F475937

General Info

Members Datasets Scaffolds Average Seq Length
698 269 1396 51

Family's Representative Sequence

Representative Sequence 3300005331|Ga0070670_101894477|Ga0070670_1018944771
Length 60
Sequence MTAGHFIFIPSILLIGIVIGWVLGSRAARDAFAAEMKRREEKAARRASKAEGLEGGKAGR

Samples

Sample ID Description Type Environment
1 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
2 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
71 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
72 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
86 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
160 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
164 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
165 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
166 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
167 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
168 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
169 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
170 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
171 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
172 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
173 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
174 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
175 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
176 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
177 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
178 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
179 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
180 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
181 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
182 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
183 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
184 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
185 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
186 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
187 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
188 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
189 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
190 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
191 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
192 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
193 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
194 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
195 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
196 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
197 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
198 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
199 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
200 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
201 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
202 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
203 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
204 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
205 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
206 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
207 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
208 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
209 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
210 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
211 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
212 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
213 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
214 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
215 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
216 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
217 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
218 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
219 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
220 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
221 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
222 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
223 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
224 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
225 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
226 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
227 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
228 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
229 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
230 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
241 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
242 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
243 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
244 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
245 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
246 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
247 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
248 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
249 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
250 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
251 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
252 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
253 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
255 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
256 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
257 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
258 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
259 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
260 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
261 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
262 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
263 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
264 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
265 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
266 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
267 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
268 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
269 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.43
Nodule 0
Rhizoplane 5.16
Rhizosphere 94.41
Stem 0
Stem Tuber 0
Unclassified 18.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070670_101894477 3300005331 Bacteria 549
2 JGI24749J21850_1062450 3300002076 Unclassified 568
3 Ga0065714_10130822 3300005288 Bacteria 1252
4 Ga0065704_10802552 3300005289 Bacteria 524
5 Ga0065712_10000253 3300005290 Bacteria 29630
6 Ga0065715_10000496 3300005293 Bacteria 10812
7 Ga0065715_10863102 3300005293 Bacteria 587
8 Ga0065707_10134382 3300005295 Bacteria 1866
9 Ga0065707_10911200 3300005295 Bacteria 563
10 Ga0070658_10023565 3300005327 Bacteria 4939
11 Ga0070676_10085717 3300005328 Bacteria 1920
12 Ga0070676_10186841 3300005328 Bacteria 1350
13 Ga0070683_101116881 3300005329 Unclassified 757
14 Ga0070690_100071568 3300005330 Bacteria 2253
15 Ga0070690_100075197 3300005330 Bacteria 2202
16 Ga0070690_101022232 3300005330 Bacteria 652
17 Ga0070690_101032298 3300005330 Bacteria 649
