F476079

General Info

Members Datasets Scaffolds Average Seq Length
700 399 1401 343

Family's Representative Sequence

Representative Sequence 3300005459|Ga0068867_100030691|Ga0068867_1000306912
Length 391
Sequence MTYRNLSHDAVGRTHAGRCNRTVILGPHNPGMTTRRGNKVRNNNNRSRLHALAALLAGGLLVAVSAQAMDITGAGATFPYPIYAKWAEAYRAKTGVGLNYQSIGSGGGIKQIQNKTVDFGASDMPMKPEELDKDGLLQFPTVIGGDVPVMNLEGVGAGQLKLTGPMLADIYLGKIIKWNDAAITKLNPTLKMPDSEITVVHRSDGSGTTFIWVNYLSKVSPEWKEKVGEGTSVAWPAGVGGKGNEGVASYVQRVKGSIGYVEYAYALQNKMIYAQMQNRDGAFVSPSADTFKAAAASADWSKAPGYYLVLTDQPGRNSWPISGATFILMYKSQAKPETAKEVLKFFDWAYSPEGDKLAGALDYVPLPDAVTNQIRTTWKAQIKDASGKPVF

Samples

Sample ID Description Type Environment
1 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
4 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
5 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
6 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
7 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
8 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
11 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
12 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
13 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
14 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
15 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
16 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
17 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
18 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
19 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
20 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
24 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
25 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
26 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
27 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
28 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
32 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
41 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
42 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
43 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
44 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
45 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
46 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
49 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
50 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
51 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
52 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
53 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
54 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
55 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
56 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
57 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
58 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
59 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
60 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
61 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
62 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
65 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
66 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
67 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
68 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
69 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
70 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
71 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
72 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
73 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
74 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
77 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
78 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
86 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
98 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
99 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
100 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
111 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
112 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
113 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
114 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
116 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
118 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
119 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
120 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
121 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
122 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
123 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
124 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
125 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
126 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
127 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
129 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
130 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
190 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
191 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
192 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
193 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
194 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
195 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
196 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
197 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
198 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
199 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
200 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
201 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
202 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
203 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
204 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
205 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
206 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
209 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
210 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
211 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
212 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
213 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
214 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
215 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
216 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
217 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
218 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
219 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
220 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
221 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
222 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
223 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
224 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
225 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
226 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
227 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
228 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
229 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
230 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
231 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
232 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
233 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
234 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
235 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
236 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
237 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
238 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
239 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
240 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
241 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
242 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
243 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
244 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
245 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
246 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
247 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
248 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
249 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
250 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
251 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
252 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
