F475935

General Info

Members Datasets Scaffolds Average Seq Length
698 392 698 143

Family's Representative Sequence

Representative Sequence 3300003320|rootH2_10008940|rootH2_1000894032
Length 175
Sequence MSTHRNAGRKFSRTKGHRRALFANMAAALIKHEQIVTTLPKAKDLRPVVEKLITLAKKGGLANYRLAIARMRDETSAKKMFDVIGPRYKDRSGGYTRIMKAGFRYGDSAPMAVIELVDRDISAKGLDSGPVFNDEGEEVQTEAAHADKGDNTKPTGPKGGATKKVAAPRRVSSGG

Samples

Sample ID Description Type Environment
1 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
5 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
6 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
7 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
70 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
71 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
72 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
73 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
74 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
75 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
76 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
77 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
78 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
79 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
83 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
84 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
85 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
86 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
90 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
94 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
96 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
100 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
101 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
104 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
105 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
106 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
107 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
108 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
109 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
110 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
111 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
112 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
113 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
114 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
115 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
116 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
117 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
118 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
119 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
120 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
121 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
122 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
123 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
124 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
125 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
126 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
127 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
185 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
186 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
190 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
191 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
192 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
193 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
194 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
195 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
196 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
197 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
198 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
199 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
200 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
201 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
202 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
203 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
204 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
205 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
206 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
207 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
211 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
212 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
213 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
214 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
215 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
216 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
217 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
218 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
219 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
220 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
221 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
222 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
223 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
224 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
225 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
226 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
227 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
228 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
229 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
230 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
231 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
232 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
233 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
234 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