18 Ga0070670_100002728 3300005331 Bacteria 14590
19 Ga0070670_100395999 3300005331 Bacteria 1219
20 Ga0070670_100482641 3300005331 Bacteria 1101
21 Ga0068869_100333848 3300005334 Bacteria 1232
22 Ga0068869_101483581 3300005334 Archaea 602
23 Ga0070666_10099024 3300005335 Unclassified 2008
24 Ga0070666_10142130 3300005335 Bacteria 1672
25 Ga0070666_10657176 3300005335 Bacteria 767
26 Ga0070666_10753378 3300005335 Bacteria 716
27 Ga0070680_100508243 3300005336 Unclassified 1031
28 Ga0070680_100528533 3300005336 Bacteria 1010
29 Ga0068868_100209330 3300005338 Bacteria 1629
30 Ga0068868_100466319 3300005338 Bacteria 1101
31 Ga0068868_101606013 3300005338 Bacteria 611
32 Ga0068868_101644338 3300005338 Bacteria 604
33 Ga0068868_101984163 3300005338 Bacteria 552
34 Ga0070660_100093951 3300005339 Bacteria 2369
35 Ga0070660_100413578 3300005339 Bacteria 1116
36 Ga0070689_100180730 3300005340 Bacteria 1713
37 Ga0070689_100315181 3300005340 Bacteria 1305
38 Ga0070689_100409973 3300005340 Bacteria 1147
39 Ga0070689_100834752 3300005340 Unclassified 812
40 Ga0070687_100061913 3300005343 Bacteria 1979
41 Ga0070687_100150322 3300005343 Bacteria 1366
42 Ga0070661_101128045 3300005344 Bacteria 654
43 Ga0070668_100891064 3300005347 Bacteria 795
44 Ga0070668_101248812 3300005347 Unclassified 674
45 Ga0070669_100243178 3300005353 Bacteria 1430
46 Ga0070669_100347606 3300005353 Bacteria 1203
47 Ga0070669_100616833 3300005353 Bacteria 910
48 Ga0070675_100029710 3300005354 Bacteria 4410
49 Ga0070675_100066220 3300005354 Bacteria 2987
50 Ga0070675_100615055 3300005354 Bacteria 986
51 Ga0070675_101531555 3300005354 Bacteria 615
52 Ga0070671_100114636 3300005355 Bacteria 2265
53 Ga0070671_100569981 3300005355 Unclassified 977
54 Ga0070671_101777829 3300005355 Unclassified 548
55 Ga0070671_101884282 3300005355 Bacteria 532
56 Ga0070674_100394366 3300005356 Unclassified 1129
57 Ga0070674_100426135 3300005356 Bacteria 1090
58 Ga0070674_100860618 3300005356 Bacteria 787
59 Ga0070674_102163219 3300005356 Bacteria 508
60 Ga0070673_100055323 3300005364 Bacteria 3126
61 Ga0070673_100069389 3300005364 Bacteria 2824
62 Ga0070673_100444371 3300005364 Bacteria 1166
63 Ga0070673_100495480 3300005364 Bacteria 1104
64 Ga0070673_102000910 3300005364 Bacteria 550
65 Ga0070673_102151860 3300005364 Bacteria 530
66 Ga0070688_100009655 3300005365 Bacteria 5291
67 Ga0070688_100181877 3300005365 Bacteria 1459
68 Ga0070688_100597816 3300005365 Bacteria 844
69 Ga0070688_100910000 3300005365 Bacteria 694
70 Ga0070659_100692031 3300005366 Archaea 881
71 Ga0070659_101251644 3300005366 Bacteria 657
72 Ga0070667_100052134 3300005367 Bacteria 3451
73 Ga0070667_100565535 3300005367 Bacteria 1046
74 Ga0070667_101784923 3300005367 Bacteria 579
75 Ga0070667_102351946 3300005367 Bacteria 502
76 Ga0070701_10029824 3300005438 Bacteria 2694
77 Ga0070701_10877239 3300005438 Bacteria 618
78 Ga0070705_100927882 3300005440 Bacteria 702
79 Ga0070700_100080470 3300005441 Bacteria 2102
80 Ga0070700_100701518 3300005441 Bacteria 805
81 Ga0070694_100045671 3300005444 Bacteria 2937
82 Ga0070694_100052582 3300005444 Bacteria 2754
83 Ga0070708_100441899 3300005445 Bacteria 1227
84 Ga0070708_100555384 3300005445 Bacteria 1083
85 Ga0070708_101618552 3300005445 Bacteria 603
86 Ga0070663_100679964 3300005455 Bacteria 873
87 Ga0070663_100959024 3300005455 Unclassified 742
88 Ga0070678_100384810 3300005456 Unclassified 1214
89 Ga0070678_100432426 3300005456 Bacteria 1149
90 Ga0070678_100730797 3300005456 Bacteria 894
91 Ga0070678_100842009 3300005456 Unclassified 835
92 Ga0070678_102228573 3300005456 Unclassified 520
93 Ga0070662_100096711 3300005457 Bacteria 2228
94 Ga0070662_100163399 3300005457 Bacteria 1743
95 Ga0070662_100785648 3300005457 Bacteria 809
96 Ga0070662_101196218 3300005457 Bacteria 653
97 Ga0070681_10785500 3300005458 Bacteria 869
98 Ga0070681_11449208 3300005458 Unclassified 611
99 Ga0068867_100102706 3300005459 Bacteria 2185
100 Ga0068867_100741131 3300005459 Bacteria 871
101 Ga0068867_100824781 3300005459 Bacteria 829
102 Ga0068867_101262307 3300005459 Bacteria 680
103 Ga0070685_10003257 3300005466 Bacteria 8250
104 Ga0070685_10652248 3300005466 Bacteria 763
105 Ga0070706_100456547 3300005467 Unclassified 1189
106 Ga0070707_100944823 3300005468 Bacteria 827
107 Ga0070707_101086535 3300005468 Bacteria 766
108 Ga0070698_100213092 3300005471 Unclassified 1866
109 Ga0070698_101056863 3300005471 Unclassified 760
110 Ga0070698_101170545 3300005471 Bacteria 718
111 Ga0070699_100337005 3300005518 Unclassified 1357
112 Ga0070699_100737746 3300005518 Bacteria 900
113 Ga0070679_100004328 3300005530 Bacteria 13110
114 Ga0070679_100600625 3300005530 Bacteria 1044
115 Ga0070684_101639104 3300005535 Bacteria 607
116 Ga0070684_101997247 3300005535 Bacteria 547
117 Ga0068853_100312890 3300005539 Bacteria 1454
118 Ga0068853_100506455 3300005539 Bacteria 1140
119 Ga0070672_100015831 3300005543 Bacteria 5384
120 Ga0070672_100283069 3300005543 Bacteria 1402
121 Ga0070672_100437000 3300005543 Bacteria 1126
122 Ga0070686_100416169 3300005544 Bacteria 1026
123 Ga0070686_101181392 3300005544 Bacteria 635
124 Ga0070686_101609173 3300005544 Bacteria 550
125 Ga0070686_101936320 3300005544 Unclassified 503
126 Ga0070695_100015039 3300005545 Bacteria 4670
127 Ga0070695_100158409 3300005545 Bacteria 1587
128 Ga0070695_100830520 3300005545 Bacteria 742
129 Ga0070696_100091601 3300005546 Bacteria 2165
130 Ga0070696_101036326 3300005546 Bacteria 687
131 Ga0070693_100568665 3300005547 Bacteria 814
132 Ga0070693_101096689 3300005547 Unclassified 607
133 Ga0070665_100004096 3300005548 Bacteria 15330
134 Ga0070665_100010345 3300005548 Bacteria 9437
135 Ga0070665_100011519 3300005548 Bacteria 8942
136 Ga0070665_100012467 3300005548 Bacteria 8570
137 Ga0070704_100102145 3300005549 Bacteria 2163
138 Ga0070704_100125170 3300005549 Bacteria 1982
139 Ga0070704_100440554 3300005549 Bacteria 1120
140 Ga0070704_100614760 3300005549 Unclassified 956
141 Ga0070704_101877635 3300005549 Bacteria 555
142 Ga0068855_100018161 3300005563 Bacteria 8450
143 Ga0068855_100614376 3300005563 Bacteria 1171
144 Ga0070664_100303160 3300005564 Bacteria 1444
145 Ga0070664_100703162 3300005564 Bacteria 942
146 Ga0068854_100492599 3300005578 Bacteria 1031
147 Ga0068854_101015832 3300005578 Bacteria 735
148 Ga0068854_101626021 3300005578 Bacteria 589
149 Ga0068856_101395000 3300005614 Unclassified 715
150 Ga0070702_100193550 3300005615 Bacteria 1340
151 Ga0070702_100423813 3300005615 Bacteria 958
152 Ga0070702_100461150 3300005615 Bacteria 924
153 Ga0068852_101711981 3300005616 Bacteria 651
154 Ga0068852_102161279 3300005616 Unclassified 578
155 Ga0068859_100301490 3300005617 Bacteria 1696
156 Ga0068859_100776745 3300005617 Bacteria 1046
157 Ga0068859_101477914 3300005617 Bacteria 750
158 Ga0068859_101573909 3300005617 Unclassified 726
159 Ga0068864_100016872 3300005618 Bacteria 6086
160 Ga0068864_100020109 3300005618 Bacteria 5584
161 Ga0068864_100478689 3300005618 Bacteria 1195
162 Ga0068864_102065284 3300005618 Bacteria 576
163 Ga0068866_10043658 3300005718 Bacteria 2238
164 Ga0068866_10384381 3300005718 Unclassified 901
