F475939

General Info

Members Datasets Scaffolds Average Seq Length
698 260 1396 134

Family's Representative Sequence

Representative Sequence 3300005339|Ga0070660_101060126|Ga0070660_1010601261
Length 158
Sequence LSMSLQCLFSVPDRARNAEDSVCHMELRMSARPKSKASASRKDDIIIPEKLYFRIGEVSTLCKLPAYVLRFWETEFPQLKPVKSSTGQRMYRRKEVETVLRIKQLLYDEGFTIAGARQQLRVENKTQAPLPFPTHSTGELKRLRHGLEEILTILSPRA

Samples

Sample ID Description Type Environment
1 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
94 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
95 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
104 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
110 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
111 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
112 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
170 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
174 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
177 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
178 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
179 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
180 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
181 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
182 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
183 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
184 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
185 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
186 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
187 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
188 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
189 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
190 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
191 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
192 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
193 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
194 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
195 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
196 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
197 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
198 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
199 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
200 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
201 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
202 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
203 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
204 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
205 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
206 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
207 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
208 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
209 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
210 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
211 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
212 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
213 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
214 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
215 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
216 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
217 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
218 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
219 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
220 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
221 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
222 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
223 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
224 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
225 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
226 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
227 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
228 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
229 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
230 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
231 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
232 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
233 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
234 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
235 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
236 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
237 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
238 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
239 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
240 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
241 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
242 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
243 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
244 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
245 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
246 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
247 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
248 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
249 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
250 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
251 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
252 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
253 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
254 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
255 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
256 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
257 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
258 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
259 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
260 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.71
Metatranscriptomes 1.29
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.59
Rhizosphere 92.55
Stem 0
Stem Tuber 0
Unclassified 32.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070660_101060126 3300005339 Unclassified 686
2 LJNas_1000091 3300000546 Bacteria 13390
3 Ga0058862_10022584 3300004803 Unclassified 585
4 Ga0065715_10944818 3300005293 Bacteria 539
5 Ga0070676_10342775 3300005328 Unclassified 1025
6 Ga0070683_100041890 3300005329 Bacteria 4215
7 Ga0070683_100055107 3300005329 Bacteria 3689
8 Ga0070683_100166343 3300005329 Bacteria 2093
9 Ga0070683_100421325 3300005329 Bacteria 1274
10 Ga0070683_101134526 3300005329 Bacteria 751
11 Ga0070690_100089419 3300005330 Bacteria 2026
12 Ga0070690_100096733 3300005330 Unclassified 1952
13 Ga0070670_100274203 3300005331 Unclassified 1472
14 Ga0070677_10197649 3300005333 Unclassified 968
15 Ga0068869_100013081 3300005334 Bacteria 5508
16 Ga0068869_100303751 3300005334 Bacteria 1289
17 Ga0068869_101598788 3300005334 Bacteria 580
18 Ga0070680_100114432 3300005336 Bacteria 2247
19 Ga0070680_100123833 3300005336 Bacteria 2159
20 Ga0070680_101307334 3300005336 Unclassified 627
21 Ga0070682_100304981 3300005337 Unclassified 1170
22 Ga0068868_100002034 3300005338 Bacteria 13907
23 Ga0068868_100002728 3300005338 Bacteria 12233
24 Ga0068868_100153053 3300005338 Unclassified 1900
25 Ga0068868_100253272 3300005338 Bacteria 1482
26 Ga0068868_100502822 3300005338 Bacteria 1062
27 Ga0070689_100061212 3300005340 Bacteria 2928
28 Ga0070691_10389028 3300005341 Unclassified 783
29 Ga0070687_100051207 3300005343 Bacteria 2137
30 Ga0070661_100048115 3300005344 Bacteria 3121
31 Ga0070661_100126962 3300005344 Bacteria 1914
32 Ga0070661_100171795 3300005344 Bacteria 1646
33 Ga0070692_10802856 3300005345 Unclassified 643
34 Ga0070668_100032039 3300005347 Bacteria 3999
35 Ga0070669_101733371 3300005353 Unclassified 545
36 Ga0070675_101438080 3300005354 Bacteria 636
37 Ga0070671_100082778 3300005355 Bacteria 2684
38 Ga0070674_100142743 3300005356 Unclassified 1799
39 Ga0070674_100563342 3300005356 Bacteria 958
40 Ga0070688_100136020 3300005365 Unclassified 1664
41 Ga0070659_100017759 3300005366 Bacteria 5358
42 Ga0070659_100384395 3300005366 Unclassified 1183
43 Ga0070667_100027674 3300005367 Bacteria 4717