253 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
254 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
255 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
256 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
257 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
258 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
259 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
260 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
261 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
262 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
263 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
264 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
265 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
266 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
267 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
268 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
269 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
270 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
271 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
272 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
273 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
274 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
275 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
276 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
277 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
278 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
279 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
280 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
281 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
282 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
283 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
284 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
285 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
286 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
287 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
288 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
289 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
291 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
293 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
295 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
296 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
299 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
300 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
301 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
302 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
303 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
304 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
305 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
306 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
307 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
308 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
309 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
310 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
311 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
312 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
313 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
314 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
315 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
316 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
317 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
318 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
319 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
320 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
321 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
322 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
323 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
324 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
325 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
326 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
327 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
328 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
329 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
330 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
331 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
332 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
333 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
334 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
335 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
336 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
337 2519899620 Rhizobium sp. Pop5 Isolate Nodule
338 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
339 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
340 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
341 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
342 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
343 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
344 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
345 2643221559 Lysobacter sp. Root559 Isolate Unclassified
346 2643221586 Lysobacter sp. Root667 Isolate Unclassified
347 2643221612 Lysobacter sp. Root76 Isolate Unclassified
348 2643221640 Caulobacter sp. Root342 Isolate Unclassified
349 2643221642 Caulobacter sp. Root343 Isolate Unclassified
350 2643221720 Lysobacter sp. Root916 Isolate Unclassified
351 2643221727 Lysobacter sp. Root96 Isolate Unclassified
352 2643221728 Lysobacter sp. Root983 Isolate Unclassified
353 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
354 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
355 2791355266 Rhizobium sp. L43 Isolate Nodule
356 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
357 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
358 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
359 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
360 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
361 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
362 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
363 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
364 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
365 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
366 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
367 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
368 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
369 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
370 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
371 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
372 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
373 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
374 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
375 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
376 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
377 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
378 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
379 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
380 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
381 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
382 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
383 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
384 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
385 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
386 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
387 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
388 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
389 2936381700 Rhizobium chutanense C16 Isolate Unclassified
390 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
391 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
392 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
393 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
394 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
395 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
396 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
397 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
398 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
399 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 88.86
Metatranscriptomes 0.71
Isolates 10.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.29
Nodule 5.29
Rhizoplane 3.71
Rhizosphere 69.57
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068867_100030691 3300005459 Bacteria 3877