165 Ga0068866_10466316 3300005718 Bacteria 829
166 Ga0068866_10577208 3300005718 Bacteria 756
167 Ga0068861_100170011 3300005719 Bacteria 1806
168 Ga0068851_10429039 3300005834 Bacteria 782
169 Ga0068870_10956111 3300005840 Bacteria 608
170 Ga0068863_100190092 3300005841 Bacteria 1973
171 Ga0068863_100385025 3300005841 Bacteria 1370
172 Ga0068863_100410888 3300005841 Bacteria 1325
173 Ga0068863_101353489 3300005841 Bacteria 719
174 Ga0068858_100001428 3300005842 Bacteria 24559
175 Ga0068858_100014942 3300005842 Bacteria 7305
176 Ga0068858_100073151 3300005842 Bacteria 3182
177 Ga0068858_100093951 3300005842 Bacteria 2792
178 Ga0068858_100137424 3300005842 Bacteria 2294
179 Ga0068858_100164258 3300005842 Bacteria 2092
180 Ga0068858_100299705 3300005842 Bacteria 1533
181 Ga0068858_100575905 3300005842 Bacteria 1091
182 Ga0068858_101107728 3300005842 Unclassified 777
183 Ga0068860_100263048 3300005843 Bacteria 1682
184 Ga0068860_100409954 3300005843 Bacteria 1342
185 Ga0068860_100442348 3300005843 Unclassified 1291
186 Ga0068860_100554444 3300005843 Bacteria 1152
187 Ga0068860_100822581 3300005843 Bacteria 943
188 Ga0068860_101057353 3300005843 Bacteria 830
189 Ga0068862_100130029 3300005844 Bacteria 2226
190 Ga0068862_100292194 3300005844 Bacteria 1497
191 Ga0068862_100823725 3300005844 Bacteria 908
192 Ga0068862_101000039 3300005844 Unclassified 827
193 Ga0081455_10315174 3300005937 Unclassified 1116
194 Ga0081455_10699235 3300005937 Bacteria 646
195 Ga0081539_10008987 3300005985 Bacteria 8496
196 Ga0070715_10058698 3300006163 Bacteria 1681
197 Ga0070715_11071312 3300006163 Bacteria 506
198 Ga0070716_100101878 3300006173 Bacteria 1762
199 Ga0097621_100010914 3300006237 Bacteria 6669
200 Ga0097621_100029036 3300006237 Bacteria 4365
201 Ga0097621_100223262 3300006237 Unclassified 1642
202 Ga0097621_100228686 3300006237 Bacteria 1623
203 Ga0097621_100323720 3300006237 Bacteria 1366
204 Ga0097621_100493752 3300006237 Bacteria 1108
205 Ga0097621_100711216 3300006237 Bacteria 925
206 Ga0097621_100889386 3300006237 Bacteria 829
207 Ga0097621_102236128 3300006237 Bacteria 523
208 Ga0075370_10579795 3300006353 Bacteria 679
209 Ga0068871_100001956 3300006358 Bacteria 13947
210 Ga0068871_100016255 3300006358 Bacteria 5598
211 Ga0068871_100092215 3300006358 Bacteria 2526
212 Ga0068871_100136395 3300006358 Bacteria 2084
213 Ga0068871_100166757 3300006358 Bacteria 1886
214 Ga0068871_100378410 3300006358 Unclassified 1257
215 Ga0068871_100694857 3300006358 Bacteria 931
216 Ga0068871_101134035 3300006358 Bacteria 732
217 Ga0068871_101640419 3300006358 Bacteria 609
218 Ga0075428_100075948 3300006844 Bacteria 3668
219 Ga0075428_100175177 3300006844 Bacteria 2323
220 Ga0075428_100372803 3300006844 Bacteria 1530
221 Ga0075431_100733200 3300006847 Bacteria 964
222 Ga0075431_101863103 3300006847 Unclassified 557
223 Ga0075433_10013088 3300006852 Bacteria 6731
224 Ga0075433_10029138 3300006852 Bacteria 4701
225 Ga0075433_10093401 3300006852 Bacteria 2662
226 Ga0075433_11192425 3300006852 Bacteria 661
227 Ga0075433_11640668 3300006852 Unclassified 554
228 Ga0075434_100011242 3300006871 Bacteria 8430
229 Ga0075434_100044251 3300006871 Bacteria 4417
230 Ga0075434_100046396 3300006871 Bacteria 4312
231 Ga0075434_100367349 3300006871 Bacteria 1460
232 Ga0075434_100581231 3300006871 Unclassified 1139
233 Ga0075434_102517052 3300006871 Bacteria 516
234 Ga0075429_100155329 3300006880 Bacteria 2003
235 Ga0075429_100434100 3300006880 Bacteria 1151
236 Ga0068865_100010622 3300006881 Bacteria 5737
237 Ga0068865_100421554 3300006881 Unclassified 1097
238 Ga0068865_100599890 3300006881 Unclassified 930
239 Ga0068865_101170057 3300006881 Bacteria 680
240 Ga0075436_100102961 3300006914 Bacteria 1989
241 Ga0075436_101288058 3300006914 Unclassified 553
242 Ga0097620_100301504 3300006931 Bacteria 1696
243 Ga0097620_100776784 3300006931 Bacteria 1046
244 Ga0097620_101477780 3300006931 Bacteria 750
245 Ga0097620_101573656 3300006931 Unclassified 726
246 Ga0075435_100001910 3300007076 Bacteria 13570
247 Ga0075435_100011981 3300007076 Bacteria 6405
248 Ga0075435_100378855 3300007076 Bacteria 1215
249 Ga0075435_100677988 3300007076 Unclassified 895
250 Ga0075435_100907833 3300007076 Bacteria 768
251 Ga0075435_101378191 3300007076 Unclassified 618
252 Ga0105251_10510301 3300009011 Unclassified 563
253 Ga0105240_11057297 3300009093 Bacteria 866
254 Ga0111539_10003450 3300009094 Bacteria 20823
255 Ga0111539_10482428 3300009094 Bacteria 1444
256 Ga0111539_10712132 3300009094 Unclassified 1169
257 Ga0111539_10930955 3300009094 Bacteria 1011
258 Ga0111539_11200200 3300009094 Bacteria 881
259 Ga0111539_12011462 3300009094 Bacteria 670
260 Ga0111539_12255159 3300009094 Bacteria 632
261 Ga0111539_13353384 3300009094 Bacteria 515
262 Ga0105245_10003782 3300009098 Bacteria 13463
263 Ga0105245_10020965 3300009098 Bacteria 5730
264 Ga0105245_10759966 3300009098 Bacteria 1006
265 Ga0105245_13230890 3300009098 Unclassified 505
266 Ga0105247_10024393 3300009101 Bacteria 3644
267 Ga0105247_10054452 3300009101 Bacteria 2469
268 Ga0105247_10064380 3300009101 Bacteria 2277
269 Ga0105247_11052141 3300009101 Bacteria 639
270 Ga0114129_10011319 3300009147 Bacteria 12708
271 Ga0114129_10012599 3300009147 Bacteria 12038
272 Ga0114129_10189950 3300009147 Bacteria 2790
273 Ga0114129_10275664 3300009147 Bacteria 2249
274 Ga0114129_10318282 3300009147 Bacteria 2069
275 Ga0114129_10401588 3300009147 Bacteria 1806
276 Ga0114129_11329588 3300009147 Bacteria 889
277 Ga0114129_11961516 3300009147 Bacteria 709
278 Ga0114129_12971425 3300009147 Unclassified 558
279 Ga0105243_10412820 3300009148 Bacteria 1257
280 Ga0105243_11351738 3300009148 Unclassified 731
281 Ga0105243_11519333 3300009148 Unclassified 694
282 Ga0105243_11995396 3300009148 Unclassified 614
283 Ga0105243_12667328 3300009148 Bacteria 540
284 Ga0105243_13100528 3300009148 Unclassified 503
285 Ga0105241_10817752 3300009174 Unclassified 859
286 Ga0105242_10004014 3300009176 Bacteria 11443
287 Ga0105242_10046496 3300009176 Bacteria 3521
288 Ga0105242_10180812 3300009176 Bacteria 1860
289 Ga0105242_10400289 3300009176 Unclassified 1281
290 Ga0105242_11102775 3300009176 Bacteria 808
291 Ga0105242_11180784 3300009176 Bacteria 783
292 Ga0105242_11440247 3300009176 Bacteria 718
293 Ga0105242_12685297 3300009176 Unclassified 548
294 Ga0105248_10006611 3300009177 Bacteria 12704
295 Ga0105248_10007428 3300009177 Bacteria 12026
296 Ga0105248_10044449 3300009177 Bacteria 4981
297 Ga0105248_10046497 3300009177 Bacteria 4865
298 Ga0105248_10056344 3300009177 Bacteria 4410
299 Ga0105248_10128811 3300009177 Unclassified 2855
300 Ga0105248_10269074 3300009177 Bacteria 1919
301 Ga0105248_10750377 3300009177 Unclassified 1101
302 Ga0105248_11015724 3300009177 Unclassified 937
303 Ga0105248_11255122 3300009177 Bacteria 838
304 Ga0105248_11995347 3300009177 Bacteria 659
305 Ga0105249_10280511 3300009553 Bacteria 1664
306 Ga0105249_10779139 3300009553 Bacteria 1020
307 Ga0105249_10887980 3300009553 Bacteria 958
308 Ga0105249_11022066 3300009553 Bacteria 896
309 Ga0105249_11517285 3300009553 Bacteria 742
310 Ga0105249_12731736 3300009553 Bacteria 566