235 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
236 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
237 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
238 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
239 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
240 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
241 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
242 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
243 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
244 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
245 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
246 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
247 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
248 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
249 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
250 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
251 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
252 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
253 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
254 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
255 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
256 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
257 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
258 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
259 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
260 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
261 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
262 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
263 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
264 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
265 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
266 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
267 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
268 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
269 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
270 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
271 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
272 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
273 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
274 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
275 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
276 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
277 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
278 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
279 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
280 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
281 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
282 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
283 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
284 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
285 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
286 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
287 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
288 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
289 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
290 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
291 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
292 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
293 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
294 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
295 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
296 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
297 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
298 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
299 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
300 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
301 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
302 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
303 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
304 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
305 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
306 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
307 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
308 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
309 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
310 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
311 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
312 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
313 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
314 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
315 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
316 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
317 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
318 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
319 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
320 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
321 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
322 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
323 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
324 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
325 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
326 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
327 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
328 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
329 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
330 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
331 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
332 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
333 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
334 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
335 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
336 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
337 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
338 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
339 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
340 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
341 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
342 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
343 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
344 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
345 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
346 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
347 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
348 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
349 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
350 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
351 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
352 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
353 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
354 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
355 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
356 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
357 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
358 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
359 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
360 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
361 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
362 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
363 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
364 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
365 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
366 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
367 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
368 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
369 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
370 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
371 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
372 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
373 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
374 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
375 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
376 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
377 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
378 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
379 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
380 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
381 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
382 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
383 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
384 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
385 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
386 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
387 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
388 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
389 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
390 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
391 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
392 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.42
Metatranscriptomes 2.58
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.59
Nodule 0
Rhizoplane 7.45
Rhizosphere 83.24
Stem 0
Stem Tuber 0
Unclassified 2.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10227841 3300001990 Bacteria 550
2 JGI24751J29686_10060711 3300002459 Bacteria 779
3 rootH2_10008940 3300003320 Bacteria 20037
4 Ga0055530_10004418 3300003791 Bacteria 7239
5 Ga0055531_10007563 3300003794 Bacteria 5895
6 Ga0055543_1006406 3300004625 Bacteria 2849
7 Ga0065165_1000506 3300005262 Bacteria 60005
8 Ga0065715_10016107 3300005293 Bacteria 1669
9 Ga0070658_10188377 3300005327 Bacteria 1738
10 Ga0070658_10230109 3300005327 Bacteria 1569
11 Ga0070676_10399633 3300005328 Bacteria 956
12 Ga0070683_100374447 3300005329 Bacteria 1357
13 Ga0070690_100876114 3300005330 Bacteria 701
14 Ga0070670_100498310 3300005331 Bacteria 1083
15 Ga0070670_101259609 3300005331 Bacteria 676
16 Ga0068869_100084029 3300005334 Bacteria 2382
17 Ga0070666_10075059 3300005335 Bacteria 2305
18 Ga0070666_10228902 3300005335 Bacteria 1312
19 Ga0070682_100651426 3300005337 Bacteria 838
20 Ga0068868_101311942 3300005338 Bacteria 673
21 Ga0070660_100022840 3300005339 Bacteria 4631
22 Ga0070691_10370003 3300005341 Bacteria 800
23 Ga0070687_100054855 3300005343 Bacteria 2078
24 Ga0070687_100077380 3300005343 Bacteria 1805
25 Ga0070668_100023248 3300005347 Bacteria 4688
26 Ga0070668_100102262 3300005347 Bacteria 2272
27 Ga0070668_100157394 3300005347 Bacteria 1841
28 Ga0070668_100160948 3300005347 Bacteria 1821
29 Ga0070668_100420854 3300005347 Bacteria 1144
30 Ga0070668_100719648 3300005347 Bacteria 881
31 Ga0070669_100068818 3300005353 Bacteria 2614
32 Ga0070669_100094668 3300005353 Bacteria 2245
33 Ga0070669_100448503 3300005353 Bacteria 1063
34 Ga0070675_100087027 3300005354 Bacteria 2612
35 Ga0070675_101088783 3300005354 Bacteria 735
36 Ga0070671_100076706 3300005355 Bacteria 2792
37 Ga0070671_100259862 3300005355 Bacteria 1476
38 Ga0070671_100412268 3300005355 Bacteria 1156
39 Ga0070674_100013740 3300005356 Bacteria 5011
40 Ga0070674_100016168 3300005356 Bacteria 4676
41 Ga0070674_100089577 3300005356 Bacteria 2217
42 Ga0070674_100145116 3300005356 Bacteria 1785