44 Ga0070709_10021013 3300005434 Unclassified 3799
45 Ga0070709_10032620 3300005434 Unclassified 3142
46 Ga0070709_10098978 3300005434 Bacteria 1939
47 Ga0070709_10123350 3300005434 Bacteria 1759
48 Ga0070709_10157464 3300005434 Bacteria 1576
49 Ga0070709_10689149 3300005434 Unclassified 794
50 Ga0070709_11436913 3300005434 Unclassified 559
51 Ga0070714_100112760 3300005435 Bacteria 2410
52 Ga0070714_100272936 3300005435 Bacteria 1569
53 Ga0070714_101037114 3300005435 Bacteria 798
54 Ga0070714_101072905 3300005435 Unclassified 784
55 Ga0070713_100013356 3300005436 Bacteria 6061
56 Ga0070713_100028081 3300005436 Unclassified 4439
57 Ga0070713_100054800 3300005436 Bacteria 3310
58 Ga0070713_100097782 3300005436 Unclassified 2537
59 Ga0070713_100149313 3300005436 Bacteria 2077
60 Ga0070713_100155762 3300005436 Bacteria 2036
61 Ga0070713_100387847 3300005436 Bacteria 1302
62 Ga0070713_100701449 3300005436 Unclassified 966
63 Ga0070713_100902106 3300005436 Bacteria 850
64 Ga0070713_101059829 3300005436 Unclassified 783
65 Ga0070713_101363270 3300005436 Unclassified 687
66 Ga0070713_101764982 3300005436 Unclassified 600
67 Ga0070710_10005330 3300005437 Bacteria 6100
68 Ga0070710_10025421 3300005437 Unclassified 3136
69 Ga0070710_10063430 3300005437 Bacteria 2111
70 Ga0070710_10146232 3300005437 Bacteria 1454
71 Ga0070710_10181924 3300005437 Unclassified 1317
72 Ga0070710_10288755 3300005437 Bacteria 1067
73 Ga0070710_10805971 3300005437 Bacteria 671
74 Ga0070711_100001830 3300005439 Bacteria 11867
75 Ga0070711_100096368 3300005439 Bacteria 2143
76 Ga0070711_100301176 3300005439 Bacteria 1275
77 Ga0070711_100566650 3300005439 Unclassified 944
78 Ga0070694_100897163 3300005444 Bacteria 731
79 Ga0070708_100076072 3300005445 Unclassified 3031
80 Ga0070708_100134356 3300005445 Bacteria 2291
81 Ga0070708_100612428 3300005445 Bacteria 1026
82 Ga0070678_100858172 3300005456 Unclassified 828
83 Ga0070681_10000516 3300005458 Bacteria 31602
84 Ga0070681_10129495 3300005458 Bacteria 2456
85 Ga0070681_10177382 3300005458 Bacteria 2052
86 Ga0070681_10303830 3300005458 Bacteria 1505
87 Ga0070681_11092446 3300005458 Unclassified 718
88 Ga0068867_100112974 3300005459 Bacteria 2089
89 Ga0070685_10374665 3300005466 Unclassified 979
90 Ga0070706_100001385 3300005467 Bacteria 25705
91 Ga0070706_100493890 3300005467 Bacteria 1139
92 Ga0070706_100588610 3300005467 Bacteria 1034
93 Ga0070707_100029873 3300005468 Bacteria 5186
94 Ga0070707_100460253 3300005468 Bacteria 1233
95 Ga0070707_101167353 3300005468 Unclassified 736
96 Ga0070707_101662294 3300005468 Unclassified 606
97 Ga0070707_101906178 3300005468 Unclassified 562
98 Ga0070707_101924214 3300005468 Unclassified 559
99 Ga0070698_100095532 3300005471 Bacteria 2950
100 Ga0070699_100020676 3300005518 Bacteria 5679
101 Ga0070699_100070662 3300005518 Unclassified 3035
102 Ga0070679_100077835 3300005530 Bacteria 3305
103 Ga0070679_100177179 3300005530 Unclassified 2105
104 Ga0070679_100179887 3300005530 Bacteria 2087
105 Ga0070679_100251909 3300005530 Bacteria 1722
106 Ga0070679_100456689 3300005530 Bacteria 1222
107 Ga0070679_100937948 3300005530 Bacteria 809
108 Ga0070679_101384700 3300005530 Unclassified 649
109 Ga0070684_100023799 3300005535 Bacteria 5129
110 Ga0070684_100250601 3300005535 Bacteria 1618
111 Ga0070684_100268514 3300005535 Bacteria 1561
112 Ga0070697_100000280 3300005536 Bacteria 41171
113 Ga0070697_100077445 3300005536 Bacteria 2735
114 Ga0068853_100215969 3300005539 Bacteria 1750
115 Ga0068853_100233762 3300005539 Unclassified 1682
116 Ga0068853_100508081 3300005539 Bacteria 1138
117 Ga0068853_100509544 3300005539 Bacteria 1137
118 Ga0068853_100892483 3300005539 Unclassified 853
119 Ga0068853_101122270 3300005539 Bacteria 758
120 Ga0070686_100015760 3300005544 Bacteria 4386
121 Ga0070695_100118313 3300005545 Bacteria 1809
122 Ga0070696_100088832 3300005546 Bacteria 2197
123 Ga0070696_100509548 3300005546 Bacteria 958
124 Ga0070696_101653486 3300005546 Unclassified 551
125 Ga0070693_100044144 3300005547 Unclassified 2520
126 Ga0070693_100137784 3300005547 Bacteria 1533
127 Ga0070693_101138563 3300005547 Unclassified 597
128 Ga0070665_100014347 3300005548 Bacteria 7956
129 Ga0070704_100718116 3300005549 Unclassified 888
130 Ga0068855_100027325 3300005563 Bacteria 6827
131 Ga0068855_100035605 3300005563 Bacteria 5929
132 Ga0068855_100035798 3300005563 Bacteria 5912
133 Ga0068855_100047460 3300005563 Bacteria 5074
134 Ga0068855_100087385 3300005563 Unclassified 3603
135 Ga0070664_100000972 3300005564 Bacteria 22427
136 Ga0070664_100013788 3300005564 Bacteria 6589
137 Ga0070664_100137058 3300005564 Unclassified 2153
138 Ga0070664_100182628 3300005564 Bacteria 1865
139 Ga0070664_100318401 3300005564 Bacteria 1409
140 Ga0068857_100000335 3300005577 Bacteria 32411
141 Ga0068857_100019182 3300005577 Bacteria 6003
142 Ga0068857_100788941 3300005577 Unclassified 906
143 Ga0068857_101329688 3300005577 Bacteria 698
144 Ga0068857_101917281 3300005577 Unclassified 580
145 Ga0068854_100003073 3300005578 Bacteria 10393
146 Ga0068854_100010276 3300005578 Bacteria 6067
147 Ga0068854_100020761 3300005578 Bacteria 4451
148 Ga0068854_100165129 3300005578 Bacteria 1718
149 Ga0068854_100527621 3300005578 Bacteria 998
150 Ga0068856_100002426 3300005614 Bacteria 19184
151 Ga0068856_100005963 3300005614 Bacteria 11992
152 Ga0068856_100024175 3300005614 Bacteria 5912
153 Ga0068856_100044883 3300005614 Bacteria 4350
154 Ga0068856_100066238 3300005614 Bacteria 3569
155 Ga0068856_100081676 3300005614 Bacteria 3207
156 Ga0068856_100160862 3300005614 Unclassified 2255
157 Ga0068856_100744112 3300005614 Bacteria 1000
158 Ga0068856_100807791 3300005614 Bacteria 957
159 Ga0070702_101777403 3300005615 Unclassified 514
160 Ga0068852_100042898 3300005616 Bacteria 3832
161 Ga0068852_100062259 3300005616 Bacteria 3245
162 Ga0068852_100099595 3300005616 Bacteria 2620
163 Ga0068852_102051425 3300005616 Bacteria 594
164 Ga0068859_100008421 3300005617 Bacteria 10445
165 Ga0068859_100015248 3300005617 Bacteria 7717
166 Ga0068864_100003998 3300005618 Bacteria 12141
167 Ga0068864_100204214 3300005618 Bacteria 1817
168 Ga0068864_100549922 3300005618 Bacteria 1116
169 Ga0068866_10028210 3300005718 Bacteria 2672
170 Ga0068866_10317213 3300005718 Unclassified 979
171 Ga0068861_100342375 3300005719 Unclassified 1309
172 Ga0068851_10038848 3300005834 Bacteria 2389
173 Ga0068863_100011279 3300005841 Bacteria 8657
174 Ga0068863_100802871 3300005841 Unclassified 939
175 Ga0068863_101163399 3300005841 Bacteria 777
176 Ga0068858_100000404 3300005842 Bacteria 44997
177 Ga0068858_100022305 3300005842 Bacteria 5912
178 Ga0068858_100022664 3300005842 Bacteria 5857
179 Ga0068858_100103720 3300005842 Bacteria 2653
180 Ga0068860_100192651 3300005843 Bacteria 1973
181 Ga0068860_101315204 3300005843 Unclassified 744
182 Ga0068862_100013092 3300005844 Bacteria 6860
183 Ga0068862_100609478 3300005844 Unclassified 1049
184 Ga0070717_10020255 3300006028 Bacteria 5227
185 Ga0070717_10102757 3300006028 Bacteria 2429
186 Ga0070717_10227267 3300006028 Bacteria 1642
187 Ga0070717_10237682 3300006028 Unclassified 1605
188 Ga0070717_10283545 3300006028 Bacteria 1470
189 Ga0070717_10309452 3300006028 Bacteria 1406
190 Ga0070717_10437062 3300006028 Bacteria 1178
191 Ga0070717_11162393 3300006028 Unclassified 702
192 Ga0070715_10019936 3300006163 Bacteria 2579
193 Ga0070715_10036685 3300006163 Bacteria 2024
194 Ga0070715_10065909 3300006163 Bacteria 1604
195 Ga0070715_10195657 3300006163 Bacteria 1024
196 Ga0070715_10272486 3300006163 Unclassified 894
197 Ga0070716_100000719 3300006173 Bacteria 14140
198 Ga0070716_100174921 3300006173 Bacteria 1404
199 Ga0070716_100337527 3300006173 Bacteria 1062
200 Ga0070716_100764457 3300006173 Bacteria 745
201 Ga0070716_101321018 3300006173 Unclassified 584
202 Ga0070712_100000188 3300006175 Bacteria 34294
203 Ga0070712_100002110 3300006175 Bacteria 12215
204 Ga0070712_100032463 3300006175 Bacteria 3526
205 Ga0070712_100100205 3300006175 Bacteria 2140
206 Ga0070712_100638822 3300006175 Bacteria 904
207 Ga0070712_100728309 3300006175 Unclassified 847