311 Ga0105246_10069098 3300011119 Bacteria 2480
312 Ga0157374_10027250 3300013296 Bacteria 5151
313 Ga0157374_11036368 3300013296 Bacteria 840
314 Ga0157378_10006441 3300013297 Bacteria 10264
315 Ga0157378_10149174 3300013297 Bacteria 2177
316 Ga0157378_10463621 3300013297 Bacteria 1259
317 Ga0157378_10754324 3300013297 Bacteria 996
318 Ga0157378_12252866 3300013297 Archaea 596
319 Ga0163162_10241169 3300013306 Bacteria 1939
320 Ga0163162_10308163 3300013306 Bacteria 1716
321 Ga0157375_10261354 3300013308 Bacteria 1893
322 Ga0157375_10914401 3300013308 Bacteria 1021
323 Ga0157375_13115501 3300013308 Unclassified 553
324 Ga0163163_10027265 3300014325 Bacteria 5471
325 Ga0163163_10058119 3300014325 Bacteria 3824
326 Ga0163163_10082297 3300014325 Bacteria 3222
327 Ga0163163_10134151 3300014325 Bacteria 2516
328 Ga0163163_10834524 3300014325 Unclassified 985
329 Ga0163163_11320624 3300014325 Unclassified 783
330 Ga0157380_10369559 3300014326 Bacteria 1349
331 Ga0157380_10686500 3300014326 Bacteria 1027
332 Ga0157380_10934711 3300014326 Bacteria 896
333 Ga0157380_12178499 3300014326 Bacteria 618
334 Ga0157377_10710088 3300014745 Bacteria 731
335 Ga0157379_10027097 3300014968 Bacteria 5101
336 Ga0157379_10032645 3300014968 Bacteria 4642
337 Ga0157379_10045663 3300014968 Bacteria 3910
338 Ga0157379_10167112 3300014968 Bacteria 1986
339 Ga0157379_10605799 3300014968 Bacteria 1023
340 Ga0157379_10830609 3300014968 Unclassified 873
341 Ga0157376_10016216 3300014969 Bacteria 5649
342 Ga0157376_10127661 3300014969 Bacteria 2264
343 Ga0157376_10181322 3300014969 Bacteria 1925
344 Ga0157376_10237213 3300014969 Bacteria 1697
345 Ga0157376_10375566 3300014969 Unclassified 1368
346 Ga0157376_10424430 3300014969 Archaea 1291
347 Ga0157376_10768352 3300014969 Bacteria 974
348 Ga0157376_10963252 3300014969 Unclassified 874
349 Ga0157376_12003100 3300014969 Bacteria 617
350 Ga0163161_10346682 3300017792 Bacteria 1179
351 Ga0163161_11503713 3300017792 Bacteria 591
352 Ga0207666_1060752 3300025271 Bacteria 604
353 Ga0207642_10052098 3300025899 Bacteria 1855
354 Ga0207642_11132584 3300025899 Bacteria 506
355 Ga0207710_10015338 3300025900 Bacteria 3235
356 Ga0207710_10037267 3300025900 Bacteria 2147
357 Ga0207710_10243480 3300025900 Bacteria 898
358 Ga0207710_10664915 3300025900 Bacteria 546
359 Ga0207688_10070931 3300025901 Bacteria 1977
360 Ga0207680_10438414 3300025903 Unclassified 926
361 Ga0207680_10460444 3300025903 Bacteria 903
362 Ga0207680_10489877 3300025903 Bacteria 875
363 Ga0207685_10477757 3300025905 Bacteria 652
364 Ga0207643_10270171 3300025908 Bacteria 1052
365 Ga0207643_10790055 3300025908 Unclassified 615
366 Ga0207705_10157149 3300025909 Bacteria 1706
367 Ga0207684_11647425 3300025910 Unclassified 518
368 Ga0207707_10224946 3300025912 Bacteria 1633
369 Ga0207660_11535249 3300025917 Unclassified 538
370 Ga0207662_10197541 3300025918 Bacteria 1300
371 Ga0207662_10709511 3300025918 Bacteria 705
372 Ga0207657_10003677 3300025919 Bacteria 16315
373 Ga0207657_10374141 3300025919 Bacteria 1122
374 Ga0207649_11635269 3300025920 Unclassified 510
375 Ga0207652_10022714 3300025921 Bacteria 5194
376 Ga0207652_10540277 3300025921 Bacteria 1048
377 Ga0207652_11119300 3300025921 Bacteria 688
378 Ga0207681_10167527 3300025923 Bacteria 1662
379 Ga0207681_10234963 3300025923 Bacteria 1424
380 Ga0207681_10588262 3300025923 Bacteria 919
381 Ga0207681_11501996 3300025923 Bacteria 565
382 Ga0207650_10015204 3300025925 Bacteria 5357
383 Ga0207650_10764926 3300025925 Bacteria 818
384 Ga0207659_10001087 3300025926 Bacteria 16132
385 Ga0207659_10019572 3300025926 Bacteria 4459
386 Ga0207659_10039299 3300025926 Bacteria 3299
387 Ga0207687_10081706 3300025927 Bacteria 2336
388 Ga0207687_10156089 3300025927 Bacteria 1746
389 Ga0207687_11856132 3300025927 Unclassified 515
390 Ga0207644_10347645 3300025931 Bacteria 1203
391 Ga0207644_10763880 3300025931 Bacteria 808
392 Ga0207644_11030027 3300025931 Bacteria 691
393 Ga0207690_10258474 3300025932 Bacteria 1348
394 Ga0207690_10662488 3300025932 Unclassified 856
395 Ga0207706_10100553 3300025933 Bacteria 2544
396 Ga0207706_10157636 3300025933 Bacteria 1996
397 Ga0207686_10150607 3300025934 Bacteria 1619
398 Ga0207686_10200067 3300025934 Unclassified 1430
399 Ga0207686_10240536 3300025934 Bacteria 1317
400 Ga0207686_10390038 3300025934 Bacteria 1058
401 Ga0207709_10533720 3300025935 Unclassified 920
402 Ga0207709_11364756 3300025935 Bacteria 586
403 Ga0207670_10067912 3300025936 Bacteria 2454
404 Ga0207670_10315744 3300025936 Bacteria 1228
405 Ga0207670_10864799 3300025936 Bacteria 756
406 Ga0207670_10867402 3300025936 Bacteria 755
407 Ga0207669_10230808 3300025937 Unclassified 1365
408 Ga0207669_11195793 3300025937 Unclassified 644
409 Ga0207704_10006485 3300025938 Bacteria 5460
410 Ga0207704_10014235 3300025938 Bacteria 4011
411 Ga0207704_10639083 3300025938 Bacteria 875
412 Ga0207691_10004926 3300025940 Bacteria 12887
413 Ga0207691_10038808 3300025940 Bacteria 4407
414 Ga0207691_10215185 3300025940 Bacteria 1668
415 Ga0207711_10020073 3300025941 Bacteria 5569
416 Ga0207711_10025916 3300025941 Bacteria 4917
417 Ga0207711_10027818 3300025941 Bacteria 4752
418 Ga0207711_10181527 3300025941 Bacteria 1914
419 Ga0207711_10258289 3300025941 Bacteria 1600
420 Ga0207711_10284914 3300025941 Bacteria 1522
421 Ga0207711_10381217 3300025941 Bacteria 1308
422 Ga0207711_11228109 3300025941 Unclassified 691
423 Ga0207711_11326029 3300025941 Bacteria 662
424 Ga0207689_10102761 3300025942 Bacteria 2348
425 Ga0207689_10479253 3300025942 Bacteria 1042
426 Ga0207689_10584678 3300025942 Unclassified 939
427 Ga0207661_12113323 3300025944 Unclassified 509
428 Ga0207679_10029473 3300025945 Bacteria 3822
429 Ga0207679_11484824 3300025945 Unclassified 622
430 Ga0207679_11496862 3300025945 Bacteria 619
431 Ga0207667_10022641 3300025949 Bacteria 6933
432 Ga0207651_10037515 3300025960 Bacteria 3176
433 Ga0207651_10262602 3300025960 Bacteria 1418
434 Ga0207651_10422568 3300025960 Bacteria 1138
435 Ga0207651_11725906 3300025960 Bacteria 564
436 Ga0207651_11770477 3300025960 Bacteria 556
437 Ga0207651_11835318 3300025960 Unclassified 545
438 Ga0207712_10257305 3300025961 Bacteria 1414
439 Ga0207712_10839242 3300025961 Bacteria 809
440 Ga0207712_11633865 3300025961 Unclassified 578
441 Ga0207668_10134277 3300025972 Bacteria 1894
442 Ga0207668_11632065 3300025972 Bacteria 582
443 Ga0207640_11165096 3300025981 Archaea 684
444 Ga0207658_10461270 3300025986 Bacteria 1126
445 Ga0207658_10499794 3300025986 Bacteria 1083
446 Ga0207658_11111583 3300025986 Bacteria 722
447 Ga0207658_11759634 3300025986 Bacteria 566
448 Ga0207677_10327544 3300026023 Bacteria 1275
449 Ga0207677_10673077 3300026023 Bacteria 916
450 Ga0207677_10714436 3300026023 Bacteria 890
451 Ga0207677_10871702 3300026023 Bacteria 810
452 Ga0207677_11455280 3300026023 Bacteria 632
453 Ga0207703_10051723 3300026035 Bacteria 3331
454 Ga0207703_10057287 3300026035 Bacteria 3177
455 Ga0207703_10126904 3300026035 Bacteria 2198
456 Ga0207703_10145750 3300026035 Bacteria 2059
457 Ga0207703_10283592 3300026035 Bacteria 1505