2 MRS1b_contig_7245341 2162886011 Bacteria 1454
3 JGI25158J39367_1000145 3300002739 Bacteria 16591
4 JGI25152J39213_1000438 3300002773 Bacteria 24994
5 JGI25152J39213_1006418 3300002773 Bacteria 3217
6 JGI25150J39212_1000033 3300002774 Bacteria 96269
7 JGI25150J39212_1002203 3300002774 Bacteria 4974
8 JGI25150J39212_1006317 3300002774 Bacteria 2455
9 JGI25159J45721_1002375 3300002987 Bacteria 7177
10 JGI25151J46595_10000108 3300003187 Bacteria 112874
11 JGI25151J46595_10001983 3300003187 Bacteria 12854
12 JGI25153J46596_10000714 3300003215 Bacteria 20303
13 JGI25153J46596_10001212 3300003215 Bacteria 15607
14 rootH1_10084383 3300003316 Bacteria 1368
15 rootH1_10084383 3300003323 Bacteria 2182
16 JGI25160J50197_1005880 3300003354 Bacteria 5043
17 JGI25161J50226_1000051 3300003374 Bacteria 110051
18 Ga0055532_1000017 3300003758 Bacteria 306880
19 Ga0055526_1001596 3300003771 Bacteria 15900
20 Ga0055526_1025488 3300003771 Bacteria 1896
21 Ga0055526_1025700 3300003771 Bacteria 1881
22 Ga0055524_1008220 3300003775 Bacteria 4354
23 Ga0055528_1000784 3300003790 Bacteria 22118
24 Ga0055528_1002033 3300003790 Bacteria 11342
25 Ga0055540_1011398 3300003792 Bacteria 2870
26 Ga0055540_1012650 3300003792 Bacteria 2635
27 Ga0055531_10013713 3300003794 Bacteria 3715
28 Ga0055543_1000453 3300004625 Bacteria 24658
29 Ga0065165_1011305 3300005262 Bacteria 3745
30 Ga0065715_10217445 3300005293 Bacteria 1286
31 Ga0070658_10001026 3300005327 Bacteria 23890
32 Ga0070658_10311537 3300005327 Bacteria 1343
33 Ga0070683_100007802 3300005329 Bacteria 9061
34 Ga0070683_100019630 3300005329 Bacteria 6004
35 Ga0070690_100013345 3300005330 Bacteria 4851
36 Ga0070670_100014042 3300005331 Bacteria 6869
37 Ga0070670_100025288 3300005331 Bacteria 5109
38 Ga0068869_100012532 3300005334 Bacteria 5607
39 Ga0070666_10006653 3300005335 Bacteria 7107
40 Ga0070666_10040545 3300005335 Bacteria 3107
41 Ga0070680_100006041 3300005336 Bacteria 9180
42 Ga0070680_100041099 3300005336 Bacteria 3748
43 Ga0070680_100055284 3300005336 Bacteria 3243
44 Ga0070682_100074038 3300005337 Bacteria 2186
45 Ga0070682_100079538 3300005337 Bacteria 2117
46 Ga0070682_100135327 3300005337 Bacteria 1673
47 Ga0068868_100001733 3300005338 Bacteria 14946
48 Ga0070660_100001820 3300005339 Bacteria 14641
49 Ga0070660_100020030 3300005339 Bacteria 4910
50 Ga0070660_100039320 3300005339 Bacteria 3595
51 Ga0070660_100145737 3300005339 Bacteria 1902
52 Ga0070689_100007113 3300005340 Bacteria 7795
53 Ga0070661_100000353 3300005344 Bacteria 36189
54 Ga0070661_100005138 3300005344 Bacteria 9013
55 Ga0070661_100062841 3300005344 Bacteria 2726
56 Ga0070661_100133117 3300005344 Bacteria 1869
57 Ga0070668_100120912 3300005347 Bacteria 2093
58 Ga0070668_100199078 3300005347 Bacteria 1644
59 Ga0070669_100198628 3300005353 Bacteria 1577
60 Ga0070671_100001538 3300005355 Bacteria 17332
61 Ga0070671_100004291 3300005355 Bacteria 11282
62 Ga0070671_100016435 3300005355 Bacteria 5984
63 Ga0070671_100329756 3300005355 Bacteria 1301
64 Ga0070673_100030294 3300005364 Bacteria 4046
65 Ga0070673_100101415 3300005364 Bacteria 2371
66 Ga0070688_100004577 3300005365 Bacteria 7213
67 Ga0070659_100117551 3300005366 Bacteria 2150
68 Ga0070667_100015498 3300005367 Bacteria 6301
69 Ga0070667_100020494 3300005367 Bacteria 5489
70 Ga0070709_10000286 3300005434 Bacteria 32137
71 Ga0070709_10040330 3300005434 Bacteria 2870
72 Ga0070714_100036167 3300005435 Bacteria 4141
73 Ga0070714_100104189 3300005435 Bacteria 2503
74 Ga0070713_100000532 3300005436 Bacteria 24168
75 Ga0070713_100009535 3300005436 Bacteria 6958
76 Ga0070713_100172478 3300005436 Bacteria 1938
77 Ga0070701_10004453 3300005438 Bacteria 5679
78 Ga0070711_100002284 3300005439 Bacteria 10871
79 Ga0070711_100009701 3300005439 Bacteria 5931
80 Ga0070711_100087130 3300005439 Bacteria 2241
81 Ga0070711_100131436 3300005439 Bacteria 1865
82 Ga0070705_100029431 3300005440 Bacteria 3020
83 Ga0070708_100175078 3300005445 Bacteria 2004
84 Ga0070663_100008354 3300005455 Bacteria 6361
85 Ga0070663_100310601 3300005455 Bacteria 1265
86 Ga0070662_100000758 3300005457 Bacteria 19818
87 Ga0070681_10044276 3300005458 Bacteria 4454
88 Ga0070681_10045883 3300005458 Bacteria 4370
89 Ga0070681_10179358 3300005458 Bacteria 2039
90 Ga0070685_10000757 3300005466 Bacteria 17554
91 Ga0070706_100040058 3300005467 Bacteria 4325
92 Ga0070706_100053220 3300005467 Bacteria 3736
93 Ga0070707_100083865 3300005468 Bacteria 3079
94 Ga0070698_100320050 3300005471 Bacteria 1482
95 Ga0070699_100062462 3300005518 Bacteria 3228
96 Ga0070699_100151978 3300005518 Bacteria 2048
97 Ga0070699_100196050 3300005518 Bacteria 1795
98 Ga0070679_100003332 3300005530 Bacteria 14708
99 Ga0070679_100013071 3300005530 Bacteria 7949
100 Ga0070679_100116316 3300005530 Bacteria 2659
101 Ga0070684_100039001 3300005535 Bacteria 4084
102 Ga0070697_100030816 3300005536 Bacteria 4310
103 Ga0068853_100051203 3300005539 Bacteria 3554
104 Ga0068853_100250929 3300005539 Bacteria 1623
105 Ga0070686_100099498 3300005544 Bacteria 1962
106 Ga0070695_100035338 3300005545 Bacteria 3139
107 Ga0070696_100026026 3300005546 Bacteria 3980
108 Ga0070665_100163579 3300005548 Bacteria 2227
109 Ga0070665_100205777 3300005548 Bacteria 1969
110 Ga0068855_100002883 3300005563 Bacteria 21060
111 Ga0068855_100019906 3300005563 Bacteria 8059
112 Ga0068855_100026654 3300005563 Bacteria 6915
113 Ga0068855_100053543 3300005563 Bacteria 4747
114 Ga0070664_100003194 3300005564 Bacteria 13243
115 Ga0070664_100022842 3300005564 Bacteria 5160
116 Ga0070664_100132561 3300005564 Bacteria 2189
117 Ga0070664_100182888 3300005564 Bacteria 1864
118 Ga0068857_100001548 3300005577 Bacteria 18416
119 Ga0068857_100016484 3300005577 Bacteria 6474
120 Ga0068854_100064040 3300005578 Bacteria 2670
121 Ga0068856_100040485 3300005614 Bacteria 4578
122 Ga0068856_100090128 3300005614 Bacteria 3050
123 Ga0068852_100058719 3300005616 Bacteria 3334
124 Ga0068852_100079157 3300005616 Bacteria 2911
125 Ga0068852_100158953 3300005616 Bacteria 2108
126 Ga0068852_100193442 3300005616 Bacteria 1921
127 Ga0068859_100023589 3300005617 Bacteria 6174
128 Ga0068859_100029951 3300005617 Bacteria 5460
129 Ga0068859_100063021 3300005617 Bacteria 3738
130 Ga0068864_100004290 3300005618 Bacteria 11722
131 Ga0068864_100029560 3300005618 Bacteria 4642
132 Ga0068866_10001951 3300005718 Bacteria 8595
133 Ga0068851_10137289 3300005834 Bacteria 1327
134 Ga0068863_100011317 3300005841 Bacteria 8641
135 Ga0068863_100015435 3300005841 Bacteria 7342
136 Ga0068863_100275499 3300005841 Bacteria 1629
137 Ga0068858_100003266 3300005842 Bacteria 16159
138 Ga0068858_100382496 3300005842 Bacteria 1351
139 Ga0068860_100010778 3300005843 Bacteria 9022
140 Ga0068860_100022143 3300005843 Bacteria 6152
141 Ga0068860_100210126 3300005843 Bacteria 1888
142 Ga0070716_100019296 3300006173 Bacteria 3561
143 Ga0070716_100043780 3300006173 Bacteria 2505
144 Ga0070712_100000779 3300006175 Bacteria 18831
145 Ga0070712_100004028 3300006175 Bacteria 9017
146 Ga0075369_10002694 3300006186 Bacteria 6369
147 Ga0068871_100045785 3300006358 Bacteria 3522
148 Ga0068871_100046443 3300006358 Bacteria 3498
149 Ga0068871_100127726 3300006358 Bacteria 2153
150 Ga0068871_100195898 3300006358 Bacteria 1742
151 Ga0075433_10016404 3300006852 Bacteria 6104
152 Ga0075434_100073527 3300006871 Bacteria 3411
153 Ga0068865_100019608 3300006881 Bacteria 4378
154 Ga0097620_100023589 3300006931 Bacteria 6174
155 Ga0097620_100029951 3300006931 Bacteria 5460
156 Ga0097620_100063023 3300006931 Bacteria 3738
157 Ga0075435_100007900 3300007076 Bacteria 7612
158 Ga0105251_10062880 3300009011 Bacteria 1742
159 Ga0105244_10004338 3300009036 Bacteria 9790
160 Ga0105240_10004920 3300009093 Bacteria 20087
161 Ga0105240_10017953 3300009093 Bacteria 9516
162 Ga0105240_10027607 3300009093 Bacteria 7430
163 Ga0105240_10033737 3300009093 Bacteria 6609
164 Ga0105240_10066535 3300009093 Bacteria 4469
165 Ga0105245_10019608 3300009098 Bacteria 5925
166 Ga0105245_10190928 3300009098 Bacteria 1962
167 Ga0105245_10207845 3300009098 Bacteria 1883
168 Ga0105245_10233579 3300009098 Bacteria 1780
169 Ga0105247_10067858 3300009101 Bacteria 2223
170 Ga0105241_10026765 3300009174 Bacteria 4293
171 Ga0105241_10052044 3300009174 Bacteria 3125
172 Ga0105248_10035742 3300009177 Bacteria 5558
173 Ga0105248_10097407 3300009177 Bacteria 3314
174 Ga0105248_10242023 3300009177 Bacteria 2031
175 Ga0105237_10015674 3300009545 Bacteria 7879
176 Ga0105237_10015848 3300009545 Bacteria 7838