208 Ga0070712_100754853 3300006175 Bacteria 833
209 Ga0070712_100988416 3300006175 Unclassified 728
210 Ga0070712_101262539 3300006175 Unclassified 643
211 Ga0070712_101271065 3300006175 Unclassified 641
212 Ga0097621_100014867 3300006237 Bacteria 5839
213 Ga0097621_100035312 3300006237 Bacteria 3994
214 Ga0097621_100050913 3300006237 Unclassified 3369
215 Ga0097621_100058450 3300006237 Bacteria 3155
216 Ga0097621_100098010 3300006237 Bacteria 2462
217 Ga0097621_100581949 3300006237 Unclassified 1022
218 Ga0068871_100026130 3300006358 Bacteria 4552
219 Ga0068871_100048947 3300006358 Bacteria 3414
220 Ga0068871_100052347 3300006358 Bacteria 3306
221 Ga0068871_100055804 3300006358 Bacteria 3208
222 Ga0068871_100230547 3300006358 Bacteria 1607
223 Ga0075434_100040343 3300006871 Bacteria 4623
224 Ga0068865_100037406 3300006881 Unclassified 3277
225 Ga0068865_100042312 3300006881 Bacteria 3106
226 Ga0068865_100055090 3300006881 Bacteria 2766
227 Ga0075436_100208045 3300006914 Unclassified 1387
228 Ga0097620_100008421 3300006931 Bacteria 10445
229 Ga0097620_100015253 3300006931 Bacteria 7717
230 Ga0075435_100175674 3300007076 Bacteria 1809
231 Ga0075435_100212654 3300007076 Bacteria 1641
232 Ga0075435_101521949 3300007076 Unclassified 587
233 Ga0075435_101639253 3300007076 Bacteria 564
234 Ga0099795_10079371 3300007788 Bacteria 1253
235 Ga0105240_10041027 3300009093 Bacteria 5912
236 Ga0105240_10118482 3300009093 Bacteria 3190
237 Ga0105240_10173529 3300009093 Bacteria 2551
238 Ga0105240_10192360 3300009093 Unclassified 2398
239 Ga0105240_10228981 3300009093 Bacteria 2161
240 Ga0105240_10485544 3300009093 Unclassified 1376
241 Ga0105240_10560576 3300009093 Unclassified 1263
242 Ga0105245_10178532 3300009098 Bacteria 2027
243 Ga0105245_10658879 3300009098 Unclassified 1077
244 Ga0105245_10748058 3300009098 Unclassified 1013
245 Ga0105247_10061643 3300009101 Unclassified 2326
246 Ga0105247_10096097 3300009101 Unclassified 1888
247 Ga0105247_10295200 3300009101 Bacteria 1122
248 Ga0105247_10347377 3300009101 Bacteria 1042
249 Ga0105243_10621312 3300009148 Bacteria 1043
250 Ga0105241_10004558 3300009174 Bacteria 10250
251 Ga0105241_10008879 3300009174 Bacteria 7394
252 Ga0105241_10014156 3300009174 Bacteria 5844
253 Ga0105241_10041998 3300009174 Bacteria 3458
254 Ga0105241_10283768 3300009174 Bacteria 1415
255 Ga0105241_10311687 3300009174 Unclassified 1354
256 Ga0105241_10413206 3300009174 Unclassified 1186
257 Ga0105241_11110069 3300009174 Unclassified 745
258 Ga0105241_11614339 3300009174 Bacteria 628
259 Ga0105242_10112040 3300009176 Bacteria 2327
260 Ga0105242_10309510 3300009176 Bacteria 1445
261 Ga0105242_10632175 3300009176 Unclassified 1038
262 Ga0105242_10638292 3300009176 Unclassified 1034
263 Ga0105248_10011433 3300009177 Bacteria 9783
264 Ga0105248_10038196 3300009177 Bacteria 5373
265 Ga0105248_10083865 3300009177 Unclassified 3585
266 Ga0105248_11189077 3300009177 Unclassified 862
267 Ga0105237_10013626 3300009545 Bacteria 8515
268 Ga0105237_10019981 3300009545 Bacteria 6914
269 Ga0105237_10129661 3300009545 Unclassified 2516
270 Ga0105237_10179233 3300009545 Bacteria 2119
271 Ga0105237_10392500 3300009545 Unclassified 1392
272 Ga0105237_10403347 3300009545 Unclassified 1372
273 Ga0105237_10469160 3300009545 Bacteria 1265
274 Ga0105237_11172531 3300009545 Unclassified 775
275 Ga0105237_12512891 3300009545 Unclassified 525
276 Ga0105238_10000214 3300009551 Bacteria 64373
277 Ga0105238_10058700 3300009551 Bacteria 3856
278 Ga0105238_11284079 3300009551 Unclassified 758
279 Ga0105238_11306186 3300009551 Unclassified 751
280 Ga0105249_10128144 3300009553 Unclassified 2419
281 Ga0099796_10070296 3300010159 Bacteria 1262
282 Ga0099796_10154955 3300010159 Unclassified 904
283 Ga0099796_10400096 3300010159 Unclassified 602
284 Ga0105239_10418471 3300010375 Bacteria 1518
285 Ga0105239_10747253 3300010375 Unclassified 1119
286 Ga0105246_10031095 3300011119 Bacteria 3530
287 Ga0105246_10073637 3300011119 Bacteria 2412
288 Ga0157373_10002307 3300013100 Bacteria 14477
289 Ga0157373_10050500 3300013100 Unclassified 2961
290 Ga0157373_10341583 3300013100 Bacteria 1067
291 Ga0157371_10145618 3300013102 Bacteria 1688
292 Ga0157371_10320680 3300013102 Bacteria 1124
293 Ga0157371_10522301 3300013102 Bacteria 878
294 Ga0157370_10042321 3300013104 Unclassified 4390
295 Ga0157370_10062571 3300013104 Unclassified 3528
296 Ga0157370_10823399 3300013104 Unclassified 844
297 Ga0157370_11581347 3300013104 Unclassified 589
298 Ga0157369_10017191 3300013105 Bacteria 8127
299 Ga0157369_10024898 3300013105 Bacteria 6650
300 Ga0157369_10030146 3300013105 Bacteria 5984
301 Ga0157369_10030474 3300013105 Bacteria 5949
302 Ga0157369_10055341 3300013105 Bacteria 4283
303 Ga0157369_10169254 3300013105 Bacteria 2303
304 Ga0157374_10002353 3300013296 Bacteria 15957
305 Ga0157374_10007704 3300013296 Bacteria 9195
306 Ga0157374_10020082 3300013296 Bacteria 5924
307 Ga0157374_10020608 3300013296 Bacteria 5854
308 Ga0157374_10112592 3300013296 Unclassified 2618
309 Ga0157374_10136470 3300013296 Bacteria 2378
310 Ga0157374_10493097 3300013296 Unclassified 1229
311 Ga0157374_10533244 3300013296 Unclassified 1181
312 Ga0157374_11508064 3300013296 Bacteria 696
313 Ga0157378_10000349 3300013297 Bacteria 45351
314 Ga0157378_10012660 3300013297 Bacteria 7380
315 Ga0157378_10019523 3300013297 Bacteria 5958
316 Ga0157378_10110608 3300013297 Bacteria 2518
317 Ga0157378_10223860 3300013297 Unclassified 1789
318 Ga0157378_10284258 3300013297 Unclassified 1596
319 Ga0157378_10578669 3300013297 Unclassified 1132
320 Ga0163162_10001352 3300013306 Bacteria 22820
321 Ga0163162_10076008 3300013306 Bacteria 3420
322 Ga0157372_10009551 3300013307 Bacteria 10312
323 Ga0157372_10016466 3300013307 Bacteria 7935
324 Ga0157372_10021505 3300013307 Bacteria 6970
325 Ga0157372_10198126 3300013307 Bacteria 2326
326 Ga0157372_10340856 3300013307 Bacteria 1746
327 Ga0157372_10449539 3300013307 Unclassified 1502
328 Ga0157372_12244693 3300013307 Unclassified 627
329 Ga0157375_10073391 3300013308 Bacteria 3441
330 Ga0163163_10137406 3300014325 Unclassified 2485
331 Ga0163163_10308668 3300014325 Bacteria 1635
332 Ga0163163_10744433 3300014325 Unclassified 1043
333 Ga0182008_10166695 3300014497 Unclassified 1111
334 Ga0157377_10230735 3300014745 Bacteria 1190
335 Ga0157379_10014470 3300014968 Bacteria 6924
336 Ga0157376_10004658 3300014969 Bacteria 9559
337 Ga0157376_10029979 3300014969 Bacteria 4337
338 Ga0157376_10129620 3300014969 Unclassified 2248
339 Ga0157376_10156827 3300014969 Bacteria 2059
340 Ga0157376_10606817 3300014969 Unclassified 1090
341 Ga0157376_10917595 3300014969 Unclassified 895
342 Ga0163161_10454448 3300017792 Bacteria 1036
343 Ga0206350_10799557 3300020080 Bacteria 572
344 Ga0224569_100417 3300022732 Bacteria 3629
345 Ga0224569_101519 3300022732 Bacteria 1944
346 Ga0224572_1043589 3300024225 Bacteria 842
347 Ga0228598_1000610 3300024227 Bacteria 7498
348 Ga0228598_1017198 3300024227 Bacteria 1426
349 Ga0207656_10591974 3300025321 Unclassified 566
350 Ga0207692_10038564 3300025898 Bacteria 2344
351 Ga0207692_10051885 3300025898 Bacteria 2081
352 Ga0207692_10075763 3300025898 Bacteria 1786
353 Ga0207692_10232322 3300025898 Bacteria 1098
354 Ga0207692_10287795 3300025898 Unclassified 996
355 Ga0207692_10553051 3300025898 Unclassified 735
356 Ga0207692_10808708 3300025898 Bacteria 613
357 Ga0207642_10251058 3300025899 Unclassified 1004
358 Ga0207642_10353709 3300025899 Unclassified 867
359 Ga0207710_10127567 3300025900 Bacteria 1220
360 Ga0207647_10056919 3300025904 Bacteria 2398
361 Ga0207685_10010487 3300025905 Bacteria 2739
362 Ga0207685_10121840 3300025905 Unclassified 1146
363 Ga0207685_10143577 3300025905 Bacteria 1073
364 Ga0207685_10265566 3300025905 Unclassified 836
365 Ga0207685_10362993 3300025905 Bacteria 733
366 Ga0207699_10005690 3300025906 Bacteria 5990
367 Ga0207699_10061308 3300025906 Bacteria 2262
368 Ga0207699_10139396 3300025906 Unclassified 1592
369 Ga0207699_10289543 3300025906 Bacteria 1141
370 Ga0207699_10347228 3300025906 Bacteria 1047
371 Ga0207699_10491028 3300025906 Bacteria 885