458 Ga0207703_10628103 3300026035 Bacteria 1018
459 Ga0207703_10710397 3300026035 Bacteria 956
460 Ga0207703_11242323 3300026035 Bacteria 716
461 Ga0207639_10179108 3300026041 Bacteria 1802
462 Ga0207639_10469415 3300026041 Bacteria 1145
463 Ga0207639_11597446 3300026041 Archaea 612
464 Ga0207678_11933297 3300026067 Unclassified 514
465 Ga0207708_10068336 3300026075 Bacteria 2720
466 Ga0207708_10180456 3300026075 Bacteria 1676
467 Ga0207708_11534605 3300026075 Bacteria 585
468 Ga0207702_11212468 3300026078 Unclassified 749
469 Ga0207641_10172881 3300026088 Bacteria 1973
470 Ga0207641_10325144 3300026088 Bacteria 1459
471 Ga0207641_10347050 3300026088 Bacteria 1414
472 Ga0207641_11541799 3300026088 Bacteria 666
473 Ga0207648_10136103 3300026089 Bacteria 2164
474 Ga0207648_10191075 3300026089 Bacteria 1814
475 Ga0207648_10769059 3300026089 Bacteria 895
476 Ga0207648_10790764 3300026089 Bacteria 883
477 Ga0207648_11366169 3300026089 Bacteria 666
478 Ga0207648_11525537 3300026089 Unclassified 628
479 Ga0207648_11612730 3300026089 Bacteria 610
480 Ga0207676_10029446 3300026095 Bacteria 4112
481 Ga0207676_10046462 3300026095 Bacteria 3360
482 Ga0207676_10075636 3300026095 Bacteria 2717
483 Ga0207674_10851024 3300026116 Bacteria 879
484 Ga0207675_100172076 3300026118 Bacteria 2070
485 Ga0207675_100234692 3300026118 Bacteria 1771
486 Ga0207675_100679804 3300026118 Bacteria 1037
487 Ga0207683_10231526 3300026121 Bacteria 1685
488 Ga0207683_10322805 3300026121 Bacteria 1414
489 Ga0207683_10464903 3300026121 Unclassified 1167
490 Ga0207683_12029620 3300026121 Unclassified 523
491 Ga0207698_11175336 3300026142 Unclassified 781
492 Ga0207698_11251356 3300026142 Bacteria 756
493 Ga0207698_11778979 3300026142 Bacteria 631
494 Ga0207698_12623549 3300026142 Unclassified 513
495 Ga0207428_10222198 3300027907 Bacteria 1415
496 Ga0207428_10231869 3300027907 Bacteria 1381
497 Ga0268266_10028319 3300028379 Bacteria 4762
498 Ga0268266_10029439 3300028379 Bacteria 4668
499 Ga0268266_10038822 3300028379 Bacteria 4053
500 Ga0268266_11909025 3300028379 Bacteria 568
501 Ga0268265_10052294 3300028380 Bacteria 3088
502 Ga0268265_10248009 3300028380 Bacteria 1575
503 Ga0268264_10064622 3300028381 Bacteria 3080
504 Ga0268264_10204783 3300028381 Bacteria 1807
505 Ga0268264_10345086 3300028381 Bacteria 1415
506 Ga0268264_10428813 3300028381 Bacteria 1277
507 Ga0268264_10627520 3300028381 Bacteria 1062
508 Ga0268264_10655086 3300028381 Bacteria 1039
509 Ga0268264_10869028 3300028381 Unclassified 904
510 Ga0268264_11165983 3300028381 Unclassified 780
511 Ga0268264_12135562 3300028381 Bacteria 568
512 Ga0268264_12263292 3300028381 Bacteria 551
513 Ga0265332_10014647 3300031238 Bacteria 3466
514 Ga0265316_10459377 3300031344 Bacteria 913
515 Ga0307405_10561527 3300031731 Unclassified 925
516 Ga0307410_10103150 3300031852 Unclassified 2048
517 Ga0307410_10304355 3300031852 Unclassified 1259
518 Ga0307406_10305590 3300031901 Bacteria 1224
519 Ga0307409_102041926 3300031995 Bacteria 603
520 Ga0307416_100257040 3300032002 Unclassified 1704
521 Ga0307416_100308700 3300032002 Unclassified 1577
522 Ga0307414_11277204 3300032004 Unclassified 681
523 Ga0307411_10039002 3300032005 Bacteria 3002
524 Ga0307411_10289339 3300032005 Unclassified 1308
525 Ga0307415_100112799 3300032126 Unclassified 2021
526 Ga0307415_100339478 3300032126 Unclassified 1260
527 Ga0373940_0173940 3300035088 Bacteria 697
528 Ga0373944_0199907 3300035089 Bacteria 723
529 Ga0373944_0310971 3300035089 Bacteria 593
530 Ga0373939_0036089 3300035114 Bacteria 1460
531 Ga0373956_0422958 3300035119 Bacteria 636
532 Ga0373956_0546335 3300035119 Bacteria 553
533 Ga0373957_0205889 3300035120 Bacteria 821
534 Ga0373943_0745149 3300035170 Bacteria 582
535 Ga0373955_0319570 3300035172 Bacteria 938
536 Ga0373955_0766394 3300035172 Unclassified 593
537 Ga0373931_0959052 3300035691 Bacteria 577
538 Ga0373935_0168809 3300035692 Bacteria 1496
539 Ga0373927_0559059 3300035695 Bacteria 756
540 Ga0373947_0209244 3300035725 Unclassified 1279
541 Ga0373947_0264315 3300035725 Bacteria 1141
542 Ga0373947_1163249 3300035725 Unclassified 526
543 Ga0373937_0219249 3300036401 Bacteria 1791
544 Ga0373937_0541123 3300036401 Bacteria 1106
545 Ga0373937_0877114 3300036401 Unclassified 846
546 Ga0373925_0404120 3300037068 Archaea 1114
547 Ga0373925_0787204 3300037068 Bacteria 784
548 Ga0373925_1395510 3300037068 Bacteria 574
549 Ga0451789_0512942 3300041443 Bacteria 514
550 Ga0451798_0737968 3300041458 Unclassified 743
551 Ga0439444_0102587 3300042437 Bacteria 650
552 Ga0439460_0062132 3300042461 Bacteria 1142
553 Ga0451576_1149453 3300045051 Bacteria 812
554 Ga0495641_0269576 3300046461 Bacteria 766
555 Ga0495653_0022933 3300046463 Bacteria 5048
556 Ga0495582_0244186 3300046473 Bacteria 1029
557 Ga0495639_0185195 3300046475 Bacteria 1015
558 Ga0495584_0105626 3300046491 Bacteria 1424
559 Ga0495618_0680038 3300046514 Unclassified 607
560 Ga0495628_0235516 3300046516 Bacteria 1371
561 Ga0495630_0388010 3300046517 Bacteria 1070
562 Ga0495642_0247707 3300046528 Bacteria 779
563 Ga0495652_0526701 3300046529 Bacteria 816
564 Ga0495640_0191382 3300046533 Bacteria 1300
565 Ga0495640_0238445 3300046533 Archaea 1142
566 Ga0495586_0297029 3300046535 Bacteria 925
567 Ga0495587_0106119 3300046536 Bacteria 1616
568 Ga0495645_0027182 3300046543 Bacteria 4155
569 Ga0495634_0209566 3300046642 Unclassified 1207
570 Ga0495635_0070225 3300046663 Bacteria 2401
571 Ga0495635_0618100 3300046663 Bacteria 707
572 Ga0495647_0098691 3300046681 Bacteria 1207
573 Ga0495647_0181536 3300046681 Bacteria 916
574 Ga0495658_0058731 3300046683 Bacteria 2201
575 Ga0495658_0112499 3300046683 Bacteria 1638
576 Ga0495669_0629568 3300046684 Bacteria 522
577 Ga0495613_0597338 3300046689 Bacteria 735
578 Ga0495600_0064516 3300046809 Unclassified 2394
579 Ga0495674_0413658 3300047319 Bacteria 1087
580 Ga0495674_0732256 3300047319 Bacteria 774
581 Ga0495680_0394762 3300047322 Bacteria 956
582 Ga0495684_0171481 3300047471 Bacteria 1613
583 Ga0495684_0835413 3300047471 Unclassified 599
584 Ga0495614_0290452 3300048089 Bacteria 754
585 Ga0496100_0504519 3300048903 Bacteria 932
586 Ga0496101_0093646 3300048904 Bacteria 2238
587 Ga0496102_0067322 3300048905 Bacteria 3285
588 Ga0496103_0412120 3300048906 Bacteria 868
589 Ga0496104_0076790 3300048907 Bacteria 3182
590 Ga0496104_0471780 3300048907 Bacteria 1166
591 Ga0496105_0243813 3300048908 Bacteria 1458
592 Ga0496105_0293386 3300048908 Unclassified 1309
593 Ga0496105_0359513 3300048908 Bacteria 1162
594 Ga0496105_0417170 3300048908 Bacteria 1063
595 Ga0496105_0805516 3300048908 Bacteria 714
596 Ga0496106_0510550 3300048909 Unclassified 965
597 Ga0496106_0520954 3300048909 Bacteria 955
598 Ga0496106_1043351 3300048909 Bacteria 642
599 Ga0496107_0306148 3300048910 Bacteria 1183
600 Ga0496107_0912573 3300048910 Unclassified 640
601 Ga0496108_0016032 3300048911 Bacteria 6109
602 Ga0496108_0818028 3300048911 Bacteria 803
603 Ga0496108_1223835 3300048911 Bacteria 634
604 Ga0496109_0003418 3300048912 Bacteria 13283
605 Ga0496109_0066075 3300048912 Bacteria 3311
606 Ga0496109_0335269 3300048912 Bacteria 1428