177 Ga0105237_10475266 3300009545 Bacteria 1256
178 Ga0105238_10004286 3300009551 Bacteria 14157
179 Ga0105238_10019471 3300009551 Bacteria 6912
180 Ga0105238_10061705 3300009551 Bacteria 3751
181 Ga0105238_10397001 3300009551 Bacteria 1372
182 Ga0105238_10436614 3300009551 Bacteria 1305
183 Ga0105249_10060842 3300009553 Bacteria 3465
184 Ga0105239_10001652 3300010375 Bacteria 29393
185 Ga0105239_10011986 3300010375 Bacteria 9667
186 Ga0105239_10018900 3300010375 Bacteria 7613
187 Ga0105239_10152096 3300010375 Bacteria 2583
188 Ga0105246_10000004 3300011119 Bacteria 86087
189 Ga0105246_10089192 3300011119 Bacteria 2218
190 Ga0105246_10161316 3300011119 Bacteria 1708
191 Ga0105246_10233268 3300011119 Bacteria 1450
192 Ga0157373_10030197 3300013100 Bacteria 3899
193 Ga0157373_10036415 3300013100 Bacteria 3532
194 Ga0157373_10088344 3300013100 Bacteria 2183
195 Ga0157371_10007912 3300013102 Bacteria 8532
196 Ga0157370_10007506 3300013104 Bacteria 11849
197 Ga0157370_10020459 3300013104 Bacteria 6610
198 Ga0157370_10124931 3300013104 Bacteria 2402
199 Ga0157369_10000057 3300013105 Bacteria 157096
200 Ga0157369_10017018 3300013105 Bacteria 8170
201 Ga0157369_10115754 3300013105 Bacteria 2847
202 Ga0157374_10004613 3300013296 Bacteria 11559
203 Ga0157374_10117670 3300013296 Bacteria 2562
204 Ga0157378_10004539 3300013297 Bacteria 12182
205 Ga0157378_10015193 3300013297 Bacteria 6742
206 Ga0163162_10008312 3300013306 Bacteria 10126
207 Ga0163162_10067130 3300013306 Bacteria 3636
208 Ga0157372_10006594 3300013307 Bacteria 12355
209 Ga0157372_10153791 3300013307 Bacteria 2656
210 Ga0157375_10064726 3300013308 Bacteria 3642
211 Ga0157375_10100695 3300013308 Bacteria 2971
212 Ga0157375_10104765 3300013308 Bacteria 2918
213 Ga0157375_10166745 3300013308 Bacteria 2347
214 Ga0157375_10439082 3300013308 Bacteria 1471
215 Ga0163163_10000024 3300014325 Bacteria 185100
216 Ga0163163_10002992 3300014325 Bacteria 14295
217 Ga0163163_10004778 3300014325 Bacteria 11625
218 Ga0163163_10035016 3300014325 Bacteria 4868
219 Ga0163163_10289908 3300014325 Bacteria 1689
220 Ga0182008_10010381 3300014497 Bacteria 4985
221 Ga0182008_10030640 3300014497 Bacteria 2711
222 Ga0157379_10004174 3300014968 Bacteria 12337
223 Ga0157379_10008775 3300014968 Bacteria 8816
224 Ga0157376_10010376 3300014969 Bacteria 6810
225 Ga0182006_1010762 3300015261 Bacteria 4051
226 Ga0213872_10002244 3300021361 Bacteria 11550
227 Ga0209435_100015 3300025206 Bacteria 321177
228 Ga0209436_100032 3300025208 Bacteria 80755
229 Ga0209147_100004 3300025229 Bacteria 1371850
230 Ga0209437_100268 3300025233 Bacteria 79327
231 Ga0209258_100298 3300025242 Bacteria 81047
232 Ga0207425_1000031 3300025245 Bacteria 261181
233 Ga0207425_1020613 3300025245 Bacteria 1407
234 Ga0209646_1000040 3300025246 Bacteria 347867
235 Ga0209646_1000105 3300025246 Bacteria 163453
236 Ga0209026_1000034 3300025250 Bacteria 306953
237 Ga0209026_1001107 3300025250 Bacteria 12814
238 Ga0209759_1000234 3300025256 Bacteria 83099
239 Ga0209759_1000569 3300025256 Bacteria 37040
240 Ga0209129_1000053 3300025258 Bacteria 262823
241 Ga0209129_1000137 3300025258 Bacteria 123213
242 Ga0209129_1000680 3300025258 Bacteria 22439
243 Ga0209129_1001823 3300025258 Bacteria 11298
244 Ga0209129_1001829 3300025258 Bacteria 11271
245 Ga0209673_1000041 3300025273 Bacteria 307397
246 Ga0209673_1007509 3300025273 Bacteria 5005
247 Ga0209673_1017790 3300025273 Bacteria 2609
248 Ga0209130_1000006 3300025284 Bacteria 596528
249 Ga0209025_1000087 3300025294 Bacteria 261181
250 Ga0209025_1001237 3300025294 Bacteria 35478
251 Ga0209025_1003719 3300025294 Bacteria 14011
252 Ga0209564_1000591 3300025295 Bacteria 57183
253 Ga0209564_1007176 3300025295 Bacteria 5808
254 Ga0209564_1018799 3300025295 Bacteria 2613
255 Ga0209758_1000081 3300025297 Bacteria 261181
256 Ga0209758_1000190 3300025297 Bacteria 137882
257 Ga0209758_1000435 3300025297 Bacteria 70539
258 Ga0209758_1003508 3300025297 Bacteria 14162
259 Ga0209758_1004470 3300025297 Bacteria 11617
260 Ga0209050_1014301 3300025298 Bacteria 3431
261 Ga0209256_1000404 3300025299 Bacteria 68364
262 Ga0209256_1002262 3300025299 Bacteria 16321
263 Ga0209256_1009863 3300025299 Bacteria 4107
264 Ga0207426_1000231 3300025302 Bacteria 128171
265 Ga0209051_1018754 3300025303 Bacteria 3048
266 Ga0209257_1000180 3300025304 Bacteria 158090
267 Ga0207656_10026055 3300025321 Bacteria 2380
268 Ga0207655_1014265 3300025728 Bacteria 4502
269 Ga0207713_1048096 3300025735 Bacteria 1720
270 Ga0207682_10020977 3300025893 Bacteria 2569
271 Ga0207680_10008491 3300025903 Bacteria 5045
272 Ga0207647_10046478 3300025904 Bacteria 2705
273 Ga0207699_10000121 3300025906 Bacteria 55187
274 Ga0207705_10005402 3300025909 Bacteria 9557
275 Ga0207705_10169376 3300025909 Bacteria 1644
276 Ga0207654_10066520 3300025911 Bacteria 2126
277 Ga0207654_10140038 3300025911 Bacteria 1542
278 Ga0207707_10005386 3300025912 Bacteria 11190
279 Ga0207707_10152222 3300025912 Bacteria 2022
280 Ga0207707_10199390 3300025912 Bacteria 1745
281 Ga0207695_10000256 3300025913 Bacteria 135850
282 Ga0207695_10004109 3300025913 Bacteria 20007
283 Ga0207695_10006006 3300025913 Bacteria 15874
284 Ga0207695_10021003 3300025913 Bacteria 7458
285 Ga0207695_10236154 3300025913 Bacteria 1731
286 Ga0207671_10001767 3300025914 Bacteria 24286
287 Ga0207671_10005441 3300025914 Bacteria 11721
288 Ga0207671_10144233 3300025914 Bacteria 1836
289 Ga0207671_10197452 3300025914 Bacteria 1570
290 Ga0207693_10003531 3300025915 Bacteria 13352
291 Ga0207693_10004338 3300025915 Bacteria 11998
292 Ga0207663_10007555 3300025916 Bacteria 5642
293 Ga0207663_10041084 3300025916 Bacteria 2816
294 Ga0207660_10005946 3300025917 Bacteria 7919
295 Ga0207660_10047903 3300025917 Bacteria 3024
296 Ga0207662_10113542 3300025918 Bacteria 1691
297 Ga0207657_10000048 3300025919 Bacteria 111458
298 Ga0207657_10089664 3300025919 Bacteria 2568
299 Ga0207657_10098714 3300025919 Bacteria 2426
300 Ga0207657_10228518 3300025919 Bacteria 1489
301 Ga0207649_10000586 3300025920 Bacteria 24818
302 Ga0207649_10010851 3300025920 Bacteria 5008
303 Ga0207649_10024688 3300025920 Bacteria 3497
304 Ga0207652_10001709 3300025921 Bacteria 19167
305 Ga0207652_10014257 3300025921 Bacteria 6437
306 Ga0207652_10189987 3300025921 Bacteria 1847
307 Ga0207646_10009033 3300025922 Bacteria 9905
308 Ga0207681_10253375 3300025923 Bacteria 1375
309 Ga0207694_10001224 3300025924 Bacteria 22235
310 Ga0207694_10010512 3300025924 Bacteria 6982
311 Ga0207694_10130299 3300025924 Bacteria 2015
312 Ga0207650_10055791 3300025925 Bacteria 2934
313 Ga0207650_10105515 3300025925 Bacteria 2175
314 Ga0207650_10172892 3300025925 Bacteria 1718
315 Ga0207687_10001346 3300025927 Bacteria 16808
316 Ga0207687_10076390 3300025927 Bacteria 2406
317 Ga0207687_10227525 3300025927 Bacteria 1472
318 Ga0207700_10000077 3300025928 Bacteria 60197
319 Ga0207700_10033026 3300025928 Bacteria 3699
320 Ga0207664_10073788 3300025929 Bacteria 2754
321 Ga0207644_10001185 3300025931 Bacteria 16763
322 Ga0207644_10045843 3300025931 Bacteria 3111
323 Ga0207644_10109998 3300025931 Bacteria 2082
324 Ga0207644_10158523 3300025931 Bacteria 1757
325 Ga0207644_10162663 3300025931 Bacteria 1736
326 Ga0207690_10001757 3300025932 Bacteria 13310
327 Ga0207690_10265121 3300025932 Bacteria 1332
328 Ga0207706_10000381 3300025933 Bacteria 48362
329 Ga0207706_10002930 3300025933 Bacteria 16489
330 Ga0207706_10023578 3300025933 Bacteria 5525
331 Ga0207706_10057126 3300025933 Bacteria 3439
332 Ga0207706_10182449 3300025933 Bacteria 1843
333 Ga0207686_10001096 3300025934 Bacteria 15845
334 Ga0207670_10003185 3300025936 Bacteria 8692
335 Ga0207670_10094770 3300025936 Bacteria 2119
336 Ga0207669_10169472 3300025937 Bacteria 1552
337 Ga0207704_10017552 3300025938 Bacteria 3714
338 Ga0207665_10059504 3300025939 Bacteria 2585
339 Ga0207691_10028415 3300025940 Bacteria 5237
340 Ga0207691_10110723 3300025940 Bacteria 2442
341 Ga0207691_10116116 3300025940 Bacteria 2376
342 Ga0207711_10000688 3300025941 Bacteria 33317
343 Ga0207711_10020849 3300025941 Bacteria 5470
344 Ga0207711_10103347 3300025941 Bacteria 2523
345 Ga0207689_10049031 3300025942 Bacteria 3484
346 Ga0207661_10008041 3300025944 Bacteria 7517
347 Ga0207679_10103367 3300025945 Bacteria 2233
348 Ga0207679_10157528 3300025945 Bacteria 1856
349 Ga0207667_10009743 3300025949 Bacteria 11297
350 Ga0207667_10016556 3300025949 Bacteria 8327
351 Ga0207667_10025763 3300025949 Bacteria 6434
352 Ga0207667_10184046 3300025949 Bacteria 2145