372 Ga0207645_10011239 3300025907 Bacteria 6123
373 Ga0207684_10005360 3300025910 Bacteria 11848
374 Ga0207684_10211737 3300025910 Bacteria 1672
375 Ga0207654_10003381 3300025911 Bacteria 8076
376 Ga0207654_10005928 3300025911 Bacteria 6151
377 Ga0207654_10072931 3300025911 Bacteria 2045
378 Ga0207654_10108992 3300025911 Bacteria 1719
379 Ga0207654_10217127 3300025911 Unclassified 1266
380 Ga0207654_10246731 3300025911 Unclassified 1195
381 Ga0207654_10386426 3300025911 Unclassified 970
382 Ga0207654_10839063 3300025911 Bacteria 665
383 Ga0207707_10004272 3300025912 Bacteria 12644
384 Ga0207707_10014133 3300025912 Bacteria 6956
385 Ga0207707_10104125 3300025912 Bacteria 2480
386 Ga0207707_10512052 3300025912 Bacteria 1022
387 Ga0207707_10873381 3300025912 Unclassified 745
388 Ga0207695_10006382 3300025913 Bacteria 15343
389 Ga0207695_10039220 3300025913 Bacteria 5092
390 Ga0207695_10059977 3300025913 Bacteria 3942
391 Ga0207695_10220128 3300025913 Unclassified 1806
392 Ga0207695_10259566 3300025913 Bacteria 1635
393 Ga0207671_10011713 3300025914 Bacteria 7106
394 Ga0207671_10138997 3300025914 Bacteria 1870
395 Ga0207671_10299163 3300025914 Bacteria 1271
396 Ga0207693_10000524 3300025915 Bacteria 34688
397 Ga0207693_10001919 3300025915 Bacteria 18194
398 Ga0207693_10008223 3300025915 Bacteria 8543
399 Ga0207693_10013982 3300025915 Bacteria 6463
400 Ga0207693_10025087 3300025915 Bacteria 4729
401 Ga0207693_10058181 3300025915 Bacteria 3028
402 Ga0207663_10002678 3300025916 Bacteria 8589
403 Ga0207663_10034834 3300025916 Bacteria 3015
404 Ga0207663_10072437 3300025916 Unclassified 2227
405 Ga0207663_10172934 3300025916 Unclassified 1536
406 Ga0207663_10300115 3300025916 Unclassified 1200
407 Ga0207663_10474092 3300025916 Bacteria 969
408 Ga0207663_10779602 3300025916 Bacteria 761
409 Ga0207660_10164830 3300025917 Bacteria 1712
410 Ga0207660_10647908 3300025917 Bacteria 861
411 Ga0207660_11006774 3300025917 Unclassified 680
412 Ga0207662_10068932 3300025918 Bacteria 2137
413 Ga0207657_10004544 3300025919 Bacteria 14660
414 Ga0207657_10511540 3300025919 Unclassified 940
415 Ga0207649_10112564 3300025920 Bacteria 1821
416 Ga0207649_10494298 3300025920 Unclassified 929
417 Ga0207649_10735469 3300025920 Bacteria 767
418 Ga0207652_10008758 3300025921 Bacteria 8144
419 Ga0207652_10039789 3300025921 Bacteria 3991
420 Ga0207652_10236677 3300025921 Bacteria 1646
421 Ga0207652_10601787 3300025921 Bacteria 986
422 Ga0207652_11199600 3300025921 Unclassified 661
423 Ga0207646_10071842 3300025922 Bacteria 3091
424 Ga0207646_10338275 3300025922 Unclassified 1360
425 Ga0207646_10382507 3300025922 Bacteria 1271
426 Ga0207681_10806896 3300025923 Bacteria 784
427 Ga0207694_10002173 3300025924 Bacteria 16132
428 Ga0207694_10015779 3300025924 Bacteria 5700
429 Ga0207694_10612603 3300025924 Unclassified 916
430 Ga0207659_11260092 3300025926 Unclassified 635
431 Ga0207687_10145120 3300025927 Bacteria 1805
432 Ga0207687_10739627 3300025927 Unclassified 837
433 Ga0207700_10001374 3300025928 Bacteria 13798
434 Ga0207700_10003931 3300025928 Bacteria 8684
435 Ga0207700_10040604 3300025928 Unclassified 3397
436 Ga0207700_10053055 3300025928 Bacteria 3035
437 Ga0207700_10076042 3300025928 Bacteria 2604
438 Ga0207700_10103133 3300025928 Bacteria 2280
439 Ga0207700_10416726 3300025928 Bacteria 1179
440 Ga0207700_10622073 3300025928 Unclassified 962
441 Ga0207700_10908109 3300025928 Unclassified 788
442 Ga0207700_11491342 3300025928 Unclassified 600
443 Ga0207664_10222907 3300025929 Bacteria 1636
444 Ga0207664_10233707 3300025929 Bacteria 1599
445 Ga0207664_10465584 3300025929 Bacteria 1129
446 Ga0207644_10078525 3300025931 Bacteria 2433
447 Ga0207644_10549978 3300025931 Unclassified 955
448 Ga0207690_10025625 3300025932 Bacteria 3705
449 Ga0207690_10114342 3300025932 Bacteria 1949
450 Ga0207706_10003412 3300025933 Bacteria 15181
451 Ga0207686_10042114 3300025934 Bacteria 2789
452 Ga0207686_10095160 3300025934 Bacteria 1976
453 Ga0207686_10807037 3300025934 Unclassified 752
454 Ga0207670_10297659 3300025936 Unclassified 1262
455 Ga0207669_10233361 3300025937 Bacteria 1359
456 Ga0207704_10024083 3300025938 Unclassified 3294
457 Ga0207704_10038752 3300025938 Bacteria 2768
458 Ga0207704_10468247 3300025938 Bacteria 1009
459 Ga0207665_10000107 3300025939 Bacteria 54377
460 Ga0207665_10002111 3300025939 Bacteria 13441
461 Ga0207665_10011949 3300025939 Bacteria 5703
462 Ga0207665_10073929 3300025939 Bacteria 2332
463 Ga0207665_10104733 3300025939 Bacteria 1980
464 Ga0207665_10116511 3300025939 Bacteria 1883
465 Ga0207665_10366422 3300025939 Unclassified 1091
466 Ga0207665_10439160 3300025939 Bacteria 1000
467 Ga0207665_10935426 3300025939 Unclassified 688
468 Ga0207665_11251009 3300025939 Unclassified 592
469 Ga0207691_10632240 3300025940 Unclassified 905
470 Ga0207711_10054490 3300025941 Bacteria 3432
471 Ga0207711_10105119 3300025941 Bacteria 2503
472 Ga0207711_10283757 3300025941 Bacteria 1525
473 Ga0207711_10648271 3300025941 Unclassified 985
474 Ga0207689_10020706 3300025942 Bacteria 5530
475 Ga0207689_10363656 3300025942 Unclassified 1203
476 Ga0207661_10241521 3300025944 Unclassified 1603
477 Ga0207661_10382239 3300025944 Bacteria 1274
478 Ga0207661_10408868 3300025944 Unclassified 1231
479 Ga0207661_10614299 3300025944 Unclassified 998
480 Ga0207679_10022824 3300025945 Unclassified 4267
481 Ga0207679_10065896 3300025945 Unclassified 2712
482 Ga0207667_10002400 3300025949 Bacteria 23462
483 Ga0207667_10016948 3300025949 Bacteria 8219
484 Ga0207667_10019010 3300025949 Bacteria 7682
485 Ga0207667_10029499 3300025949 Bacteria 5949
486 Ga0207667_10090526 3300025949 Unclassified 3162
487 Ga0207712_10030782 3300025961 Bacteria 3610
488 Ga0207668_10014196 3300025972 Bacteria 4928
489 Ga0207640_10000843 3300025981 Bacteria 17434
490 Ga0207640_10166240 3300025981 Unclassified 1638
491 Ga0207640_10191715 3300025981 Bacteria 1541
492 Ga0207640_10438113 3300025981 Unclassified 1074
493 Ga0207640_10653993 3300025981 Bacteria 896
494 Ga0207658_10013917 3300025986 Bacteria 5506
495 Ga0207677_10001146 3300026023 Bacteria 14471
496 Ga0207677_10035986 3300026023 Bacteria 3221
497 Ga0207677_10225514 3300026023 Bacteria 1506
498 Ga0207677_10397501 3300026023 Unclassified 1168
499 Ga0207703_10004390 3300026035 Bacteria 11593
500 Ga0207703_10036228 3300026035 Bacteria 3926
501 Ga0207703_10105947 3300026035 Bacteria 2391
502 Ga0207639_10072810 3300026041 Bacteria 2692
503 Ga0207639_10098468 3300026041 Unclassified 2357
504 Ga0207639_10223605 3300026041 Bacteria 1627
505 Ga0207639_10607341 3300026041 Unclassified 1009
506 Ga0207639_10760155 3300026041 Bacteria 901
507 Ga0207678_10001295 3300026067 Bacteria 23151
508 Ga0207702_10001116 3300026078 Bacteria 27436
509 Ga0207702_10010710 3300026078 Bacteria 7659
510 Ga0207702_10033937 3300026078 Bacteria 4264
511 Ga0207702_10054228 3300026078 Bacteria 3396
512 Ga0207702_10070660 3300026078 Bacteria 3003
513 Ga0207702_10138022 3300026078 Bacteria 2202
514 Ga0207702_10187958 3300026078 Bacteria 1906
515 Ga0207702_10758828 3300026078 Unclassified 958
516 Ga0207641_10078848 3300026088 Unclassified 2854
517 Ga0207641_10080284 3300026088 Bacteria 2829
518 Ga0207641_10186602 3300026088 Bacteria 1903
519 Ga0207641_10636859 3300026088 Unclassified 1046
520 Ga0207648_10014004 3300026089 Bacteria 7430
521 Ga0207648_10034800 3300026089 Bacteria 4440
522 Ga0207676_10009475 3300026095 Bacteria 6932
523 Ga0207676_10276247 3300026095 Bacteria 1523
524 Ga0207676_11394991 3300026095 Unclassified 696
525 Ga0207674_10000269 3300026116 Bacteria 65505
526 Ga0207674_10184164 3300026116 Bacteria 2039
527 Ga0207674_10213170 3300026116 Bacteria 1880
528 Ga0207674_11363048 3300026116 Bacteria 679
529 Ga0207675_100106135 3300026118 Bacteria 2648
530 Ga0207683_10195001 3300026121 Bacteria 1840
531 Ga0207698_10280822 3300026142 Bacteria 1540
532 Ga0207698_11481623 3300026142 Bacteria 694
533 Ga0207698_11712564 3300026142 Unclassified 644
534 Ga0265356_1007564 3300028017 Bacteria 1251
535 Ga0268266_10249239 3300028379 Bacteria 1642
536 Ga0268266_10389584 3300028379 Bacteria 1316
537 Ga0268265_10270770 3300028380 Bacteria 1515