607 Ga0496110_0005316 3300048913 Bacteria 10083
608 Ga0496112_0001264 3300048915 Bacteria 19181
609 Ga0496112_0027457 3300048915 Bacteria 5488
610 Ga0496112_0223646 3300048915 Bacteria 1838
611 Ga0496112_0419174 3300048915 Unclassified 1278
612 Ga0496113_0026290 3300048916 Bacteria 4160
613 Ga0496113_0035755 3300048916 Bacteria 3635
614 Ga0496114_0021164 3300048917 Bacteria 5289
615 Ga0496114_0063177 3300048917 Bacteria 3100
616 Ga0496114_0129988 3300048917 Unclassified 2174
617 Ga0496114_0593203 3300048917 Unclassified 977
618 Ga0496114_0614398 3300048917 Bacteria 958
619 Ga0501031_0092702 3300049568 Bacteria 1971
620 Ga0501032_0044806 3300049569 Bacteria 2993
621 Ga0501034_0290657 3300049571 Bacteria 1572
622 Ga0501036_0023953 3300049572 Bacteria 5146
623 Ga0501037_0177923 3300049573 Bacteria 1510
624 Ga0501038_0241907 3300049574 Bacteria 1432
625 Ga0501038_1151917 3300049574 Unclassified 565
626 Ga0501039_0029832 3300049575 Bacteria 4202
627 Ga0501041_0208460 3300049577 Bacteria 1226
628 Ga0501043_0056671 3300049579 Bacteria 3078
629 Ga0501047_0524890 3300049581 Bacteria 1009
630 Ga0501067_0020349 3300049583 Bacteria 3672
631 Ga0501067_0240061 3300049583 Bacteria 1008
632 Ga0501068_0013987 3300049584 Bacteria 4579
633 Ga0501069_0015617 3300049585 Bacteria 4071
634 Ga0501070_0418517 3300049586 Bacteria 1082
635 Ga0501070_1199516 3300049586 Unclassified 582
636 Ga0501072_0483888 3300049588 Bacteria 979
637 Ga0501072_1190706 3300049588 Unclassified 592
638 Ga0501072_1485031 3300049588 Bacteria 523
639 Ga0501073_0175174 3300049589 Bacteria 1484
640 Ga0501075_0567140 3300049591 Bacteria 866
641 Ga0501075_1485362 3300049591 Unclassified 513
642 Ga0501075_1551613 3300049591 Bacteria 501
643 Ga0501076_0409762 3300049592 Bacteria 1115
644 Ga0501076_1208734 3300049592 Bacteria 622
645 Ga0501235_084525 3300049669 Unclassified 761
646 Ga0501079_0845851 3300049741 Bacteria 720
647 Ga0501079_0921079 3300049741 Unclassified 688
648 Ga0501080_0106809 3300049742 Bacteria 2594
649 Ga0501081_1480908 3300049743 Unclassified 515
650 Ga0501083_0415324 3300049744 Bacteria 875
651 Ga0501044_0060385 3300049823 Bacteria 3882
652 Ga0501045_0488090 3300049824 Bacteria 915
653 Ga0501045_1291901 3300049824 Bacteria 531
654 nmdc:mga07m45_523373_c1 3300050496 Bacteria 686
655 nmdc:mga05p37_102324_c1 3300050507 Bacteria 3528
656 nmdc:mga05p37_1362281_c1 3300050507 Bacteria 718
657 nmdc:mga05p37_355313_c1 3300050507 Bacteria 1724
658 nmdc:mga05p37_44993_c1 3300050507 Bacteria 5431
659 nmdc:mga05p37_9112_c1 3300050507 Bacteria 11730
660 nmdc:mga09592_186797_c1 3300050508 Bacteria 1793
661 nmdc:mga09592_384641_c1 3300050508 Bacteria 1213
662 nmdc:mga06r32_1699328_c1 3300050510 Unclassified 568
663 nmdc:mga08y16_1359102_c1 3300050511 Bacteria 675
664 nmdc:mga08y16_152271_c1 3300050511 Bacteria 2404
665 nmdc:mga08y16_248036_c1 3300050511 Bacteria 1840
666 nmdc:mga0n895_1003363_c1 3300050512 Unclassified 816
667 nmdc:mga0n895_1008379_c1 3300050512 Bacteria 813
668 nmdc:mga0n895_101576_c1 3300050512 Bacteria 2886
669 nmdc:mga0n895_1123092_c1 3300050512 Bacteria 763
670 nmdc:mga0n895_1460762_c1 3300050512 Unclassified 651
671 nmdc:mga0n895_1699831_c1 3300050512 Unclassified 594
672 nmdc:mga0n895_1969649_c1 3300050512 Bacteria 542
673 nmdc:mga0n895_2044981_c1 3300050512 Bacteria 530
674 nmdc:mga0n895_29201_c1 3300050512 Bacteria 5256
675 nmdc:mga0n895_45459_c1 3300050512 Bacteria 4285
676 nmdc:mga0rr50_1802435_c1 3300050513 Bacteria 515
677 nmdc:mga0rr50_32601_c1 3300050513 Bacteria 3714
678 nmdc:mga0rr50_346950_c1 3300050513 Bacteria 1248
679 nmdc:mga0rr50_457416_c1 3300050513 Unclassified 1082
680 nmdc:mga0rr50_87028_c1 3300050513 Bacteria 2425
681 nmdc:mga08x19_156738_c1 3300050514 Bacteria 1545
682 nmdc:mga08x19_701215_c1 3300050514 Bacteria 718
683 nmdc:mga0a205_1247085_c1 3300050515 Bacteria 591
684 nmdc:mga0a205_1426747_c1 3300050515 Bacteria 540
685 nmdc:mga0a205_1508698_c1 3300050515 Unclassified 520
686 nmdc:mga0a205_23780_c1 3300050515 Bacteria 5815
687 nmdc:mga0a205_249916_c1 3300050515 Unclassified 1653
688 nmdc:mga0a205_26953_c1 3300050515 Bacteria 5486
689 nmdc:mga0a205_77905_c1 3300050515 Bacteria 3202
690 nmdc:mga0a205_897048_c1 3300050515 Bacteria 733
691 Ga0495601_0042251 3300053077 Bacteria 2860
692 Ga0495595_0046787 3300053084 Bacteria 1994
693 Ga0495619_0107865 3300053085 Bacteria 1900
694 Ga0495619_0543705 3300053085 Unclassified 797
695 Ga0500658_0167480 3300053134 Bacteria 997
696 Ga0501084_1566143 3300054114 Unclassified 551
697 Ga0501082_0059899 3300060353 Bacteria 3280
698 Ga0501082_1873911 3300060353 Unclassified 523
699 Ga0070670_101894477
700 JGI24749J21850_1062450
701 Ga0065714_10130822
702 Ga0065704_10802552
703 Ga0065712_10000253
704 Ga0065715_10000496
705 Ga0065715_10863102
706 Ga0065707_10134382
707 Ga0065707_10911200
708 Ga0070658_10023565
709 Ga0070676_10085717
710 Ga0070676_10186841
711 Ga0070683_101116881
712 Ga0070690_100071568
713 Ga0070690_100075197
714 Ga0070690_101022232
715 Ga0070690_101032298
716 Ga0070670_100002728
717 Ga0070670_100395999
718 Ga0070670_100482641
719 Ga0068869_100333848
720 Ga0068869_101483581
721 Ga0070666_10099024
722 Ga0070666_10142130
723 Ga0070666_10657176
724 Ga0070666_10753378
725 Ga0070680_100508243
726 Ga0070680_100528533
727 Ga0068868_100209330
728 Ga0068868_100466319
729 Ga0068868_101606013
730 Ga0068868_101644338
731 Ga0068868_101984163
732 Ga0070660_100093951
733 Ga0070660_100413578
734 Ga0070689_100180730
735 Ga0070689_100315181
736 Ga0070689_100409973
737 Ga0070689_100834752
738 Ga0070687_100061913
739 Ga0070687_100150322
740 Ga0070661_101128045
741 Ga0070668_100891064
742 Ga0070668_101248812
743 Ga0070669_100243178
744 Ga0070669_100347606
745 Ga0070669_100616833
746 Ga0070675_100029710
747 Ga0070675_100066220
748 Ga0070675_100615055
749 Ga0070675_101531555
750 Ga0070671_100114636
751 Ga0070671_100569981
752 Ga0070671_101777829
753 Ga0070671_101884282
754 Ga0070674_100394366
755 Ga0070674_100426135
756 Ga0070674_100860618
757 Ga0070674_102163219
758 Ga0070673_100055323
759 Ga0070673_100069389
760 Ga0070673_100444371
761 Ga0070673_100495480
762 Ga0070673_102000910
763 Ga0070673_102151860
764 Ga0070688_100009655
765 Ga0070688_100181877
766 Ga0070688_100597816
767 Ga0070688_100910000
768 Ga0070659_100692031
769 Ga0070659_101251644
770 Ga0070667_100052134
771 Ga0070667_100565535
772 Ga0070667_101784923
773 Ga0070667_102351946
774 Ga0070701_10029824
775 Ga0070701_10877239
776 Ga0070705_100927882
777 Ga0070700_100080470
778 Ga0070700_100701518
779 Ga0070694_100045671
780 Ga0070694_100052582
781 Ga0070708_100441899
782 Ga0070708_100555384
783 Ga0070708_101618552
784 Ga0070663_100679964
785 Ga0070663_100959024
786 Ga0070678_100384810
787 Ga0070678_100432426
788 Ga0070678_100730797
789 Ga0070678_100842009
790 Ga0070678_102228573
791 Ga0070662_100096711
792 Ga0070662_100163399
793 Ga0070662_100785648
794 Ga0070662_101196218
795 Ga0070681_10785500
796 Ga0070681_11449208
797 Ga0068867_100102706
798 Ga0068867_100741131
799 Ga0068867_100824781
800 Ga0068867_101262307
801 Ga0070685_10003257
802 Ga0070685_10652248
803 Ga0070706_100456547
804 Ga0070707_100944823
805 Ga0070707_101086535
