidase; domain 1;Phosphatidic acid phosphatase type 2/haloperoxidase | 0.876 | 169 | 232 | 1.20.144.10 |
| af_A0A0R4J2K6_172_243_1.20.144.10 | Mainly Alpha;Up-down Bundle;Vanadium-containing Chloroperoxidase; domain 1;Phosphatidic acid phosphatase type 2/haloperoxidase | 0.7819 | 169 | 232 | 1.20.144.10 |
| af_I1N2R0_172_243_1.20.144.10 | Mainly Alpha;Up-down Bundle;Vanadium-containing Chloroperoxidase; domain 1;Phosphatidic acid phosphatase type 2/haloperoxidase | 0.7799 | 169 | 232 | 1.20.144.10 |
| af_A0A1D8PEJ5_1_514_1.20.144.10 | Mainly Alpha;Up-down Bundle;Vanadium-containing Chloroperoxidase; domain 1;Phosphatidic acid phosphatase type 2/haloperoxidase | 0.7642 | 66 | 237 | 1.20.144.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V9GTD5-F1-model_v4 | Phosphatase PAP2 family protein | 0.9526 | 8 | 237 |
GO:0016020
|
| AF-A0A1M3BKD4-F1-model_v4 | Inositolphosphotransferase Aur1/Ipt1 domain-containing protein | 0.9482 | 27 | 234 |
GO:0016020
|
| AF-A0A7K0P9Y1-F1-model_v4 | Phosphatase PAP2 family protein | 0.947 | 9 | 234 |
GO:0016020
|
| AF-A0A538AKW2-F1-model_v4 | Inositol phosphorylceramide synthase | 0.9445 | 6 | 245 |
GO:0016020
|
| AF-A0A7V9PQF1-F1-model_v4 | Phosphatase PAP2 family protein | 0.941 | 1 | 226 |
GO:0016020
|