538 Ga0268265_10557891 3300028380 Unclassified 1088
539 Ga0268264_10142842 3300028381 Bacteria 2137
540 Ga0265338_10350962 3300028800 Bacteria 1061
541 Ga0265762_1000946 3300030760 Bacteria 5205
542 Ga0265762_1009970 3300030760 Bacteria 1696
543 Ga0265762_1011930 3300030760 Unclassified 1555
544 Ga0265760_10001451 3300031090 Bacteria 6976
545 Ga0265760_10049819 3300031090 Unclassified 1259
546 Ga0265760_10066660 3300031090 Bacteria 1100
547 Ga0265760_10191260 3300031090 Bacteria 688
548 Ga0265330_10004603 3300031235 Bacteria 6976
549 Ga0265325_10081869 3300031241 Bacteria 1603
550 Ga0265340_10038300 3300031247 Bacteria 2372
551 Ga0265339_10137655 3300031249 Bacteria 1244
552 Ga0265316_10005636 3300031344 Bacteria 12119
553 Ga0265316_10069349 3300031344 Unclassified 2721
554 Ga0265314_10000348 3300031711 Bacteria 64175
555 Ga0265314_10080770 3300031711 Bacteria 2145
556 Ga0265342_10105979 3300031712 Bacteria 1596
557 Ga0316212_1010514 3300033547 Unclassified 1327
558 Ga0373930_0002850 3300034816 Bacteria 2712
559 Ga0373959_0066820 3300034820 Bacteria 806
560 Ga0373926_0120020 3300035083 Unclassified 991
561 Ga0373926_0150539 3300035083 Unclassified 886
562 Ga0373926_0277610 3300035083 Unclassified 652
563 Ga0373928_0177448 3300035084 Unclassified 604
564 Ga0373929_0101812 3300035085 Unclassified 725
565 Ga0373929_0195494 3300035085 Bacteria 564
566 Ga0373934_0031541 3300035086 Unclassified 2075
567 Ga0373940_0012610 3300035088 Bacteria 2028
568 Ga0373952_0061248 3300035092 Bacteria 921
569 Ga0373923_0687016 3300035111 Unclassified 508
570 Ga0373932_0031152 3300035112 Bacteria 1484
571 Ga0373932_0336590 3300035112 Unclassified 571
572 Ga0373941_0075026 3300035115 Unclassified 1131
573 Ga0373943_0153197 3300035170 Bacteria 1250
574 Ga0373943_0458486 3300035170 Bacteria 741
575 Ga0373955_0105875 3300035172 Bacteria 1621
576 Ga0373942_0095494 3300035207 Unclassified 902
577 Ga0373942_0287944 3300035207 Unclassified 567
578 Ga0373961_0290109 3300035241 Bacteria 602
579 Ga0373924_0055565 3300035410 Unclassified 1648
580 Ga0373931_0070609 3300035691 Bacteria 1906
581 Ga0373931_0165397 3300035691 Bacteria 1299
582 Ga0373931_0191059 3300035691 Bacteria 1218
583 Ga0373931_0359094 3300035691 Unclassified 914
584 Ga0373935_0087992 3300035692 Bacteria 2029
585 Ga0373927_0034111 3300035695 Bacteria 3312
586 Ga0373933_0210717 3300035724 Unclassified 1245
587 Ga0373947_0312167 3300035725 Unclassified 1050
588 Ga0373947_0957930 3300035725 Unclassified 584
589 Ga0373937_0049001 3300036401 Bacteria 3868
590 Ga0373937_0163202 3300036401 Bacteria 2089
591 Ga0373937_0462315 3300036401 Bacteria 1205
592 Ga0373925_0005643 3300037068 Bacteria 9311
593 Ga0373925_0024897 3300037068 Bacteria 4372
594 Ga0373925_0576270 3300037068 Bacteria 926
595 Ga0373925_0596540 3300037068 Unclassified 910
596 Ga0436364_0514138 3300037853 Unclassified 4866
597 Ga0436364_0801393 3300037853 Bacteria 825
598 Ga0242420_008913 3300038996 Bacteria 1637
599 Ga0436360_0070604 3300039438 Bacteria 1111
600 Ga0436360_0755550 3300039438 Bacteria 1210
601 Ga0436363_0207954 3300039450 Bacteria 1892
602 Ga0436363_1196749 3300039450 Bacteria 3919
603 Ga0436362_0725186 3300039453 Unclassified 3605
604 Ga0451839_0440554 3300041496 Unclassified 915
605 Ga0466966_0576756 3300044684 Unclassified 677
606 Ga0466961_0303856 3300044693 Unclassified 974
607 Ga0466963_0013420 3300044694 Bacteria 5031
608 Ga0466963_0069414 3300044694 Bacteria 2368
609 Ga0466964_0040768 3300044706 Bacteria 1876
610 Ga0466971_0026254 3300044719 Bacteria 2602
611 Ga0466968_0659183 3300044735 Unclassified 532
612 Ga0466957_0340163 3300044842 Unclassified 1016
613 Ga0466959_0353015 3300045049 Unclassified 1002
614 Ga0451576_0725525 3300045051 Unclassified 1044
615 Ga0451576_1026087 3300045051 Unclassified 864
616 Ga0466958_0081695 3300045836 Bacteria 1989
617 Ga0466967_0008226 3300045976 Bacteria 7620
618 Ga0466967_0103166 3300045976 Bacteria 2610
619 Ga0466967_0907308 3300045976 Unclassified 876
620 Ga0495651_0148262 3300046462 Bacteria 1694
621 Ga0495580_0000750 3300046472 Bacteria 27781
622 Ga0495580_0018203 3300046472 Bacteria 5233
623 Ga0495580_0079331 3300046472 Bacteria 2289
624 Ga0495580_0090086 3300046472 Unclassified 2135
625 Ga0495580_0112389 3300046472 Bacteria 1892
626 Ga0495580_0136133 3300046472 Bacteria 1703
627 Ga0495580_0189941 3300046472 Bacteria 1417
628 Ga0495580_0641467 3300046472 Unclassified 699
629 Ga0495582_0100397 3300046473 Bacteria 1620
630 Ga0495639_0044109 3300046475 Bacteria 2016
631 Ga0495630_0107809 3300046517 Bacteria 2110
632 Ga0495645_0748140 3300046543 Unclassified 590
633 Ga0495667_0264468 3300046559 Bacteria 1094
634 Ga0495635_0028063 3300046663 Bacteria 3913
635 Ga0495657_0462504 3300046675 Bacteria 742
636 Ga0495624_0534024 3300046690 Bacteria 701
637 Ga0495604_0287285 3300047317 Bacteria 1109
638 Ga0495604_0313049 3300047317 Unclassified 1051
639 Ga0495674_0205679 3300047319 Bacteria 1632
640 Ga0495675_0083980 3300047444 Unclassified 2004
641 Ga0495684_0735118 3300047471 Bacteria 651
642 Ga0495602_0338877 3300048088 Bacteria 1088
643 Ga0495602_0377638 3300048088 Unclassified 1016
644 Ga0495602_0976022 3300048088 Unclassified 560
645 Ga0496100_0003992 3300048903 Bacteria 7756
646 Ga0496101_0060213 3300048904 Bacteria 2754
647 Ga0496101_0069315 3300048904 Bacteria 2580
648 Ga0496101_0420861 3300048904 Unclassified 1053
649 Ga0496102_0020175 3300048905 Bacteria 5885
650 Ga0496102_0052591 3300048905 Bacteria 3712
651 Ga0496102_0080446 3300048905 Bacteria 3002
652 Ga0496102_0385556 3300048905 Bacteria 1319
653 Ga0496102_0437698 3300048905 Bacteria 1227
654 Ga0496103_0001274 3300048906 Bacteria 17183
655 Ga0496103_0038125 3300048906 Bacteria 2947
656 Ga0496104_0029097 3300048907 Bacteria 5123
657 Ga0496104_0030365 3300048907 Bacteria 5022
658 Ga0496104_0038796 3300048907 Bacteria 4458
659 Ga0496104_0159649 3300048907 Bacteria 2163
660 Ga0496104_0182359 3300048907 Bacteria 2010
661 Ga0496104_0192756 3300048907 Bacteria 1950
662 Ga0496104_0197752 3300048907 Bacteria 1922
663 Ga0496105_0071892 3300048908 Bacteria 2859
664 Ga0496106_0097367 3300048909 Bacteria 2278
665 Ga0496107_0066810 3300048910 Unclassified 2607
666 Ga0496107_0068683 3300048910 Bacteria 2572
667 Ga0496107_0589129 3300048910 Unclassified 822
668 Ga0496108_0126818 3300048911 Bacteria 2192
669 Ga0496108_0144691 3300048911 Unclassified 2049
670 Ga0496109_0067656 3300048912 Bacteria 3273
671 Ga0496109_0349249 3300048912 Bacteria 1397
672 Ga0496109_0453759 3300048912 Bacteria 1211
673 Ga0496110_0344415 3300048913 Bacteria 1358
674 Ga0496110_0494233 3300048913 Unclassified 1114
675 Ga0496110_1126468 3300048913 Unclassified 693
676 Ga0496112_0012633 3300048915 Bacteria 7764
677 Ga0496112_0021290 3300048915 Bacteria 6164
678 Ga0496112_0039769 3300048915 Bacteria 4597
679 Ga0496112_0064923 3300048915 Unclassified 3603
680 Ga0496112_0070705 3300048915 Unclassified 3449
681 Ga0496112_0147705 3300048915 Bacteria 2319
682 Ga0496112_0217167 3300048915 Bacteria 1868
683 Ga0496112_0645843 3300048915 Bacteria 988
684 Ga0496112_0772289 3300048915 Bacteria 886
685 Ga0496113_0354379 3300048916 Unclassified 1177
686 Ga0496114_0032743 3300048917 Bacteria 4281
687 Ga0496115_0013421 3300048918 Bacteria 6197
688 Ga0496115_0619743 3300048918 Unclassified 858
689 Ga0496115_0865740 3300048918 Unclassified 699
690 Ga0496115_1322355 3300048918 Unclassified 536
691 nmdc:mga0n895_56265_c1 3300050512 Unclassified 3874
692 nmdc:mga0rr50_310740_c1 3300050513 Bacteria 1320
693 nmdc:mga0rr50_755312_c1 3300050513 Bacteria 830
694 nmdc:mga08x19_186986_c1 3300050514 Bacteria 1416
695 Ga0495612_0375883 3300053078 Unclassified 644
696 Ga0495619_0171316 3300053085 Unclassified 1501
697 Ga0501084_0415304 3300054114 Bacteria 1137
698 Ga0466962_0215535 3300061719 Unclassified 939
699 Ga0070660_101060126
700 LJNas_1000091
701 Ga0058862_10022584
702 Ga0065715_10944818
703 Ga0070676_10342775
704 Ga0070683_100041890
705 Ga0070683_100055107
706 Ga0070683_100166343
707 Ga0070683_100421325
708 Ga0070683_101134526
709 Ga0070690_100089419
710 Ga0070690_100096733
711 Ga0070670_100274203