806 Ga0070698_100213092
807 Ga0070698_101056863
808 Ga0070698_101170545
809 Ga0070699_100337005
810 Ga0070699_100737746
811 Ga0070679_100004328
812 Ga0070679_100600625
813 Ga0070684_101639104
814 Ga0070684_101997247
815 Ga0068853_100312890
816 Ga0068853_100506455
817 Ga0070672_100015831
818 Ga0070672_100283069
819 Ga0070672_100437000
820 Ga0070686_100416169
821 Ga0070686_101181392
822 Ga0070686_101609173
823 Ga0070686_101936320
824 Ga0070695_100015039
825 Ga0070695_100158409
826 Ga0070695_100830520
827 Ga0070696_100091601
828 Ga0070696_101036326
829 Ga0070693_100568665
830 Ga0070693_101096689
831 Ga0070665_100004096
832 Ga0070665_100010345
833 Ga0070665_100011519
834 Ga0070665_100012467
835 Ga0070704_100102145
836 Ga0070704_100125170
837 Ga0070704_100440554
838 Ga0070704_100614760
839 Ga0070704_101877635
840 Ga0068855_100018161
841 Ga0068855_100614376
842 Ga0070664_100303160
843 Ga0070664_100703162
844 Ga0068854_100492599
845 Ga0068854_101015832
846 Ga0068854_101626021
847 Ga0068856_101395000
848 Ga0070702_100193550
849 Ga0070702_100423813
850 Ga0070702_100461150
851 Ga0068852_101711981
852 Ga0068852_102161279
853 Ga0068859_100301490
854 Ga0068859_100776745
855 Ga0068859_101477914
856 Ga0068859_101573909
857 Ga0068864_100016872
858 Ga0068864_100020109
859 Ga0068864_100478689
860 Ga0068864_102065284
861 Ga0068866_10043658
862 Ga0068866_10384381
863 Ga0068866_10466316
864 Ga0068866_10577208
865 Ga0068861_100170011
866 Ga0068851_10429039
867 Ga0068870_10956111
868 Ga0068863_100190092
869 Ga0068863_100385025
870 Ga0068863_100410888
871 Ga0068863_101353489
872 Ga0068858_100001428
873 Ga0068858_100014942
874 Ga0068858_100073151
875 Ga0068858_100093951
876 Ga0068858_100137424
877 Ga0068858_100164258
878 Ga0068858_100299705
879 Ga0068858_100575905
880 Ga0068858_101107728
881 Ga0068860_100263048
882 Ga0068860_100409954
883 Ga0068860_100442348
884 Ga0068860_100554444
885 Ga0068860_100822581
886 Ga0068860_101057353
887 Ga0068862_100130029
888 Ga0068862_100292194
889 Ga0068862_100823725
890 Ga0068862_101000039
891 Ga0081455_10315174
892 Ga0081455_10699235
893 Ga0081539_10008987
894 Ga0070715_10058698
895 Ga0070715_11071312
896 Ga0070716_100101878
897 Ga0097621_100010914
898 Ga0097621_100029036
899 Ga0097621_100223262
900 Ga0097621_100228686
901 Ga0097621_100323720
902 Ga0097621_100493752
903 Ga0097621_100711216
904 Ga0097621_100889386
905 Ga0097621_102236128
906 Ga0075370_10579795
907 Ga0068871_100001956
908 Ga0068871_100016255
909 Ga0068871_100092215
910 Ga0068871_100136395
911 Ga0068871_100166757
912 Ga0068871_100378410
913 Ga0068871_100694857
914 Ga0068871_101134035
915 Ga0068871_101640419
916 Ga0075428_100075948
917 Ga0075428_100175177
918 Ga0075428_100372803
919 Ga0075431_100733200
920 Ga0075431_101863103
921 Ga0075433_10013088
922 Ga0075433_10029138
923 Ga0075433_10093401
924 Ga0075433_11192425
925 Ga0075433_11640668
926 Ga0075434_100011242
927 Ga0075434_100044251
928 Ga0075434_100046396
929 Ga0075434_100367349
930 Ga0075434_100581231
931 Ga0075434_102517052
932 Ga0075429_100155329
933 Ga0075429_100434100
934 Ga0068865_100010622
935 Ga0068865_100421554
936 Ga0068865_100599890
937 Ga0068865_101170057
938 Ga0075436_100102961
939 Ga0075436_101288058
940 Ga0097620_100301504
941 Ga0097620_100776784
942 Ga0097620_101477780
943 Ga0097620_101573656
944 Ga0075435_100001910
945 Ga0075435_100011981
946 Ga0075435_100378855
947 Ga0075435_100677988
948 Ga0075435_100907833
949 Ga0075435_101378191
950 Ga0105251_10510301
951 Ga0105240_11057297
952 Ga0111539_10003450
953 Ga0111539_10482428
954 Ga0111539_10712132
955 Ga0111539_10930955
956 Ga0111539_11200200
957 Ga0111539_12011462
958 Ga0111539_12255159
959 Ga0111539_13353384
960 Ga0105245_10003782
961 Ga0105245_10020965
962 Ga0105245_10759966
963 Ga0105245_13230890
964 Ga0105247_10024393
965 Ga0105247_10054452
966 Ga0105247_10064380
967 Ga0105247_11052141
968 Ga0114129_10011319
969 Ga0114129_10012599
970 Ga0114129_10189950
971 Ga0114129_10275664
972 Ga0114129_10318282
973 Ga0114129_10401588
974 Ga0114129_11329588
975 Ga0114129_11961516
976 Ga0114129_12971425
977 Ga0105243_10412820
978 Ga0105243_11351738
979 Ga0105243_11519333
980 Ga0105243_11995396
981 Ga0105243_12667328
982 Ga0105243_13100528
983 Ga0105241_10817752
984 Ga0105242_10004014
985 Ga0105242_10046496
986 Ga0105242_10180812
987 Ga0105242_10400289
988 Ga0105242_11102775
989 Ga0105242_11180784
990 Ga0105242_11440247
991 Ga0105242_12685297
992 Ga0105248_10006611
993 Ga0105248_10007428
994 Ga0105248_10044449
995 Ga0105248_10046497
996 Ga0105248_10056344
997 Ga0105248_10128811
998 Ga0105248_10269074
999 Ga0105248_10750377
1000 Ga0105248_11015724
1001 Ga0105248_11255122
1002 Ga0105248_11995347
1003 Ga0105249_10280511
1004 Ga0105249_10779139
1005 Ga0105249_10887980
1006 Ga0105249_11022066
1007 Ga0105249_11517285
1008 Ga0105249_12731736
1009 Ga0105246_10069098
1010 Ga0157374_10027250
1011 Ga0157374_11036368
1012 Ga0157378_10006441
1013 Ga0157378_10149174
1014 Ga0157378_10463621
1015 Ga0157378_10754324
1016 Ga0157378_12252866
1017 Ga0163162_10241169
1018 Ga0163162_10308163
1019 Ga0157375_10261354
1020 Ga0157375_10914401
1021 Ga0157375_13115501
1022 Ga0163163_10027265
1023 Ga0163163_10058119
1024 Ga0163163_10082297
1025 Ga0163163_10134151
1026 Ga0163163_10834524
1027 Ga0163163_11320624
1028 Ga0157380_10369559
1029 Ga0157380_10686500
1030 Ga0157380_10934711
1031 Ga0157380_12178499
1032 Ga0157377_10710088
1033 Ga0157379_10027097
1034 Ga0157379_10032645
1035 Ga0157379_10045663
1036 Ga0157379_10167112
1037 Ga0157379_10605799
1038 Ga0157379_10830609
1039 Ga0157376_10016216
1040 Ga0157376_10127661
1041 Ga0157376_10181322
1042 Ga0157376_10237213
1043 Ga0157376_10375566
1044 Ga0157376_10424430
1045 Ga0157376_10768352
1046 Ga0157376_10963252
1047 Ga0157376_12003100
1048 Ga0163161_10346682
1049 Ga0163161_11503713
1050 Ga0207666_1060752
1051 Ga0207642_10052098
1052 Ga0207642_11132584
1053 Ga0207710_10015338
1054 Ga0207710_10037267
1055 Ga0207710_10243480
1056 Ga0207710_10664915
1057 Ga0207688_10070931
1058 Ga0207680_10438414
1059 Ga0207680_10460444
1060 Ga0207680_10489877
1061 Ga0207685_10477757
1062 Ga0207643_10270171
1063 Ga0207643_10790055
1064 Ga0207705_10157149
1065 Ga0207684_11647425
1066 Ga0207707_10224946
1067 Ga0207660_11535249
1068 Ga0207662_10197541
1069 Ga0207662_10709511
1070 Ga0207657_10003677
1071 Ga0207657_10374141
1072 Ga0207649_11635269
1073 Ga0207652_10022714
1074 Ga0207652_10540277
1075 Ga0207652_11119300
1076 Ga0207681_10167527
1077 Ga0207681_10234963
1078 Ga0207681_10588262
1079 Ga0207681_11501996
1080 Ga0207650_10015204
1081 Ga0207650_10764926
1082 Ga0207659_10001087
1083 Ga0207659_10019572
1084 Ga0207659_10039299
1085 Ga0207687_10081706
1086 Ga0207687_10156089
1087 Ga0207687_11856132
1088 Ga0207644_10347645
1089 Ga0207644_10763880
1090 Ga0207644_11030027
1091 Ga0207690_10258474
1092 Ga0207690_10662488
1093 Ga0207706_10100553
1094 Ga0207706_10157636
1095 Ga0207686_10150607
1096 Ga0207686_10200067
1097 Ga0207686_10240536
1098 Ga0207686_10390038
1099 Ga0207709_10533720
1100 Ga0207709_11364756
1101 Ga0207670_10067912
1102 Ga0207670_10315744
1103 Ga0207670_10864799
1104 Ga0207670_10867402