353 Ga0207651_10001025 3300025960 Bacteria 12337
354 Ga0207651_10035565 3300025960 Bacteria 3241
355 Ga0207651_10258206 3300025960 Bacteria 1429
356 Ga0207712_10062606 3300025961 Bacteria 2645
357 Ga0207668_10011909 3300025972 Bacteria 5305
358 Ga0207668_10027481 3300025972 Bacteria 3706
359 Ga0207668_10045771 3300025972 Bacteria 2986
360 Ga0207668_10133360 3300025972 Bacteria 1900
361 Ga0207668_10353902 3300025972 Bacteria 1229
362 Ga0207640_10009097 3300025981 Bacteria 5547
363 Ga0207658_10038282 3300025986 Bacteria 3453
364 Ga0207677_10000775 3300026023 Bacteria 18357
365 Ga0207703_10000792 3300026035 Bacteria 31130
366 Ga0207639_10005299 3300026041 Bacteria 8705
367 Ga0207639_10039947 3300026041 Bacteria 3499
368 Ga0207639_10170002 3300026041 Bacteria 1845
369 Ga0207678_10016650 3300026067 Bacteria 6458
370 Ga0207678_10065522 3300026067 Bacteria 3120
371 Ga0207702_10038972 3300026078 Bacteria 3981
372 Ga0207702_10078726 3300026078 Bacteria 2855
373 Ga0207702_10104187 3300026078 Bacteria 2510
374 Ga0207641_10002392 3300026088 Bacteria 17307
375 Ga0207641_10008263 3300026088 Bacteria 8601
376 Ga0207641_10281443 3300026088 Bacteria 1564
377 Ga0207648_10018657 3300026089 Bacteria 6278
378 Ga0207648_10029368 3300026089 Bacteria 4876
379 Ga0207676_10001352 3300026095 Bacteria 18224
380 Ga0207676_10005507 3300026095 Bacteria 8959
381 Ga0207676_10054105 3300026095 Bacteria 3144
382 Ga0207674_10000289 3300026116 Bacteria 63604
383 Ga0207674_10004526 3300026116 Bacteria 16694
384 Ga0207674_10075718 3300026116 Bacteria 3375
385 Ga0207698_10142171 3300026142 Bacteria 2069
386 Ga0207698_10213076 3300026142 Bacteria 1739
387 Ga0207698_10319319 3300026142 Bacteria 1454
388 Ga0207698_10396319 3300026142 Bacteria 1318
389 Ga0268266_10145618 3300028379 Bacteria 2130
390 Ga0268266_10324034 3300028379 Bacteria 1443
391 Ga0268264_10023735 3300028381 Bacteria 5002
392 Ga0307515_10000022 3300028794 Bacteria 404064
393 Ga0307515_10024531 3300028794 Bacteria 10504
394 Ga0307515_10045745 3300028794 Bacteria 6713
395 Ga0307515_10050848 3300028794 Bacteria 6196
396 Ga0307515_10097037 3300028794 Bacteria 3607
397 Ga0265760_10035149 3300031090 Bacteria 1483
398 Ga0265760_10046064 3300031090 Bacteria 1307
399 Ga0265330_10015313 3300031235 Bacteria 3549
400 Ga0265328_10012419 3300031239 Bacteria 3389
401 Ga0265340_10037676 3300031247 Bacteria 2395
402 Ga0265339_10013708 3300031249 Bacteria 4907
403 Ga0265331_10001838 3300031250 Bacteria 15031
404 Ga0265331_10002884 3300031250 Bacteria 11362
405 Ga0265331_10011471 3300031250 Bacteria 4850
406 Ga0265327_10000429 3300031251 Bacteria 76072
407 Ga0265327_10000472 3300031251 Bacteria 71196
408 Ga0265327_10009185 3300031251 Bacteria 7179
409 Ga0265327_10041224 3300031251 Bacteria 2490
410 Ga0265316_10090295 3300031344 Bacteria 2337
411 Ga0316575_10000043 3300031665 Bacteria 31191
412 Ga0316579_10082352 3300031691 Bacteria 1533
413 Ga0265314_10000270 3300031711 Bacteria 76077
414 Ga0265342_10042408 3300031712 Bacteria 2749
415 Ga0307516_10003783 3300031730 Bacteria 19218
416 Ga0307412_10000516 3300031911 Bacteria 23055
417 Ga0307412_10052450 3300031911 Bacteria 2701
418 Ga0316583_10022334 3300032133 Bacteria 2265
419 Ga0307507_10181828 3300033179 Bacteria 1501
420 Ga0316588_1028355 3300033528 Bacteria 1305
421 Ga0316596_1018343 3300033541 Bacteria 1767
422 Ga0373926_0020037 3300035083 Bacteria 2309
423 Ga0373934_0019260 3300035086 Bacteria 2619
424 Ga0373945_0058575 3300035116 Bacteria 1433
425 Ga0373956_0022114 3300035119 Bacteria 2718
426 Ga0373924_0004509 3300035410 Bacteria 4872
427 Ga0373935_0056404 3300035692 Bacteria 2504
428 Ga0373935_0125339 3300035692 Bacteria 1720
429 Ga0373927_0000001 3300035695 Bacteria 1082160
430 Ga0373927_0005725 3300035695 Bacteria 8535
431 Ga0373927_0017082 3300035695 Bacteria 4781
432 Ga0373927_0060831 3300035695 Bacteria 2444
433 Ga0373927_0211754 3300035695 Bacteria 1273
434 Ga0373933_0001236 3300035724 Bacteria 15103
435 Ga0373933_0080713 3300035724 Bacteria 1994
436 Ga0373947_0030785 3300035725 Bacteria 3155
437 Ga0373947_0038257 3300035725 Bacteria 2849
438 Ga0373947_0072979 3300035725 Bacteria 2108
439 Ga0373937_0016104 3300036401 Bacteria 6633
440 Ga0373937_0084989 3300036401 Bacteria 2928
441 Ga0373937_0138426 3300036401 Bacteria 2277
442 Ga0373937_0148058 3300036401 Bacteria 2198
443 Ga0316582_0013390 3300036647 Bacteria 4614
444 Ga0316582_0038264 3300036647 Bacteria 2980
445 Ga0316582_0081926 3300036647 Bacteria 2109
446 Ga0316582_0125811 3300036647 Bacteria 1718
447 Ga0316584_0048230 3300036712 Bacteria 3182
448 Ga0373925_0034010 3300037068 Bacteria 3756
449 Ga0395899_0009887 3300037312 Bacteria 7314
450 Ga0395905_0002393 3300037471 Bacteria 20873
451 Ga0395905_0004830 3300037471 Bacteria 13896
452 Ga0395905_0036766 3300037471 Bacteria 4600
453 Ga0395905_0049781 3300037471 Bacteria 3927
454 Ga0395905_0060046 3300037471 Bacteria 3555
455 Ga0395901_0015630 3300038443 Bacteria 7731
456 Ga0395901_0018705 3300038443 Bacteria 7076
457 Ga0395901_0394778 3300038443 Bacteria 1422
458 Ga0436360_0164336 3300039438 Bacteria 3621
459 Ga0436361_0150902 3300039447 Bacteria 16204
460 Ga0436361_0852798 3300039447 Bacteria 16018
461 Ga0436363_0782832 3300039450 Bacteria 12964
462 Ga0451793_0868686 3300041452 Bacteria 1209
463 Ga0451841_1318915 3300041498 Bacteria 3833
464 Ga0451845_0030167 3300041501 Bacteria 2665
465 Ga0451847_0296227 3300041503 Bacteria 3769
466 Ga0451851_0179346 3300041507 Bacteria 3791
467 Ga0451851_0729863 3300041507 Bacteria 6142
468 Ga0453684_0006935 3300044712 Bacteria 21226
469 Ga0453684_0376728 3300044712 Bacteria 1594
470 Ga0495590_0000245 3300046457 Bacteria 29532
471 Ga0495638_0000345 3300046460 Bacteria 58430
472 Ga0495638_0000439 3300046460 Bacteria 50194
473 Ga0495650_0020033 3300046471 Bacteria 3273
474 Ga0495580_0049010 3300046472 Bacteria 2989
475 Ga0495639_0050104 3300046475 Bacteria 1896
476 Ga0495664_0002226 3300046477 Bacteria 10380
477 Ga0495607_0024053 3300046501 Bacteria 3803
478 Ga0495583_0003535 3300046506 Bacteria 11809
479 Ga0495610_0010387 3300046512 Bacteria 5792
480 Ga0495616_0000898 3300046513 Bacteria 21477
481 Ga0495616_0095405 3300046513 Bacteria 1402
482 Ga0495628_0110088 3300046516 Bacteria 2119
483 Ga0495631_0001167 3300046518 Bacteria 16242
484 Ga0495637_0008350 3300046520 Bacteria 5091
485 Ga0495643_0000922 3300046522 Bacteria 30713
486 Ga0495643_0045329 3300046522 Bacteria 2387
487 Ga0495665_0132047 3300046531 Bacteria 1307
488 Ga0495587_0103354 3300046536 Bacteria 1640
489 Ga0495621_0000820 3300046539 Bacteria 7869
490 Ga0495597_0050956 3300046542 Bacteria 1826
491 Ga0495645_0005193 3300046543 Bacteria 8919
492 Ga0495645_0016705 3300046543 Bacteria 5249
493 Ga0495645_0091794 3300046543 Bacteria 2169
494 Ga0495667_0007877 3300046559 Bacteria 7221
495 Ga0495667_0027063 3300046559 Bacteria 3865
496 Ga0495668_0000124 3300046616 Bacteria 114685
497 Ga0495668_0013539 3300046616 Bacteria 4807
498 Ga0495668_0190120 3300046616 Bacteria 1124
499 Ga0495625_0005740 3300046660 Bacteria 11219
500 Ga0495625_0108264 3300046660 Bacteria 1901
501 Ga0495647_0002242 3300046681 Bacteria 6060
502 Ga0495647_0025416 3300046681 Bacteria 2164
503 Ga0495658_0005383 3300046683 Bacteria 6289
504 Ga0495658_0070166 3300046683 Bacteria 2032
505 Ga0495660_0077557 3300046810 Bacteria 1748
506 Ga0495674_0104946 3300047319 Bacteria 2402
507 Ga0495674_0222476 3300047319 Bacteria 1560
508 Ga0495672_0035555 3300047320 Bacteria 3068
509 Ga0495684_0272782 3300047471 Bacteria 1223
510 Ga0495686_0001232 3300047472 Bacteria 29230
511 Ga0495686_0044977 3300047472 Bacteria 2795
512 Ga0495593_0119034 3300047673 Bacteria 1345
513 Ga0495602_0008548 3300048088 Bacteria 10691
514 Ga0495602_0143520 3300048088 Bacteria 1887
515 Ga0495614_0131130 3300048089 Bacteria 1109
516 Ga0495626_0007803 3300048091 Bacteria 5928
517 Ga0496100_0230942 3300048903 Bacteria 1361
518 Ga0496102_0011230 3300048905 Bacteria 7717
519 Ga0496104_0000879 3300048907 Bacteria 25857
520 Ga0496104_0046653 3300048907 Bacteria 4081
521 Ga0496106_0000131 3300048909 Bacteria 56905
522 Ga0496106_0110513 3300048909 Bacteria 2140
523 Ga0496106_0177456 3300048909 Bacteria 1690
524 Ga0496107_0002758 3300048910 Bacteria 11562
525 Ga0496107_0029878 3300048910 Bacteria 3881
526 Ga0496107_0149579 3300048910 Bacteria 1727
527 Ga0496107_0171180 3300048910 Bacteria 1612
528 Ga0496108_0009683 3300048911 Bacteria 7808
529 Ga0496108_0144245 3300048911 Bacteria 2052
530 Ga0496109_0007124 3300048912 Bacteria 9443