712 Ga0070677_10197649
713 Ga0068869_100013081
714 Ga0068869_100303751
715 Ga0068869_101598788
716 Ga0070680_100114432
717 Ga0070680_100123833
718 Ga0070680_101307334
719 Ga0070682_100304981
720 Ga0068868_100002034
721 Ga0068868_100002728
722 Ga0068868_100153053
723 Ga0068868_100253272
724 Ga0068868_100502822
725 Ga0070689_100061212
726 Ga0070691_10389028
727 Ga0070687_100051207
728 Ga0070661_100048115
729 Ga0070661_100126962
730 Ga0070661_100171795
731 Ga0070692_10802856
732 Ga0070668_100032039
733 Ga0070669_101733371
734 Ga0070675_101438080
735 Ga0070671_100082778
736 Ga0070674_100142743
737 Ga0070674_100563342
738 Ga0070688_100136020
739 Ga0070659_100017759
740 Ga0070659_100384395
741 Ga0070667_100027674
742 Ga0070709_10021013
743 Ga0070709_10032620
744 Ga0070709_10098978
745 Ga0070709_10123350
746 Ga0070709_10157464
747 Ga0070709_10689149
748 Ga0070709_11436913
749 Ga0070714_100112760
750 Ga0070714_100272936
751 Ga0070714_101037114
752 Ga0070714_101072905
753 Ga0070713_100013356
754 Ga0070713_100028081
755 Ga0070713_100054800
756 Ga0070713_100097782
757 Ga0070713_100149313
758 Ga0070713_100155762
759 Ga0070713_100387847
760 Ga0070713_100701449
761 Ga0070713_100902106
762 Ga0070713_101059829
763 Ga0070713_101363270
764 Ga0070713_101764982
765 Ga0070710_10005330
766 Ga0070710_10025421
767 Ga0070710_10063430
768 Ga0070710_10146232
769 Ga0070710_10181924
770 Ga0070710_10288755
771 Ga0070710_10805971
772 Ga0070711_100001830
773 Ga0070711_100096368
774 Ga0070711_100301176
775 Ga0070711_100566650
776 Ga0070694_100897163
777 Ga0070708_100076072
778 Ga0070708_100134356
779 Ga0070708_100612428
780 Ga0070678_100858172
781 Ga0070681_10000516
782 Ga0070681_10129495
783 Ga0070681_10177382
784 Ga0070681_10303830
785 Ga0070681_11092446
786 Ga0068867_100112974
787 Ga0070685_10374665
788 Ga0070706_100001385
789 Ga0070706_100493890
790 Ga0070706_100588610
791 Ga0070707_100029873
792 Ga0070707_100460253
793 Ga0070707_101167353
794 Ga0070707_101662294
795 Ga0070707_101906178
796 Ga0070707_101924214
797 Ga0070698_100095532
798 Ga0070699_100020676
799 Ga0070699_100070662
800 Ga0070679_100077835
801 Ga0070679_100177179
802 Ga0070679_100179887
803 Ga0070679_100251909
804 Ga0070679_100456689
805 Ga0070679_100937948
806 Ga0070679_101384700
807 Ga0070684_100023799
808 Ga0070684_100250601
809 Ga0070684_100268514
810 Ga0070697_100000280
811 Ga0070697_100077445
812 Ga0068853_100215969
813 Ga0068853_100233762
814 Ga0068853_100508081
815 Ga0068853_100509544
816 Ga0068853_100892483
817 Ga0068853_101122270
818 Ga0070686_100015760
819 Ga0070695_100118313
820 Ga0070696_100088832
821 Ga0070696_100509548
822 Ga0070696_101653486
823 Ga0070693_100044144
824 Ga0070693_100137784
825 Ga0070693_101138563
826 Ga0070665_100014347
827 Ga0070704_100718116
828 Ga0068855_100027325
829 Ga0068855_100035605
830 Ga0068855_100035798
831 Ga0068855_100047460
832 Ga0068855_100087385
833 Ga0070664_100000972
834 Ga0070664_100013788
835 Ga0070664_100137058
836 Ga0070664_100182628
837 Ga0070664_100318401
838 Ga0068857_100000335
839 Ga0068857_100019182
840 Ga0068857_100788941
841 Ga0068857_101329688
842 Ga0068857_101917281
843 Ga0068854_100003073
844 Ga0068854_100010276
845 Ga0068854_100020761
846 Ga0068854_100165129
847 Ga0068854_100527621
848 Ga0068856_100002426
849 Ga0068856_100005963
850 Ga0068856_100024175
851 Ga0068856_100044883
852 Ga0068856_100066238
853 Ga0068856_100081676
854 Ga0068856_100160862
855 Ga0068856_100744112
856 Ga0068856_100807791
857 Ga0070702_101777403
858 Ga0068852_100042898
859 Ga0068852_100062259
860 Ga0068852_100099595
861 Ga0068852_102051425
862 Ga0068859_100008421
863 Ga0068859_100015248
864 Ga0068864_100003998
865 Ga0068864_100204214
866 Ga0068864_100549922
867 Ga0068866_10028210
868 Ga0068866_10317213
869 Ga0068861_100342375
870 Ga0068851_10038848
871 Ga0068863_100011279
872 Ga0068863_100802871
873 Ga0068863_101163399
874 Ga0068858_100000404
875 Ga0068858_100022305
876 Ga0068858_100022664
877 Ga0068858_100103720
878 Ga0068860_100192651
879 Ga0068860_101315204
880 Ga0068862_100013092
881 Ga0068862_100609478
882 Ga0070717_10020255
883 Ga0070717_10102757
884 Ga0070717_10227267
885 Ga0070717_10237682
886 Ga0070717_10283545
887 Ga0070717_10309452
888 Ga0070717_10437062
889 Ga0070717_11162393
890 Ga0070715_10019936
891 Ga0070715_10036685
892 Ga0070715_10065909
893 Ga0070715_10195657
894 Ga0070715_10272486
895 Ga0070716_100000719
896 Ga0070716_100174921
897 Ga0070716_100337527
898 Ga0070716_100764457
899 Ga0070716_101321018
900 Ga0070712_100000188
901 Ga0070712_100002110
902 Ga0070712_100032463
903 Ga0070712_100100205
904 Ga0070712_100638822
905 Ga0070712_100728309
906 Ga0070712_100754853
907 Ga0070712_100988416
908 Ga0070712_101262539
909 Ga0070712_101271065
910 Ga0097621_100014867
911 Ga0097621_100035312
912 Ga0097621_100050913
913 Ga0097621_100058450
914 Ga0097621_100098010
915 Ga0097621_100581949
916 Ga0068871_100026130
917 Ga0068871_100048947
918 Ga0068871_100052347
919 Ga0068871_100055804
920 Ga0068871_100230547
921 Ga0075434_100040343
922 Ga0068865_100037406
923 Ga0068865_100042312
924 Ga0068865_100055090
925 Ga0075436_100208045
926 Ga0097620_100008421
927 Ga0097620_100015253
928 Ga0075435_100175674
929 Ga0075435_100212654
930 Ga0075435_101521949
931 Ga0075435_101639253
932 Ga0099795_10079371
933 Ga0105240_10041027
934 Ga0105240_10118482
935 Ga0105240_10173529
936 Ga0105240_10192360
937 Ga0105240_10228981
938 Ga0105240_10485544
939 Ga0105240_10560576
940 Ga0105245_10178532
941 Ga0105245_10658879
942 Ga0105245_10748058
943 Ga0105247_10061643
944 Ga0105247_10096097
945 Ga0105247_10295200
946 Ga0105247_10347377
947 Ga0105243_10621312
948 Ga0105241_10004558
949 Ga0105241_10008879
950 Ga0105241_10014156
951 Ga0105241_10041998
952 Ga0105241_10283768
953 Ga0105241_10311687
954 Ga0105241_10413206
955 Ga0105241_11110069
956 Ga0105241_11614339
957 Ga0105242_10112040
958 Ga0105242_10309510
959 Ga0105242_10632175
960 Ga0105242_10638292
961 Ga0105248_10011433
962 Ga0105248_10038196
963 Ga0105248_10083865
964 Ga0105248_11189077
965 Ga0105237_10013626
966 Ga0105237_10019981
967 Ga0105237_10129661
968 Ga0105237_10179233
969 Ga0105237_10392500
970 Ga0105237_10403347
971 Ga0105237_10469160
972 Ga0105237_11172531
973 Ga0105237_12512891
974 Ga0105238_10000214
975 Ga0105238_10058700
976 Ga0105238_11284079
977 Ga0105238_11306186
978 Ga0105249_10128144
979 Ga0099796_10070296
980 Ga0099796_10154955
981 Ga0099796_10400096
982 Ga0105239_10418471
983 Ga0105239_10747253
984 Ga0105246_10031095
985 Ga0105246_10073637
986 Ga0157373_10002307
987 Ga0157373_10050500
988 Ga0157373_10341583
989 Ga0157371_10145618
990 Ga0157371_10320680
991 Ga0157371_10522301
992 Ga0157370_10042321
993 Ga0157370_10062571
994 Ga0157370_10823399
995 Ga0157370_11581347
996 Ga0157369_10017191
997 Ga0157369_10024898
998 Ga0157369_10030146
999 Ga0157369_10030474
1000 Ga0157369_10055341
1001 Ga0157369_10169254
1002 Ga0157374_10002353
1003 Ga0157374_10007704
1004 Ga0157374_10020082
1005 Ga0157374_10020608
1006 Ga0157374_10112592
1007 Ga0157374_10136470
1008 Ga0157374_10493097
1009 Ga0157374_10533244
1010 Ga0157374_11508064
1011 Ga0157378_10000349
1012 Ga0157378_10012660
1013 Ga0157378_10019523
1014 Ga0157378_10110608
1015 Ga0157378_10223860
1016 Ga0157378_10284258
1017 Ga0157378_10578669
1018 Ga0163162_10001352
1019 Ga0163162_10076008
1020 Ga0157372_10009551
1021 Ga0157372_10016466
1022 Ga0157372_10021505
1023 Ga0157372_10198126
1024 Ga0157372_10340856
1025 Ga0157372_10449539
1026 Ga0157372_12244693
1027 Ga0157375_10073391
1028 Ga0163163_10137406
1029 Ga0163163_10308668
1030 Ga0163163_10744433
1031 Ga0182008_10166695
1032 Ga0157377_10230735
1033 Ga0157379_10014470
1034 Ga0157376_10004658
1035 Ga0157376_10029979
1036 Ga0157376_10129620
1037 Ga0157376_10156827
1038 Ga0157376_10606817
1039 Ga0157376_10917595
1040 Ga0163161_10454448
1041 Ga0206350_10799557
1042 Ga0224569_100417
1043 Ga0224569_101519
1044 Ga0224572_1043589
1045 Ga0228598_1000610
1046 Ga0228598_1017198
1047 Ga0207656_10591974
1048 Ga0207692_10038564
1049 Ga0207692_10051885
1050 Ga0207692_10075763
1051 Ga0207692_10232322
1052 Ga0207692_10287795
1053 Ga0207692_10553051