43 Ga0070674_101057155 3300005356 Bacteria 715
44 Ga0070673_100089902 3300005364 Bacteria 2508
45 Ga0070673_101135854 3300005364 Bacteria 731
46 Ga0070673_101316792 3300005364 Bacteria 679
47 Ga0070688_100078874 3300005365 Bacteria 2125
48 Ga0070688_100293376 3300005365 Bacteria 1173
49 Ga0070688_100301413 3300005365 Bacteria 1158
50 Ga0070659_100091198 3300005366 Bacteria 2442
51 Ga0070659_100160715 3300005366 Bacteria 1836
52 Ga0070667_100105642 3300005367 Bacteria 2437
53 Ga0070709_10051037 3300005434 Bacteria 2594
54 Ga0070714_100310697 3300005435 Bacteria 1472
55 Ga0070710_10050631 3300005437 Bacteria 2329
56 Ga0070701_10645572 3300005438 Bacteria 706
57 Ga0070711_100089797 3300005439 Bacteria 2211
58 Ga0070705_100064360 3300005440 Bacteria 2190
59 Ga0070700_100761180 3300005441 Bacteria 776
60 Ga0070694_100076528 3300005444 Bacteria 2317
61 Ga0070708_100971503 3300005445 Bacteria 797
62 Ga0070663_100184639 3300005455 Bacteria 1620
63 Ga0070663_100361999 3300005455 Bacteria 1177
64 Ga0070678_100067859 3300005456 Bacteria 2656
65 Ga0070678_100270022 3300005456 Bacteria 1434
66 Ga0070662_100026862 3300005457 Bacteria 3990
67 Ga0070662_100614966 3300005457 Bacteria 915
68 Ga0070681_10553155 3300005458 Bacteria 1065
69 Ga0068867_100048580 3300005459 Bacteria 3122
70 Ga0068867_100528074 3300005459 Bacteria 1019
71 Ga0068867_102111338 3300005459 Bacteria 534
72 Ga0070685_10425865 3300005466 Bacteria 924
73 Ga0070685_10480609 3300005466 Bacteria 875
74 Ga0070679_100103587 3300005530 Bacteria 2832
75 Ga0070679_101343734 3300005530 Bacteria 661
76 Ga0068853_100018646 3300005539 Bacteria 5744
77 Ga0070672_100075101 3300005543 Bacteria 2698
78 Ga0070672_101136370 3300005543 Bacteria 695
79 Ga0070686_100044273 3300005544 Bacteria 2796
80 Ga0070695_100024268 3300005545 Bacteria 3734
81 Ga0070695_101466947 3300005545 Bacteria 567
82 Ga0070696_100048487 3300005546 Bacteria 2949
83 Ga0070665_100475885 3300005548 Bacteria 1260
84 Ga0070704_100684710 3300005549 Bacteria 908
85 Ga0070704_100739386 3300005549 Bacteria 875
86 Ga0068855_100110325 3300005563 Bacteria 3159
87 Ga0068855_100132525 3300005563 Bacteria 2845
88 Ga0070664_100272853 3300005564 Bacteria 1524
89 Ga0070664_100476143 3300005564 Bacteria 1149
90 Ga0068857_100027092 3300005577 Bacteria 5055
91 Ga0068857_100473947 3300005577 Bacteria 1172
92 Ga0068854_100069033 3300005578 Bacteria 2579
93 Ga0068854_100581583 3300005578 Bacteria 954
94 Ga0068854_101072348 3300005578 Bacteria 717
95 Ga0068856_100059597 3300005614 Bacteria 3770
96 Ga0068856_100789010 3300005614 Bacteria 970
97 Ga0068856_101404428 3300005614 Bacteria 713
98 Ga0070702_100211194 3300005615 Bacteria 1292
99 Ga0070702_100589321 3300005615 Bacteria 832
100 Ga0070702_100611238 3300005615 Bacteria 819
101 Ga0068852_100009389 3300005616 Bacteria 7263
102 Ga0068859_102071481 3300005617 Bacteria 628
103 Ga0068859_102716734 3300005617 Bacteria 544
104 Ga0068864_100766843 3300005618 Bacteria 946
105 Ga0068866_10035180 3300005718 Bacteria 2444
106 Ga0068866_10045031 3300005718 Bacteria 2211
107 Ga0068861_100060641 3300005719 Bacteria 2900
108 Ga0068861_100102933 3300005719 Bacteria 2274
109 Ga0068861_100131442 3300005719 Bacteria 2032
110 Ga0068851_10030591 3300005834 Bacteria 2670
111 Ga0068870_10480352 3300005840 Bacteria 824
112 Ga0068863_100081975 3300005841 Bacteria 3056
113 Ga0068863_100873163 3300005841 Bacteria 899
114 Ga0068860_100135090 3300005843 Bacteria 2368
115 Ga0068860_100177112 3300005843 Bacteria 2061
116 Ga0068860_101459088 3300005843 Bacteria 706
117 Ga0068862_100329836 3300005844 Bacteria 1411
118 Ga0068862_100467020 3300005844 Bacteria 1192
119 Ga0068862_100530458 3300005844 Bacteria 1121
120 Ga0068862_102702895 3300005844 Bacteria 508
121 Ga0081455_10001008 3300005937 Bacteria 35646
122 Ga0081455_10845990 3300005937 Bacteria 572
123 Ga0081540_1000645 3300005983 Bacteria 33098
124 Ga0081540_1000734 3300005983 Bacteria 30203
125 Ga0081540_1006488 3300005983 Bacteria 8508
126 Ga0075365_10013271 3300006038 Bacteria 4917
127 Ga0075365_10211809 3300006038 Bacteria 1358
128 Ga0075368_10002307 3300006042 Bacteria 6194
129 Ga0075368_10072020 3300006042 Bacteria 1397
130 Ga0075363_100031808 3300006048 Bacteria 2737
131 Ga0075363_100077507 3300006048 Bacteria 1814
132 Ga0075363_100446614 3300006048 Bacteria 763
133 Ga0075363_100798400 3300006048 Bacteria 574
134 Ga0075364_10014487 3300006051 Bacteria 4873
135 Ga0075364_10029402 3300006051 Bacteria 3524
136 Ga0070715_10159103 3300006163 Bacteria 1114
137 Ga0070712_100083706 3300006175 Bacteria 2317
138 Ga0075362_10031283 3300006177 Bacteria 2302
139 Ga0075367_10005654 3300006178 Bacteria 6237
140 Ga0075367_10038071 3300006178 Bacteria 2798
141 Ga0075367_10055587 3300006178 Bacteria 2349
142 Ga0075367_10117128 3300006178 Bacteria 1639
143 Ga0075366_10496428 3300006195 Bacteria 754
144 Ga0097621_100206917 3300006237 Bacteria 1705
145 Ga0097621_100512812 3300006237 Bacteria 1087
146 Ga0068871_100043163 3300006358 Bacteria 3622
147 Ga0068871_100278538 3300006358 Bacteria 1463
148 Ga0068871_100354776 3300006358 Bacteria 1298
149 Ga0068871_100458606 3300006358 Bacteria 1143
150 Ga0075428_100008738 3300006844 Bacteria 11235
151 Ga0075428_100009193 3300006844 Bacteria 10965
152 Ga0075428_100121619 3300006844 Bacteria 2843
153 Ga0075430_100025465 3300006846 Bacteria 5033
154 Ga0075430_100299295 3300006846 Bacteria 1331
155 Ga0075430_100628729 3300006846 Bacteria 886
156 Ga0075431_100020387 3300006847 Bacteria 6774
157 Ga0075431_100383853 3300006847 Bacteria 1408
158 Ga0075431_100389398 3300006847 Bacteria 1396
159 Ga0075433_10501974 3300006852 Bacteria 1068
160 Ga0075434_100286014 3300006871 Bacteria 1668
161 Ga0068865_100045722 3300006881 Bacteria 3002