531 Ga0496109_0010311 3300048912 Bacteria 7980
532 Ga0496109_0237880 3300048912 Bacteria 1713
533 Ga0496111_0014648 3300048914 Bacteria 5362
534 Ga0496112_0033791 3300048915 Bacteria 4973
535 Ga0496112_0063298 3300048915 Bacteria 3648
536 Ga0496112_0356732 3300048915 Bacteria 1404
537 Ga0496113_0010772 3300048916 Bacteria 6063
538 Ga0496113_0028855 3300048916 Bacteria 3996
539 Ga0496114_0006271 3300048917 Bacteria 9363
540 Ga0496115_0105052 3300048918 Bacteria 2318
541 Ga0496116_0004489 3300048919 Bacteria 13289
542 Ga0496116_0005269 3300048919 Bacteria 12068
543 Ga0496116_0007165 3300048919 Bacteria 9967
544 Ga0496116_0028490 3300048919 Bacteria 4045
545 Ga0496118_0010542 3300048921 Bacteria 9138
546 Ga0496118_0050677 3300048921 Bacteria 3183
547 Ga0496119_0124772 3300048922 Bacteria 1410
548 Ga0496121_0026943 3300048924 Bacteria 5395
549 Ga0496121_0096061 3300048924 Bacteria 2301
550 Ga0496121_0180396 3300048924 Bacteria 1524
551 Ga0496122_0006217 3300048925 Bacteria 13831
552 Ga0496122_0006783 3300048925 Bacteria 13005
553 Ga0496122_0008179 3300048925 Bacteria 11370
554 Ga0496122_0033283 3300048925 Bacteria 4243
555 Ga0496123_0008042 3300048926 Bacteria 9765
556 Ga0496123_0030092 3300048926 Bacteria 3980
557 Ga0496123_0032313 3300048926 Bacteria 3792
558 Ga0496124_0000032 3300048927 Bacteria 332524
559 Ga0496124_0005830 3300048927 Bacteria 13672
560 Ga0496124_0007449 3300048927 Bacteria 11624
561 Ga0496124_0062324 3300048927 Bacteria 3121
562 Ga0496125_0005882 3300048928 Bacteria 13457
563 Ga0496125_0006876 3300048928 Bacteria 12185
564 Ga0496125_0023043 3300048928 Bacteria 5762
565 Ga0496125_0059584 3300048928 Bacteria 3075
566 Ga0496125_0072195 3300048928 Bacteria 2691
567 Ga0496126_0012258 3300048929 Bacteria 8796
568 Ga0496126_0020034 3300048929 Bacteria 6569
569 Ga0501305_017047 3300049161 Bacteria 1041
570 Ga0495678_001117 3300049459 Bacteria 22317
571 Ga0501032_0053851 3300049569 Bacteria 2709
572 Ga0501032_0056552 3300049569 Bacteria 2637
573 Ga0501033_0035193 3300049570 Bacteria 3755
574 Ga0501033_0215741 3300049570 Bacteria 1367
575 Ga0501034_0163746 3300049571 Bacteria 2193
576 Ga0501034_0189912 3300049571 Bacteria 2017
577 Ga0501036_0085043 3300049572 Bacteria 2674
578 Ga0501036_0122441 3300049572 Bacteria 2197
579 Ga0501037_0024602 3300049573 Bacteria 4453
580 Ga0501037_0122307 3300049573 Bacteria 1870
581 Ga0501039_0036886 3300049575 Bacteria 3772
582 Ga0501043_0050346 3300049579 Bacteria 3274
583 Ga0501046_0104955 3300049580 Bacteria 2165
584 Ga0501047_0090951 3300049581 Bacteria 2929
585 Ga0501068_0117418 3300049584 Bacteria 1657
586 Ga0501070_0035345 3300049586 Bacteria 4176
587 Ga0501070_0164125 3300049586 Bacteria 1831
588 Ga0501073_0017700 3300049589 Bacteria 5159
589 Ga0501080_0085698 3300049742 Bacteria 2927
590 Ga0501080_0138132 3300049742 Bacteria 2254
591 Ga0501080_0241560 3300049742 Bacteria 1648
592 Ga0501083_0028050 3300049744 Bacteria 3881
593 Ga0501083_0075954 3300049744 Bacteria 2230
594 Ga0501035_0078983 3300049822 Bacteria 2906
595 Ga0501044_0040687 3300049823 Bacteria 4843
596 Ga0501044_0111992 3300049823 Bacteria 2736
597 Ga0501044_0233012 3300049823 Bacteria 1788
598 Ga0501044_0367566 3300049823 Bacteria 1355
599 nmdc:mga0yw44_801_c1 3300050492 Bacteria 11704
600 nmdc:mga0k408_92255_c1 3300050493 Bacteria 1780
601 nmdc:mga0n895_113738_c1 3300050512 Bacteria 2724
602 nmdc:mga0rr50_4564_c1 3300050513 Bacteria 8149
603 nmdc:mga08x19_131636_c1 3300050514 Bacteria 1683
604 nmdc:mga0a205_37434_c1 3300050515 Bacteria 4665
605 nmdc:mga0sz30_1832_c2 3300050516 Bacteria 6533
606 Ga0495601_0012837 3300053077 Bacteria 5028
607 Ga0495601_0018169 3300053077 Bacteria 4277
608 Ga0495601_0132635 3300053077 Bacteria 1623
609 Ga0495612_0000382 3300053078 Bacteria 17706
610 Ga0495619_0187988 3300053085 Bacteria 1430
611 Ga0500578_0000159 3300053086 Bacteria 79246
612 Ga0500644_0003289 3300053088 Bacteria 3995
613 Ga0500651_0109371 3300053093 Bacteria 1688
614 Ga0500641_0003812 3300053096 Bacteria 5329
615 Ga0500556_0104567 3300053104 Bacteria 1093
616 Ga0500594_0000108 3300053118 Bacteria 24161
617 Ga0500608_000017 3300053122 Bacteria 80228
618 Ga0500568_0000651 3300053139 Bacteria 25097
619 Ga0500568_0008859 3300053139 Bacteria 4818
620 Ga0500616_0001630 3300053153 Bacteria 20812
621 Ga0500616_0032607 3300053153 Bacteria 2847
622 Ga0500622_0001294 3300053156 Bacteria 20360
623 Ga0500622_0001649 3300053156 Bacteria 17443
624 Ga0500622_0012761 3300053156 Bacteria 4541
625 Ga0500622_0133400 3300053156 Bacteria 1191
626 Ga0500633_0002224 3300053160 Bacteria 3938
627 Ga0500645_011004 3300053730 Bacteria 2971
628 Ga0501082_0108508 3300060353 Bacteria 2402
629 2509387575 2509276021 Bacteria 7634384
630 2511197063 2510917030 Bacteria 7460662
631 2511250708 2511231003 Bacteria 5606035
632 2513632623 2513237093 Bacteria 7545552
633 2513709074 2513237103 Bacteria 7647401
634 2515637037 2515154113 Bacteria 7807172
635 2515644268 2515154114 Bacteria 7848616
636 2517040061 2516653077 Bacteria 7555578
637 2517094193 2517093000 Bacteria 7412387
638 2520375200 2519899620 Bacteria 6499161
639 2550696533 2548876994 Bacteria 4904866
640 2585148124 2582581279 Bacteria 4980720
641 2585221211 2582581298 Bacteria 7315509
642 2585549413 2585427529 Bacteria 7395659
643 2585847201 2585427594 Bacteria 6180594
644 2587916974 2585428106 Bacteria 5179711
645 2599329095 2599185155 Bacteria 5827168
646 2643818983 2643221559 Bacteria 4424915
647 2643941346 2643221586 Bacteria 4446529
648 2644080409 2643221612 Bacteria 4361984
649 2644223822 2643221640 Bacteria 5258820
650 2644236092 2643221642 Bacteria 5357871
651 2644662885 2643221720 Bacteria 4694283
652 2644697022 2643221727 Bacteria 4415595
653 2644698160 2643221728 Bacteria 4797149
654 2748015803 2747842501 Bacteria 5293829
655 2766063829 2765235942 Bacteria 7445910
656 2793359056 2791355266 Bacteria 7116587
657 2805933251 2802429606 Bacteria 6346811
658 2819591916 2818991445 Bacteria 4955017
659 2826582181 2826581358 Bacteria 5963467
660 2838046075 2838042994 Bacteria 6046894
661 2838681473 2838680041 Bacteria 6545511
662 2838694492 2838694306 Bacteria 6853137
663 2838707870 2838707686 Bacteria 6619912
664 2842080899 2842077413 Bacteria 6508645
665 2842115110 2842110456 Bacteria 7656360
666 2842121518 2842118031 Bacteria 7033875
667 2842221336 2842217011 Bacteria 7497767
668 2842237281 2842237096 Bacteria 6620661
669 2842294555 2842291075 Bacteria 7076806
670 2842343459 2842341865 Bacteria 7003929
671 2842365401 2842363717 Bacteria 6844742
672 2842371936 2842370503 Bacteria 7038661
673 2842380953 2842377471 Bacteria 7140707
674 2842388024 2842384541 Bacteria 7057858
675 2842816557 2842815866 Bacteria 5947510
676 2842850143 2842849001 Bacteria 5924277
677 2857521537 2857516855 Bacteria 7787325
678 2884813901 2884811622 Bacteria 5552861
679 2884813905 2884811622 Bacteria 5552861
680 2884840672 2884836552 Bacteria 5219991
681 2884855929 2884852848 Bacteria 5221161
682 2895512233 2895511927 Bacteria 6802080
683 2895522244 2895522137 Bacteria 3284416
684 2895527313 2895525241 Bacteria 3388457
685 2896157146 2896154374 Bacteria 5221518
686 2919103970 2919100787 Bacteria 7710546
687 2928534712 2928531327 Bacteria 5101314
688 2933591509 2933586486 Bacteria 7667493
689 2935895014 2935894831 Bacteria 6620579
690 2936371134 2936367885 Bacteria 7324495
691 2936384812 2936381700 Bacteria 7006523
692 3005412575 3005409236 Bacteria 7188837
693 3005446882 3005445848 Bacteria 6906074
694 3005713513 3005710791 Bacteria 7622528
695 639647560 639633055 Bacteria 7751309
696 8005376475 8005376324 Bacteria 6590079
697 8005559581 8005556819 Bacteria 6908598
698 8005570577 8005563573 Bacteria 7153261
699 8018169367 8018163183 Bacteria 7277977
700 8024481240 8024479707 Bacteria 6954785
701 8057876434 8057874678 Bacteria 7494653
702 Ga0068867_100030691
703 MRS1b_contig_7245341
704 JGI25158J39367_1000145
705 JGI25152J39213_1000438
706 JGI25152J39213_1006418
707 JGI25150J39212_1000033
708 JGI25150J39212_1002203
709 JGI25150J39212_1006317
710 JGI25159J45721_1002375
711 JGI25151J46595_10000108
712 JGI25151J46595_10001983
713 JGI25153J46596_10000714
714 JGI25153J46596_10001212
715 rootH1_10084383
716 JGI25160J50197_1005880
717 JGI25161J50226_1000051
718 Ga0055532_1000017
719 Ga0055526_1001596
720 Ga0055526_1025488
721 Ga0055526_1025700
722 Ga0055524_1008220
723 Ga0055528_1000784
724 Ga0055528_1002033
725 Ga0055540_1011398
726 Ga0055540_1012650
727 Ga0055531_10013713
728 Ga0055543_1000453
729 Ga0065165_1011305