1054 Ga0207692_10808708
1055 Ga0207642_10251058
1056 Ga0207642_10353709
1057 Ga0207710_10127567
1058 Ga0207647_10056919
1059 Ga0207685_10010487
1060 Ga0207685_10121840
1061 Ga0207685_10143577
1062 Ga0207685_10265566
1063 Ga0207685_10362993
1064 Ga0207699_10005690
1065 Ga0207699_10061308
1066 Ga0207699_10139396
1067 Ga0207699_10289543
1068 Ga0207699_10347228
1069 Ga0207699_10491028
1070 Ga0207645_10011239
1071 Ga0207684_10005360
1072 Ga0207684_10211737
1073 Ga0207654_10003381
1074 Ga0207654_10005928
1075 Ga0207654_10072931
1076 Ga0207654_10108992
1077 Ga0207654_10217127
1078 Ga0207654_10246731
1079 Ga0207654_10386426
1080 Ga0207654_10839063
1081 Ga0207707_10004272
1082 Ga0207707_10014133
1083 Ga0207707_10104125
1084 Ga0207707_10512052
1085 Ga0207707_10873381
1086 Ga0207695_10006382
1087 Ga0207695_10039220
1088 Ga0207695_10059977
1089 Ga0207695_10220128
1090 Ga0207695_10259566
1091 Ga0207671_10011713
1092 Ga0207671_10138997
1093 Ga0207671_10299163
1094 Ga0207693_10000524
1095 Ga0207693_10001919
1096 Ga0207693_10008223
1097 Ga0207693_10013982
1098 Ga0207693_10025087
1099 Ga0207693_10058181
1100 Ga0207663_10002678
1101 Ga0207663_10034834
1102 Ga0207663_10072437
1103 Ga0207663_10172934
1104 Ga0207663_10300115
1105 Ga0207663_10474092
1106 Ga0207663_10779602
1107 Ga0207660_10164830
1108 Ga0207660_10647908
1109 Ga0207660_11006774
1110 Ga0207662_10068932
1111 Ga0207657_10004544
1112 Ga0207657_10511540
1113 Ga0207649_10112564
1114 Ga0207649_10494298
1115 Ga0207649_10735469
1116 Ga0207652_10008758
1117 Ga0207652_10039789
1118 Ga0207652_10236677
1119 Ga0207652_10601787
1120 Ga0207652_11199600
1121 Ga0207646_10071842
1122 Ga0207646_10338275
1123 Ga0207646_10382507
1124 Ga0207681_10806896
1125 Ga0207694_10002173
1126 Ga0207694_10015779
1127 Ga0207694_10612603
1128 Ga0207659_11260092
1129 Ga0207687_10145120
1130 Ga0207687_10739627
1131 Ga0207700_10001374
1132 Ga0207700_10003931
1133 Ga0207700_10040604
1134 Ga0207700_10053055
1135 Ga0207700_10076042
1136 Ga0207700_10103133
1137 Ga0207700_10416726
1138 Ga0207700_10622073
1139 Ga0207700_10908109
1140 Ga0207700_11491342
1141 Ga0207664_10222907
1142 Ga0207664_10233707
1143 Ga0207664_10465584
1144 Ga0207644_10078525
1145 Ga0207644_10549978
1146 Ga0207690_10025625
1147 Ga0207690_10114342
1148 Ga0207706_10003412
1149 Ga0207686_10042114
1150 Ga0207686_10095160
1151 Ga0207686_10807037
1152 Ga0207670_10297659
1153 Ga0207669_10233361
1154 Ga0207704_10024083
1155 Ga0207704_10038752
1156 Ga0207704_10468247
1157 Ga0207665_10000107
1158 Ga0207665_10002111
1159 Ga0207665_10011949
1160 Ga0207665_10073929
1161 Ga0207665_10104733
1162 Ga0207665_10116511
1163 Ga0207665_10366422
1164 Ga0207665_10439160
1165 Ga0207665_10935426
1166 Ga0207665_11251009
1167 Ga0207691_10632240
1168 Ga0207711_10054490
1169 Ga0207711_10105119
1170 Ga0207711_10283757
1171 Ga0207711_10648271
1172 Ga0207689_10020706
1173 Ga0207689_10363656
1174 Ga0207661_10241521
1175 Ga0207661_10382239
1176 Ga0207661_10408868
1177 Ga0207661_10614299
1178 Ga0207679_10022824
1179 Ga0207679_10065896
1180 Ga0207667_10002400
1181 Ga0207667_10016948
1182 Ga0207667_10019010
1183 Ga0207667_10029499
1184 Ga0207667_10090526
1185 Ga0207712_10030782
1186 Ga0207668_10014196
1187 Ga0207640_10000843
1188 Ga0207640_10166240
1189 Ga0207640_10191715
1190 Ga0207640_10438113
1191 Ga0207640_10653993
1192 Ga0207658_10013917
1193 Ga0207677_10001146
1194 Ga0207677_10035986
1195 Ga0207677_10225514
1196 Ga0207677_10397501
1197 Ga0207703_10004390
1198 Ga0207703_10036228
1199 Ga0207703_10105947
1200 Ga0207639_10072810
1201 Ga0207639_10098468
1202 Ga0207639_10223605
1203 Ga0207639_10607341
1204 Ga0207639_10760155
1205 Ga0207678_10001295
1206 Ga0207702_10001116
1207 Ga0207702_10010710
1208 Ga0207702_10033937
1209 Ga0207702_10054228
1210 Ga0207702_10070660
1211 Ga0207702_10138022
1212 Ga0207702_10187958
1213 Ga0207702_10758828
1214 Ga0207641_10078848
1215 Ga0207641_10080284
1216 Ga0207641_10186602
1217 Ga0207641_10636859
1218 Ga0207648_10014004
1219 Ga0207648_10034800
1220 Ga0207676_10009475
1221 Ga0207676_10276247
1222 Ga0207676_11394991
1223 Ga0207674_10000269
1224 Ga0207674_10184164
1225 Ga0207674_10213170
1226 Ga0207674_11363048
1227 Ga0207675_100106135
1228 Ga0207683_10195001
1229 Ga0207698_10280822
1230 Ga0207698_11481623
1231 Ga0207698_11712564
1232 Ga0265356_1007564
1233 Ga0268266_10249239
1234 Ga0268266_10389584
1235 Ga0268265_10270770
1236 Ga0268265_10557891
1237 Ga0268264_10142842
1238 Ga0265338_10350962
1239 Ga0265762_1000946
1240 Ga0265762_1009970
1241 Ga0265762_1011930
1242 Ga0265760_10001451
1243 Ga0265760_10049819
1244 Ga0265760_10066660
1245 Ga0265760_10191260
1246 Ga0265330_10004603
1247 Ga0265325_10081869
1248 Ga0265340_10038300
1249 Ga0265339_10137655
1250 Ga0265316_10005636
1251 Ga0265316_10069349
1252 Ga0265314_10000348
1253 Ga0265314_10080770
1254 Ga0265342_10105979
1255 Ga0316212_1010514
1256 Ga0373930_0002850
1257 Ga0373959_0066820
1258 Ga0373926_0120020
1259 Ga0373926_0150539
1260 Ga0373926_0277610
1261 Ga0373928_0177448
1262 Ga0373929_0101812
1263 Ga0373929_0195494
1264 Ga0373934_0031541
1265 Ga0373940_0012610
1266 Ga0373952_0061248
1267 Ga0373923_0687016
1268 Ga0373932_0031152
1269 Ga0373932_0336590
1270 Ga0373941_0075026
1271 Ga0373943_0153197
1272 Ga0373943_0458486
1273 Ga0373955_0105875
1274 Ga0373942_0095494
1275 Ga0373942_0287944
1276 Ga0373961_0290109
1277 Ga0373924_0055565
1278 Ga0373931_0070609
1279 Ga0373931_0165397
1280 Ga0373931_0191059
1281 Ga0373931_0359094
1282 Ga0373935_0087992
1283 Ga0373927_0034111
1284 Ga0373933_0210717
1285 Ga0373947_0312167
1286 Ga0373947_0957930
1287 Ga0373937_0049001
1288 Ga0373937_0163202
1289 Ga0373937_0462315
1290 Ga0373925_0005643
1291 Ga0373925_0024897
1292 Ga0373925_0576270
1293 Ga0373925_0596540
1294 Ga0436364_0514138
1295 Ga0436364_0801393
1296 Ga0242420_008913
1297 Ga0436360_0070604
1298 Ga0436360_0755550
1299 Ga0436363_0207954
1300 Ga0436363_1196749
1301 Ga0436362_0725186
1302 Ga0451839_0440554
1303 Ga0466966_0576756
1304 Ga0466961_0303856
1305 Ga0466963_0013420
1306 Ga0466963_0069414
1307 Ga0466964_0040768
1308 Ga0466971_0026254
1309 Ga0466968_0659183
1310 Ga0466957_0340163
1311 Ga0466959_0353015
1312 Ga0451576_0725525
1313 Ga0451576_1026087
1314 Ga0466958_0081695
1315 Ga0466967_0008226
1316 Ga0466967_0103166
1317 Ga0466967_0907308
1318 Ga0495651_0148262
1319 Ga0495580_0000750
1320 Ga0495580_0018203
1321 Ga0495580_0079331
1322 Ga0495580_0090086
1323 Ga0495580_0112389
1324 Ga0495580_0136133
1325 Ga0495580_0189941
1326 Ga0495580_0641467
1327 Ga0495582_0100397
1328 Ga0495639_0044109
1329 Ga0495630_0107809
1330 Ga0495645_0748140
1331 Ga0495667_0264468
1332 Ga0495635_0028063
1333 Ga0495657_0462504
1334 Ga0495624_0534024
1335 Ga0495604_0287285
1336 Ga0495604_0313049
1337 Ga0495674_0205679
1338 Ga0495675_0083980
1339 Ga0495684_0735118
1340 Ga0495602_0338877
1341 Ga0495602_0377638
1342 Ga0495602_0976022
1343 Ga0496100_0003992
1344 Ga0496101_0060213
1345 Ga0496101_0069315
1346 Ga0496101_0420861
1347 Ga0496102_0020175
1348 Ga0496102_0052591
1349 Ga0496102_0080446
1350 Ga0496102_0385556
1351 Ga0496102_0437698
1352 Ga0496103_0001274
1353 Ga0496103_0038125
1354 Ga0496104_0029097
1355 Ga0496104_0030365
1356 Ga0496104_0038796
1357 Ga0496104_0159649
1358 Ga0496104_0182359
1359 Ga0496104_0192756
1360 Ga0496104_0197752
1361 Ga0496105_0071892
1362 Ga0496106_0097367
1363 Ga0496107_0066810
1364 Ga0496107_0068683
1365 Ga0496107_0589129
1366 Ga0496108_0126818
1367 Ga0496108_0144691
1368 Ga0496109_0067656
1369 Ga0496109_0349249
1370 Ga0496109_0453759
1371 Ga0496110_0344415
1372 Ga0496110_0494233
1373 Ga0496110_1126468
1374 Ga0496112_0012633
1375 Ga0496112_0021290
1376 Ga0496112_0039769
1377 Ga0496112_0064923
1378 Ga0496112_0070705
1379 Ga0496112_0147705
1380 Ga0496112_0217167
1381 Ga0496112_0645843
1382 Ga0496112_0772289
1383 Ga0496113_0354379
1384 Ga0496114_0032743
1385 Ga0496115_0013421
1386 Ga0496115_0619743
1387 Ga0496115_0865740
1388 Ga0496115_1322355
1389 nmdc:mga0n895_56265_c1
1390 nmdc:mga0rr50_310740_c1
1391 nmdc:mga0rr50_755312_c1
1392 nmdc:mga08x19_186986_c1
1393 Ga0495612_0375883
1394 Ga0495619_0171316
1395 Ga0501084_0415304
1396 Ga0466962_0215535