1105 Ga0207669_10230808
1106 Ga0207669_11195793
1107 Ga0207704_10006485
1108 Ga0207704_10014235
1109 Ga0207704_10639083
1110 Ga0207691_10004926
1111 Ga0207691_10038808
1112 Ga0207691_10215185
1113 Ga0207711_10020073
1114 Ga0207711_10025916
1115 Ga0207711_10027818
1116 Ga0207711_10181527
1117 Ga0207711_10258289
1118 Ga0207711_10284914
1119 Ga0207711_10381217
1120 Ga0207711_11228109
1121 Ga0207711_11326029
1122 Ga0207689_10102761
1123 Ga0207689_10479253
1124 Ga0207689_10584678
1125 Ga0207661_12113323
1126 Ga0207679_10029473
1127 Ga0207679_11484824
1128 Ga0207679_11496862
1129 Ga0207667_10022641
1130 Ga0207651_10037515
1131 Ga0207651_10262602
1132 Ga0207651_10422568
1133 Ga0207651_11725906
1134 Ga0207651_11770477
1135 Ga0207651_11835318
1136 Ga0207712_10257305
1137 Ga0207712_10839242
1138 Ga0207712_11633865
1139 Ga0207668_10134277
1140 Ga0207668_11632065
1141 Ga0207640_11165096
1142 Ga0207658_10461270
1143 Ga0207658_10499794
1144 Ga0207658_11111583
1145 Ga0207658_11759634
1146 Ga0207677_10327544
1147 Ga0207677_10673077
1148 Ga0207677_10714436
1149 Ga0207677_10871702
1150 Ga0207677_11455280
1151 Ga0207703_10051723
1152 Ga0207703_10057287
1153 Ga0207703_10126904
1154 Ga0207703_10145750
1155 Ga0207703_10283592
1156 Ga0207703_10628103
1157 Ga0207703_10710397
1158 Ga0207703_11242323
1159 Ga0207639_10179108
1160 Ga0207639_10469415
1161 Ga0207639_11597446
1162 Ga0207678_11933297
1163 Ga0207708_10068336
1164 Ga0207708_10180456
1165 Ga0207708_11534605
1166 Ga0207702_11212468
1167 Ga0207641_10172881
1168 Ga0207641_10325144
1169 Ga0207641_10347050
1170 Ga0207641_11541799
1171 Ga0207648_10136103
1172 Ga0207648_10191075
1173 Ga0207648_10769059
1174 Ga0207648_10790764
1175 Ga0207648_11366169
1176 Ga0207648_11525537
1177 Ga0207648_11612730
1178 Ga0207676_10029446
1179 Ga0207676_10046462
1180 Ga0207676_10075636
1181 Ga0207674_10851024
1182 Ga0207675_100172076
1183 Ga0207675_100234692
1184 Ga0207675_100679804
1185 Ga0207683_10231526
1186 Ga0207683_10322805
1187 Ga0207683_10464903
1188 Ga0207683_12029620
1189 Ga0207698_11175336
1190 Ga0207698_11251356
1191 Ga0207698_11778979
1192 Ga0207698_12623549
1193 Ga0207428_10222198
1194 Ga0207428_10231869
1195 Ga0268266_10028319
1196 Ga0268266_10029439
1197 Ga0268266_10038822
1198 Ga0268266_11909025
1199 Ga0268265_10052294
1200 Ga0268265_10248009
1201 Ga0268264_10064622
1202 Ga0268264_10204783
1203 Ga0268264_10345086
1204 Ga0268264_10428813
1205 Ga0268264_10627520
1206 Ga0268264_10655086
1207 Ga0268264_10869028
1208 Ga0268264_11165983
1209 Ga0268264_12135562
1210 Ga0268264_12263292
1211 Ga0265332_10014647
1212 Ga0265316_10459377
1213 Ga0307405_10561527
1214 Ga0307410_10103150
1215 Ga0307410_10304355
1216 Ga0307406_10305590
1217 Ga0307409_102041926
1218 Ga0307416_100257040
1219 Ga0307416_100308700
1220 Ga0307414_11277204
1221 Ga0307411_10039002
1222 Ga0307411_10289339
1223 Ga0307415_100112799
1224 Ga0307415_100339478
1225 Ga0373940_0173940
1226 Ga0373944_0199907
1227 Ga0373944_0310971
1228 Ga0373939_0036089
1229 Ga0373956_0422958
1230 Ga0373956_0546335
1231 Ga0373957_0205889
1232 Ga0373943_0745149
1233 Ga0373955_0319570
1234 Ga0373955_0766394
1235 Ga0373931_0959052
1236 Ga0373935_0168809
1237 Ga0373927_0559059
1238 Ga0373947_0209244
1239 Ga0373947_0264315
1240 Ga0373947_1163249
1241 Ga0373937_0219249
1242 Ga0373937_0541123
1243 Ga0373937_0877114
1244 Ga0373925_0404120
1245 Ga0373925_0787204
1246 Ga0373925_1395510
1247 Ga0451789_0512942
1248 Ga0451798_0737968
1249 Ga0439444_0102587
1250 Ga0439460_0062132
1251 Ga0451576_1149453
1252 Ga0495641_0269576
1253 Ga0495653_0022933
1254 Ga0495582_0244186
1255 Ga0495639_0185195
1256 Ga0495584_0105626
1257 Ga0495618_0680038
1258 Ga0495628_0235516
1259 Ga0495630_0388010
1260 Ga0495642_0247707
1261 Ga0495652_0526701
1262 Ga0495640_0191382
1263 Ga0495640_0238445
1264 Ga0495586_0297029
1265 Ga0495587_0106119
1266 Ga0495645_0027182
1267 Ga0495634_0209566
1268 Ga0495635_0070225
1269 Ga0495635_0618100
1270 Ga0495647_0098691
1271 Ga0495647_0181536
1272 Ga0495658_0058731
1273 Ga0495658_0112499
1274 Ga0495669_0629568
1275 Ga0495613_0597338
1276 Ga0495600_0064516
1277 Ga0495674_0413658
1278 Ga0495674_0732256
1279 Ga0495680_0394762
1280 Ga0495684_0171481
1281 Ga0495684_0835413
1282 Ga0495614_0290452
1283 Ga0496100_0504519
1284 Ga0496101_0093646
1285 Ga0496102_0067322
1286 Ga0496103_0412120
1287 Ga0496104_0076790
1288 Ga0496104_0471780
1289 Ga0496105_0243813
1290 Ga0496105_0293386
1291 Ga0496105_0359513
1292 Ga0496105_0417170
1293 Ga0496105_0805516
1294 Ga0496106_0510550
1295 Ga0496106_0520954
1296 Ga0496106_1043351
1297 Ga0496107_0306148
1298 Ga0496107_0912573
1299 Ga0496108_0016032
1300 Ga0496108_0818028
1301 Ga0496108_1223835
1302 Ga0496109_0003418
1303 Ga0496109_0066075
1304 Ga0496109_0335269
1305 Ga0496110_0005316
1306 Ga0496112_0001264
1307 Ga0496112_0027457
1308 Ga0496112_0223646
1309 Ga0496112_0419174
1310 Ga0496113_0026290
1311 Ga0496113_0035755
1312 Ga0496114_0021164
1313 Ga0496114_0063177
1314 Ga0496114_0129988
1315 Ga0496114_0593203
1316 Ga0496114_0614398
1317 Ga0501031_0092702
1318 Ga0501032_0044806
1319 Ga0501034_0290657
1320 Ga0501036_0023953
1321 Ga0501037_0177923
1322 Ga0501038_0241907
1323 Ga0501038_1151917
1324 Ga0501039_0029832
1325 Ga0501041_0208460
1326 Ga0501043_0056671
1327 Ga0501047_0524890
1328 Ga0501067_0020349
1329 Ga0501067_0240061
1330 Ga0501068_0013987
1331 Ga0501069_0015617
1332 Ga0501070_0418517
1333 Ga0501070_1199516
1334 Ga0501072_0483888
1335 Ga0501072_1190706
1336 Ga0501072_1485031
1337 Ga0501073_0175174
1338 Ga0501075_0567140
1339 Ga0501075_1485362
1340 Ga0501075_1551613
1341 Ga0501076_0409762
1342 Ga0501076_1208734
1343 Ga0501235_084525
1344 Ga0501079_0845851
1345 Ga0501079_0921079
1346 Ga0501080_0106809
1347 Ga0501081_1480908
1348 Ga0501083_0415324
1349 Ga0501044_0060385
1350 Ga0501045_0488090
1351 Ga0501045_1291901
1352 nmdc:mga07m45_523373_c1
1353 nmdc:mga05p37_102324_c1
1354 nmdc:mga05p37_1362281_c1
1355 nmdc:mga05p37_355313_c1
1356 nmdc:mga05p37_44993_c1
1357 nmdc:mga05p37_9112_c1
1358 nmdc:mga09592_186797_c1
1359 nmdc:mga09592_384641_c1
1360 nmdc:mga06r32_1699328_c1
1361 nmdc:mga08y16_1359102_c1
1362 nmdc:mga08y16_152271_c1
1363 nmdc:mga08y16_248036_c1
1364 nmdc:mga0n895_1003363_c1
1365 nmdc:mga0n895_1008379_c1
1366 nmdc:mga0n895_101576_c1
1367 nmdc:mga0n895_1123092_c1
1368 nmdc:mga0n895_1460762_c1
1369 nmdc:mga0n895_1699831_c1
1370 nmdc:mga0n895_1969649_c1
1371 nmdc:mga0n895_2044981_c1
1372 nmdc:mga0n895_29201_c1
1373 nmdc:mga0n895_45459_c1
1374 nmdc:mga0rr50_1802435_c1
1375 nmdc:mga0rr50_32601_c1
1376 nmdc:mga0rr50_346950_c1
1377 nmdc:mga0rr50_457416_c1
1378 nmdc:mga0rr50_87028_c1
1379 nmdc:mga08x19_156738_c1
1380 nmdc:mga08x19_701215_c1
1381 nmdc:mga0a205_1247085_c1
1382 nmdc:mga0a205_1426747_c1
1383 nmdc:mga0a205_1508698_c1
1384 nmdc:mga0a205_23780_c1
1385 nmdc:mga0a205_249916_c1
1386 nmdc:mga0a205_26953_c1
1387 nmdc:mga0a205_77905_c1
1388 nmdc:mga0a205_897048_c1
1389 Ga0495601_0042251
1390 Ga0495595_0046787
1391 Ga0495619_0107865
1392 Ga0495619_0543705
1393 Ga0500658_0167480
1394 Ga0501084_1566143
1395 Ga0501082_0059899
1396 Ga0501082_1873911

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map