730 Ga0065715_10217445
731 Ga0070658_10001026
732 Ga0070658_10311537
733 Ga0070683_100007802
734 Ga0070683_100019630
735 Ga0070690_100013345
736 Ga0070670_100014042
737 Ga0070670_100025288
738 Ga0068869_100012532
739 Ga0070666_10006653
740 Ga0070666_10040545
741 Ga0070680_100006041
742 Ga0070680_100041099
743 Ga0070680_100055284
744 Ga0070682_100074038
745 Ga0070682_100079538
746 Ga0070682_100135327
747 Ga0068868_100001733
748 Ga0070660_100001820
749 Ga0070660_100020030
750 Ga0070660_100039320
751 Ga0070660_100145737
752 Ga0070689_100007113
753 Ga0070661_100000353
754 Ga0070661_100005138
755 Ga0070661_100062841
756 Ga0070661_100133117
757 Ga0070668_100120912
758 Ga0070668_100199078
759 Ga0070669_100198628
760 Ga0070671_100001538
761 Ga0070671_100004291
762 Ga0070671_100016435
763 Ga0070671_100329756
764 Ga0070673_100030294
765 Ga0070673_100101415
766 Ga0070688_100004577
767 Ga0070659_100117551
768 Ga0070667_100015498
769 Ga0070667_100020494
770 Ga0070709_10000286
771 Ga0070709_10040330
772 Ga0070714_100036167
773 Ga0070714_100104189
774 Ga0070713_100000532
775 Ga0070713_100009535
776 Ga0070713_100172478
777 Ga0070701_10004453
778 Ga0070711_100002284
779 Ga0070711_100009701
780 Ga0070711_100087130
781 Ga0070711_100131436
782 Ga0070705_100029431
783 Ga0070708_100175078
784 Ga0070663_100008354
785 Ga0070663_100310601
786 Ga0070662_100000758
787 Ga0070681_10044276
788 Ga0070681_10045883
789 Ga0070681_10179358
790 Ga0070685_10000757
791 Ga0070706_100040058
792 Ga0070706_100053220
793 Ga0070707_100083865
794 Ga0070698_100320050
795 Ga0070699_100062462
796 Ga0070699_100151978
797 Ga0070699_100196050
798 Ga0070679_100003332
799 Ga0070679_100013071
800 Ga0070679_100116316
801 Ga0070684_100039001
802 Ga0070697_100030816
803 Ga0068853_100051203
804 Ga0068853_100250929
805 Ga0070686_100099498
806 Ga0070695_100035338
807 Ga0070696_100026026
808 Ga0070665_100163579
809 Ga0070665_100205777
810 Ga0068855_100002883
811 Ga0068855_100019906
812 Ga0068855_100026654
813 Ga0068855_100053543
814 Ga0070664_100003194
815 Ga0070664_100022842
816 Ga0070664_100132561
817 Ga0070664_100182888
818 Ga0068857_100001548
819 Ga0068857_100016484
820 Ga0068854_100064040
821 Ga0068856_100040485
822 Ga0068856_100090128
823 Ga0068852_100058719
824 Ga0068852_100079157
825 Ga0068852_100158953
826 Ga0068852_100193442
827 Ga0068859_100023589
828 Ga0068859_100029951
829 Ga0068859_100063021
830 Ga0068864_100004290
831 Ga0068864_100029560
832 Ga0068866_10001951
833 Ga0068851_10137289
834 Ga0068863_100011317
835 Ga0068863_100015435
836 Ga0068863_100275499
837 Ga0068858_100003266
838 Ga0068858_100382496
839 Ga0068860_100010778
840 Ga0068860_100022143
841 Ga0068860_100210126
842 Ga0070716_100019296
843 Ga0070716_100043780
844 Ga0070712_100000779
845 Ga0070712_100004028
846 Ga0075369_10002694
847 Ga0068871_100045785
848 Ga0068871_100046443
849 Ga0068871_100127726
850 Ga0068871_100195898
851 Ga0075433_10016404
852 Ga0075434_100073527
853 Ga0068865_100019608
854 Ga0097620_100023589
855 Ga0097620_100029951
856 Ga0097620_100063023
857 Ga0075435_100007900
858 Ga0105251_10062880
859 Ga0105244_10004338
860 Ga0105240_10004920
861 Ga0105240_10017953
862 Ga0105240_10027607
863 Ga0105240_10033737
864 Ga0105240_10066535
865 Ga0105245_10019608
866 Ga0105245_10190928
867 Ga0105245_10207845
868 Ga0105245_10233579
869 Ga0105247_10067858
870 Ga0105241_10026765
871 Ga0105241_10052044
872 Ga0105248_10035742
873 Ga0105248_10097407
874 Ga0105248_10242023
875 Ga0105237_10015674
876 Ga0105237_10015848
877 Ga0105237_10475266
878 Ga0105238_10004286
879 Ga0105238_10019471
880 Ga0105238_10061705
881 Ga0105238_10397001
882 Ga0105238_10436614
883 Ga0105249_10060842
884 Ga0105239_10001652
885 Ga0105239_10011986
886 Ga0105239_10018900
887 Ga0105239_10152096
888 Ga0105246_10000004
889 Ga0105246_10089192
890 Ga0105246_10161316
891 Ga0105246_10233268
892 Ga0157373_10030197
893 Ga0157373_10036415
894 Ga0157373_10088344
895 Ga0157371_10007912
896 Ga0157370_10007506
897 Ga0157370_10020459
898 Ga0157370_10124931
899 Ga0157369_10000057
900 Ga0157369_10017018
901 Ga0157369_10115754
902 Ga0157374_10004613
903 Ga0157374_10117670
904 Ga0157378_10004539
905 Ga0157378_10015193
906 Ga0163162_10008312
907 Ga0163162_10067130
908 Ga0157372_10006594
909 Ga0157372_10153791
910 Ga0157375_10064726
911 Ga0157375_10100695
912 Ga0157375_10104765
913 Ga0157375_10166745
914 Ga0157375_10439082
915 Ga0163163_10000024
916 Ga0163163_10002992
917 Ga0163163_10004778
918 Ga0163163_10035016
919 Ga0163163_10289908
920 Ga0182008_10010381
921 Ga0182008_10030640
922 Ga0157379_10004174
923 Ga0157379_10008775
924 Ga0157376_10010376
925 Ga0182006_1010762
926 Ga0213872_10002244
927 Ga0209435_100015
928 Ga0209436_100032
929 Ga0209147_100004
930 Ga0209437_100268
931 Ga0209258_100298
932 Ga0207425_1000031
933 Ga0207425_1020613
934 Ga0209646_1000040
935 Ga0209646_1000105
936 Ga0209026_1000034
937 Ga0209026_1001107
938 Ga0209759_1000234
939 Ga0209759_1000569
940 Ga0209129_1000053
941 Ga0209129_1000137
942 Ga0209129_1000680
943 Ga0209129_1001823
944 Ga0209129_1001829
945 Ga0209673_1000041
946 Ga0209673_1007509
947 Ga0209673_1017790
948 Ga0209130_1000006
949 Ga0209025_1000087
950 Ga0209025_1001237
951 Ga0209025_1003719
952 Ga0209564_1000591
953 Ga0209564_1007176
954 Ga0209564_1018799
955 Ga0209758_1000081
956 Ga0209758_1000190
957 Ga0209758_1000435
958 Ga0209758_1003508
959 Ga0209758_1004470
960 Ga0209050_1014301
961 Ga0209256_1000404
962 Ga0209256_1002262
963 Ga0209256_1009863
964 Ga0207426_1000231
965 Ga0209051_1018754
966 Ga0209257_1000180
967 Ga0207656_10026055
968 Ga0207655_1014265
969 Ga0207713_1048096
970 Ga0207682_10020977
971 Ga0207680_10008491
972 Ga0207647_10046478
973 Ga0207699_10000121
974 Ga0207705_10005402
975 Ga0207705_10169376
976 Ga0207654_10066520
977 Ga0207654_10140038
978 Ga0207707_10005386
979 Ga0207707_10152222
980 Ga0207707_10199390
981 Ga0207695_10000256
982 Ga0207695_10004109
983 Ga0207695_10006006
984 Ga0207695_10021003
985 Ga0207695_10236154
986 Ga0207671_10001767
987 Ga0207671_10005441
988 Ga0207671_10144233
989 Ga0207671_10197452
990 Ga0207693_10003531
991 Ga0207693_10004338
992 Ga0207663_10007555
993 Ga0207663_10041084
994 Ga0207660_10005946
995 Ga0207660_10047903
996 Ga0207662_10113542
997 Ga0207657_10000048
998 Ga0207657_10089664
999 Ga0207657_10098714
1000 Ga0207657_10228518
1001 Ga0207649_10000586
1002 Ga0207649_10010851
1003 Ga0207649_10024688
1004 Ga0207652_10001709
1005 Ga0207652_10014257
1006 Ga0207652_10189987
1007 Ga0207646_10009033
1008 Ga0207681_10253375
1009 Ga0207694_10001224
1010 Ga0207694_10010512
1011 Ga0207694_10130299
1012 Ga0207650_10055791
1013 Ga0207650_10105515
1014 Ga0207650_10172892
1015 Ga0207687_10001346
1016 Ga0207687_10076390
1017 Ga0207687_10227525
1018 Ga0207700_10000077
1019 Ga0207700_10033026
1020 Ga0207664_10073788
1021 Ga0207644_10001185
1022 Ga0207644_10045843
1023 Ga0207644_10109998
1024 Ga0207644_10158523
1025 Ga0207644_10162663
1026 Ga0207690_10001757
1027 Ga0207690_10265121
1028 Ga0207706_10000381
1029 Ga0207706_10002930
1030 Ga0207706_10023578
1031 Ga0207706_10057126
1032 Ga0207706_10182449
1033 Ga0207686_10001096
1034 Ga0207670_10003185
1035 Ga0207670_10094770
1036 Ga0207669_10169472
1037 Ga0207704_10017552
1038 Ga0207665_10059504
1039 Ga0207691_10028415
1040 Ga0207691_10110723
1041 Ga0207691_10116116
1042 Ga0207711_10000688
1043 Ga0207711_10020849
1044 Ga0207711_10103347
1045 Ga0207689_10049031
1046 Ga0207661_10008041
1047 Ga0207679_10103367
1048 Ga0207679_10157528
1049 Ga0207667_10009743
1050 Ga0207667_10016556
1051 Ga0207667_10025763
1052 Ga0207667_10184046
1053 Ga0207651_10001025
1054 Ga0207651_10035565
1055 Ga0207651_10258206
1056 Ga0207712_10062606
1057 Ga0207668_10011909
1058 Ga0207668_10027481
1059 Ga0207668_10045771
1060 Ga0207668_10133360
1061 Ga0207668_10353902
1062 Ga0207640_10009097
1063 Ga0207658_10038282
1064 Ga0207677_10000775
1065 Ga0207703_10000792
1066 Ga0207639_10005299
1067 Ga0207639_10039947
1068 Ga0207639_10170002
1069 Ga0207678_10016650
1070 Ga0207678_10065522
1071 Ga0207702_10038972
1072 Ga0207702_10078726
1073 Ga0207702_10104187
1074 Ga0207641_10002392
1075 Ga0207641_10008263
1076 Ga0207641_10281443
1077 Ga0207648_10018657
1078 Ga0207648_10029368
1079 Ga0207676_10001352
1080 Ga0207676_10005507
1081 Ga0207676_10054105
1082 Ga0207674_10000289
1083 Ga0207674_10004526
1084 Ga0207674_10075718
1085 Ga0207698_10142171
1086 Ga0207698_10213076
1087 Ga0207698_10319319
1088 Ga0207698_10396319
1089 Ga0268266_10145618
1090 Ga0268266_10324034