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00376

MerR

MerR family regulatory protein

54

91

0.98

PF13411

MerR_1

MerR HTH family regulatory protein

53

123

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5i41-assembly1.cif.gz_B structure of the apo raca dna binding domain 0.9086 23 86
7tea-assembly2.cif.gz_C crystal structure of s. aureus glnr-dna complex 0.9036 21 92
4r4e-assembly1.cif.gz_B structure of glnr-dna complex 0.8958 21 95
5c8d-assembly2.cif.gz_F crystal structure of full-length thermus thermophilus carh bound to adenosylcobalamin (dark state) 0.8719 23 94
5c8d-assembly2.cif.gz_E crystal structure of full-length thermus thermophilus carh bound to adenosylcobalamin (dark state) 0.8604 21 93
ID Description Score Start End Superfamily
5i41B00 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.9086 23 86 1.10.1660.10
af_O06302_4_79_1.10.1660.10 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.8981 23 90 1.10.1660.10
af_P9WME7_10_96_1.10.1660.10 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.8871 24 93 1.10.1660.10
af_P33358_1_73_1.10.1660.10 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.8859 21 93 1.10.1660.10
af_P33358_1_73_1.10.1660.10 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.8641 21 93 1.10.1660.10
ID Description Score Start End GO Terms
AF-A0A7Y2ZJ98-F1-model_v4 MerR family transcriptional regulator 0.9766 18 90 GO:0003677
GO:0003700
AF-A0A7C6E2P5-F1-model_v4 MerR family transcriptional regulator 0.971 15 95 GO:0003677
GO:0003700
AF-A0A521Z2B7-F1-model_v4 MerR family transcriptional regulator 0.9696 17 94 GO:0003677
GO:0003700
AF-A0A3N5J0M3-F1-model_v4 MerR family transcriptional regulator 0.9669 14 92 GO:0003677
GO:0006355
AF-A0A6N2CYE6-F1-model_v4 MerR family transcriptional regulator 0.9667 16 98 GO:0003677
GO:0003700

Map