1091 Ga0268264_10023735
1092 Ga0307515_10000022
1093 Ga0307515_10024531
1094 Ga0307515_10045745
1095 Ga0307515_10050848
1096 Ga0307515_10097037
1097 Ga0265760_10035149
1098 Ga0265760_10046064
1099 Ga0265330_10015313
1100 Ga0265328_10012419
1101 Ga0265340_10037676
1102 Ga0265339_10013708
1103 Ga0265331_10001838
1104 Ga0265331_10002884
1105 Ga0265331_10011471
1106 Ga0265327_10000429
1107 Ga0265327_10000472
1108 Ga0265327_10009185
1109 Ga0265327_10041224
1110 Ga0265316_10090295
1111 Ga0316575_10000043
1112 Ga0316579_10082352
1113 Ga0265314_10000270
1114 Ga0265342_10042408
1115 Ga0307516_10003783
1116 Ga0307412_10000516
1117 Ga0307412_10052450
1118 Ga0316583_10022334
1119 Ga0307507_10181828
1120 Ga0316588_1028355
1121 Ga0316596_1018343
1122 Ga0373926_0020037
1123 Ga0373934_0019260
1124 Ga0373945_0058575
1125 Ga0373956_0022114
1126 Ga0373924_0004509
1127 Ga0373935_0056404
1128 Ga0373935_0125339
1129 Ga0373927_0000001
1130 Ga0373927_0005725
1131 Ga0373927_0017082
1132 Ga0373927_0060831
1133 Ga0373927_0211754
1134 Ga0373933_0001236
1135 Ga0373933_0080713
1136 Ga0373947_0030785
1137 Ga0373947_0038257
1138 Ga0373947_0072979
1139 Ga0373937_0016104
1140 Ga0373937_0084989
1141 Ga0373937_0138426
1142 Ga0373937_0148058
1143 Ga0316582_0013390
1144 Ga0316582_0038264
1145 Ga0316582_0081926
1146 Ga0316582_0125811
1147 Ga0316584_0048230
1148 Ga0373925_0034010
1149 Ga0395899_0009887
1150 Ga0395905_0002393
1151 Ga0395905_0004830
1152 Ga0395905_0036766
1153 Ga0395905_0049781
1154 Ga0395905_0060046
1155 Ga0395901_0015630
1156 Ga0395901_0018705
1157 Ga0395901_0394778
1158 Ga0436360_0164336
1159 Ga0436361_0150902
1160 Ga0436361_0852798
1161 Ga0436363_0782832
1162 Ga0451793_0868686
1163 Ga0451841_1318915
1164 Ga0451845_0030167
1165 Ga0451847_0296227
1166 Ga0451851_0179346
1167 Ga0451851_0729863
1168 Ga0453684_0006935
1169 Ga0453684_0376728
1170 Ga0495590_0000245
1171 Ga0495638_0000345
1172 Ga0495638_0000439
1173 Ga0495650_0020033
1174 Ga0495580_0049010
1175 Ga0495639_0050104
1176 Ga0495664_0002226
1177 Ga0495607_0024053
1178 Ga0495583_0003535
1179 Ga0495610_0010387
1180 Ga0495616_0000898
1181 Ga0495616_0095405
1182 Ga0495628_0110088
1183 Ga0495631_0001167
1184 Ga0495637_0008350
1185 Ga0495643_0000922
1186 Ga0495643_0045329
1187 Ga0495665_0132047
1188 Ga0495587_0103354
1189 Ga0495621_0000820
1190 Ga0495597_0050956
1191 Ga0495645_0005193
1192 Ga0495645_0016705
1193 Ga0495645_0091794
1194 Ga0495667_0007877
1195 Ga0495667_0027063
1196 Ga0495668_0000124
1197 Ga0495668_0013539
1198 Ga0495668_0190120
1199 Ga0495625_0005740
1200 Ga0495625_0108264
1201 Ga0495647_0002242
1202 Ga0495647_0025416
1203 Ga0495658_0005383
1204 Ga0495658_0070166
1205 Ga0495660_0077557
1206 Ga0495674_0104946
1207 Ga0495674_0222476
1208 Ga0495672_0035555
1209 Ga0495684_0272782
1210 Ga0495686_0001232
1211 Ga0495686_0044977
1212 Ga0495593_0119034
1213 Ga0495602_0008548
1214 Ga0495602_0143520
1215 Ga0495614_0131130
1216 Ga0495626_0007803
1217 Ga0496100_0230942
1218 Ga0496102_0011230
1219 Ga0496104_0000879
1220 Ga0496104_0046653
1221 Ga0496106_0000131
1222 Ga0496106_0110513
1223 Ga0496106_0177456
1224 Ga0496107_0002758
1225 Ga0496107_0029878
1226 Ga0496107_0149579
1227 Ga0496107_0171180
1228 Ga0496108_0009683
1229 Ga0496108_0144245
1230 Ga0496109_0007124
1231 Ga0496109_0010311
1232 Ga0496109_0237880
1233 Ga0496111_0014648
1234 Ga0496112_0033791
1235 Ga0496112_0063298
1236 Ga0496112_0356732
1237 Ga0496113_0010772
1238 Ga0496113_0028855
1239 Ga0496114_0006271
1240 Ga0496115_0105052
1241 Ga0496116_0004489
1242 Ga0496116_0005269
1243 Ga0496116_0007165
1244 Ga0496116_0028490
1245 Ga0496118_0010542
1246 Ga0496118_0050677
1247 Ga0496119_0124772
1248 Ga0496121_0026943
1249 Ga0496121_0096061
1250 Ga0496121_0180396
1251 Ga0496122_0006217
1252 Ga0496122_0006783
1253 Ga0496122_0008179
1254 Ga0496122_0033283
1255 Ga0496123_0008042
1256 Ga0496123_0030092
1257 Ga0496123_0032313
1258 Ga0496124_0000032
1259 Ga0496124_0005830
1260 Ga0496124_0007449
1261 Ga0496124_0062324
1262 Ga0496125_0005882
1263 Ga0496125_0006876
1264 Ga0496125_0023043
1265 Ga0496125_0059584
1266 Ga0496125_0072195
1267 Ga0496126_0012258
1268 Ga0496126_0020034
1269 Ga0501305_017047
1270 Ga0495678_001117
1271 Ga0501032_0053851
1272 Ga0501032_0056552
1273 Ga0501033_0035193
1274 Ga0501033_0215741
1275 Ga0501034_0163746
1276 Ga0501034_0189912
1277 Ga0501036_0085043
1278 Ga0501036_0122441
1279 Ga0501037_0024602
1280 Ga0501037_0122307
1281 Ga0501039_0036886
1282 Ga0501043_0050346
1283 Ga0501046_0104955
1284 Ga0501047_0090951
1285 Ga0501068_0117418
1286 Ga0501070_0035345
1287 Ga0501070_0164125
1288 Ga0501073_0017700
1289 Ga0501080_0085698
1290 Ga0501080_0138132
1291 Ga0501080_0241560
1292 Ga0501083_0028050
1293 Ga0501083_0075954
1294 Ga0501035_0078983
1295 Ga0501044_0040687
1296 Ga0501044_0111992
1297 Ga0501044_0233012
1298 Ga0501044_0367566
1299 nmdc:mga0yw44_801_c1
1300 nmdc:mga0k408_92255_c1
1301 nmdc:mga0n895_113738_c1
1302 nmdc:mga0rr50_4564_c1
1303 nmdc:mga08x19_131636_c1
1304 nmdc:mga0a205_37434_c1
1305 nmdc:mga0sz30_1832_c2
1306 Ga0495601_0012837
1307 Ga0495601_0018169
1308 Ga0495601_0132635
1309 Ga0495612_0000382
1310 Ga0495619_0187988
1311 Ga0500578_0000159
1312 Ga0500644_0003289
1313 Ga0500651_0109371
1314 Ga0500641_0003812
1315 Ga0500556_0104567
1316 Ga0500594_0000108
1317 Ga0500608_000017
1318 Ga0500568_0000651
1319 Ga0500568_0008859
1320 Ga0500616_0001630
1321 Ga0500616_0032607
1322 Ga0500622_0001294
1323 Ga0500622_0001649
1324 Ga0500622_0012761
1325 Ga0500622_0133400
1326 Ga0500633_0002224
1327 Ga0500645_011004
1328 Ga0501082_0108508
1329 2509387575
1330 2511197063
1331 2511250708
1332 2513632623
1333 2513709074
1334 2515637037
1335 2515644268
1336 2517040061
1337 2517094193
1338 2520375200
1339 2550696533
1340 2585148124
1341 2585221211
1342 2585549413
1343 2585847201
1344 2587916974
1345 2599329095
1346 2643818983
1347 2643941346
1348 2644080409
1349 2644223822
1350 2644236092
1351 2644662885
1352 2644697022
1353 2644698160
1354 2748015803
1355 2766063829
1356 2793359056
1357 2805933251
1358 2819591916
1359 2826582181
1360 2838046075
1361 2838681473
1362 2838694492
1363 2838707870
1364 2842080899
1365 2842115110
1366 2842121518
1367 2842221336
1368 2842237281
1369 2842294555
1370 2842343459
1371 2842365401
1372 2842371936
1373 2842380953
1374 2842388024
1375 2842816557
1376 2842850143
1377 2857521537
1378 2884813901
1379 2884813905
1380 2884840672
1381 2884855929
1382 2895512233
1383 2895522244
1384 2895527313
1385 2896157146
1386 2919103970
1387 2928534712
1388 2933591509
1389 2935895014
1390 2936371134
1391 2936384812
1392 3005412575
1393 3005446882
1394 3005713513
1395 639647560
1396 8005376475
1397 8005559581
1398 8005570577
1399 8018169367
1400 8024481240
1401 8057876434

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12849

PBP_like_2

PBP superfamily domain

61

353

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
5i84-assembly3.cif.gz_C structure of the xanthomonas citri phosphate-binding protein phox 0.9903 9 313
5i84-assembly5.cif.gz_E structure of the xanthomonas citri phosphate-binding protein phox 0.9895 8 313
8ods-assembly1.cif.gz_A phosphate-binding protein (psts) from xanthomonas citri pv. citri a306 bound to phosphate 0.9871 7 312
1pbp-assembly1.cif.gz_A fine tuning of the specificity of the periplasmic phosphate transport receptor: site-directed mutagenesis, ligand binding, and crystallographic studies 0.9867 7 313
1quj-assembly1.cif.gz_A phosphate-binding protein mutant with asp 137 replaced by gly complex with chlorine and phosphate 0.9846 7 313
ID Description Score Start End Superfamily
af_P0AG82_103_278_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9915 76 252 3.40.190.10
af_P0AG82_103_278_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9804 76 252 3.40.190.10
1pc3B02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.946 77 252 3.40.190.10
5i84A01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9307 5 313 3.40.190.10
af_Q58421_135_323_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9125 78 252 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A5R2MUA4-F1-model_v4 Extracellular solute-binding protein 0.9985 70 167
AF-A0A3M5TDI5-F1-model_v4 Phosphate-binding protein PstS 0.9977 74 313 GO:0035435
GO:0042301
GO:0043190
AF-A0A2S5M4J3-F1-model_v4 Phosphate-binding protein PstS 0.9938 67 308 GO:0035435
GO:0042301
GO:0043190
AF-A0A1G4AKN5-F1-model_v4 deleted 0.9931 138 313
AF-A0A534DK47-F1-model_v4 Phosphate-binding protein PstS 0.9924 47 313 GO:0035435
GO:0042301
GO:0043190

Map