162 Ga0068865_100633562 3300006881 Bacteria 907
163 Ga0068865_101779295 3300006881 Bacteria 556
164 Ga0097620_102071727 3300006931 Bacteria 628
165 Ga0097620_102717067 3300006931 Bacteria 544
166 Ga0075435_100467424 3300007076 Bacteria 1089
167 Ga0075435_100862694 3300007076 Bacteria 789
168 Ga0105240_10350162 3300009093 Bacteria 1676
169 Ga0111539_10209396 3300009094 Bacteria 2272
170 Ga0111539_10588635 3300009094 Bacteria 1296
171 Ga0111539_11048699 3300009094 Bacteria 948
172 Ga0111539_11386889 3300009094 Bacteria 815
173 Ga0105245_10623799 3300009098 Bacteria 1106
174 Ga0105245_10877289 3300009098 Bacteria 938
175 Ga0105247_10140681 3300009101 Bacteria 1581
176 Ga0105247_10291122 3300009101 Bacteria 1130
177 Ga0105247_11876775 3300009101 Bacteria 501
178 Ga0114129_10001848 3300009147 Bacteria 28835
179 Ga0114129_10033141 3300009147 Bacteria 7299
180 Ga0114129_10106272 3300009147 Bacteria 3878
181 Ga0114129_10115748 3300009147 Bacteria 3695
182 Ga0114129_11051375 3300009147 Bacteria 1022
183 Ga0114129_11549916 3300009147 Bacteria 813
184 Ga0114129_12588088 3300009147 Bacteria 606
185 Ga0105243_10325230 3300009148 Bacteria 1403
186 Ga0105243_10501226 3300009148 Bacteria 1150
187 Ga0105243_10820777 3300009148 Bacteria 918
188 Ga0105243_10854576 3300009148 Bacteria 901
189 Ga0105243_11334671 3300009148 Bacteria 736
190 Ga0105243_12586280 3300009148 Bacteria 547
191 Ga0105241_10041066 3300009174 Bacteria 3493
192 Ga0105241_10080308 3300009174 Bacteria 2552
193 Ga0105241_10462779 3300009174 Bacteria 1124
194 Ga0105241_10550767 3300009174 Bacteria 1036
195 Ga0105241_10907020 3300009174 Bacteria 819
196 Ga0105241_11854862 3300009174 Bacteria 590
197 Ga0105242_11464485 3300009176 Bacteria 712
198 Ga0105248_10394603 3300009177 Bacteria 1558
199 Ga0105248_12696804 3300009177 Bacteria 567
200 Ga0105237_10002619 3300009545 Bacteria 22167
201 Ga0105237_10432658 3300009545 Bacteria 1321
202 Ga0105237_11367968 3300009545 Bacteria 714
203 Ga0105237_11651062 3300009545 Bacteria 648
204 Ga0105238_10163151 3300009551 Bacteria 2204
205 Ga0105238_10214223 3300009551 Bacteria 1902
206 Ga0105238_10689867 3300009551 Bacteria 1033
207 Ga0105238_11098052 3300009551 Bacteria 818
208 Ga0105249_10002122 3300009553 Bacteria 17209
209 Ga0105249_10365560 3300009553 Bacteria 1465
210 Ga0105249_10746546 3300009553 Bacteria 1041
211 Ga0105239_10053471 3300010375 Bacteria 4430
212 Ga0105239_10226685 3300010375 Bacteria 2096
213 Ga0105239_10440662 3300010375 Bacteria 1477
214 Ga0105239_12113769 3300010375 Bacteria 654
215 Ga0105246_10150375 3300011119 Bacteria 1762
216 Ga0105246_10285884 3300011119 Bacteria 1325
217 Ga0105246_10294577 3300011119 Bacteria 1307
218 Ga0105246_10322992 3300011119 Bacteria 1255
219 Ga0105246_10691739 3300011119 Bacteria 893
220 Ga0157315_1027020 3300012508 Bacteria 648
221 Ga0157373_10105576 3300013100 Bacteria 1981
222 Ga0157373_10306784 3300013100 Bacteria 1127
223 Ga0157371_10237546 3300013102 Bacteria 1310
224 Ga0157370_10641788 3300013104 Bacteria 971
225 Ga0157369_10323808 3300013105 Bacteria 1602
226 Ga0157369_10858091 3300013105 Bacteria 932
227 Ga0157369_11391374 3300013105 Bacteria 714
228 Ga0157374_11260930 3300013296 Bacteria 761
229 Ga0157374_11404218 3300013296 Bacteria 721
230 Ga0157378_10130670 3300013297 Bacteria 2324
231 Ga0157378_10177698 3300013297 Bacteria 2001
232 Ga0157378_10234922 3300013297 Bacteria 1749
233 Ga0157378_10272888 3300013297 Bacteria 1627
234 Ga0157378_11260127 3300013297 Bacteria 780
235 Ga0163162_10159336 3300013306 Bacteria 2378
236 Ga0163162_10510690 3300013306 Bacteria 1332
237 Ga0163162_11838847 3300013306 Bacteria 693
238 Ga0163162_11957209 3300013306 Bacteria 671
239 Ga0163162_12291817 3300013306 Bacteria 620
240 Ga0157372_10210380 3300013307 Bacteria 2254
241 Ga0157372_11236982 3300013307 Bacteria 862
242 Ga0157375_10011899 3300013308 Bacteria 7698
243 Ga0157375_10106565 3300013308 Bacteria 2895
244 Ga0157375_10120676 3300013308 Bacteria 2730
245 Ga0157375_11623752 3300013308 Bacteria 765
246 Ga0157375_11784236 3300013308 Bacteria 729
247 Ga0163163_10591325 3300014325 Bacteria 1173
248 Ga0157380_10349612 3300014326 Bacteria 1383
249 Ga0157380_11747375 3300014326 Bacteria 680
250 Ga0182008_10073828 3300014497 Bacteria 1678
251 Ga0157377_10184481 3300014745 Bacteria 1314
252 Ga0157379_10467059 3300014968 Bacteria 1167
253 Ga0157379_11164017 3300014968 Bacteria 741
254 Ga0157376_10087464 3300014969 Bacteria 2689
255 Ga0157376_10541565 3300014969 Bacteria 1151
256 Ga0157376_10569693 3300014969 Bacteria 1123
257 Ga0213873_10001663 3300021358 Bacteria 3727
258 Ga0213874_10001065 3300021377 Bacteria 5640
259 Ga0213874_10091819 3300021377 Bacteria 998
260 Ga0213876_10001556 3300021384 Bacteria 14102
261 Ga0213876_10003867 3300021384 Bacteria 8462
262 Ga0213875_10004174 3300021388 Bacteria 7998
263 Ga0213875_10295883 3300021388 Bacteria 765
264 Ga0213871_10163663 3300021441 Bacteria 682
265 Ga0207427_101221 3300025231 Bacteria 9946
266 Ga0209233_1000293 3300025261 Bacteria 63470
267 Ga0207697_10015360 3300025315 Bacteria 3165
268 Ga0207653_10284219 3300025885 Bacteria 639
269 Ga0207682_10008798 3300025893 Bacteria 3992
270 Ga0207642_10043600 3300025899 Bacteria 1980
271 Ga0207710_10039456 3300025900 Bacteria 2090
272 Ga0207688_10458048 3300025901 Bacteria 796
273 Ga0207680_10139028 3300025903 Bacteria 1608
274 Ga0207680_10282532 3300025903 Bacteria 1153
275 Ga0207685_10034067 3300025905 Bacteria 1847
276 Ga0207699_11210720 3300025906 Bacteria 559
277 Ga0207645_10057305 3300025907 Bacteria 2487
278 Ga0207645_10551560 3300025907 Bacteria 782
279 Ga0207643_10060863 3300025908 Bacteria 2156
280 Ga0207705_10289316 3300025909 Bacteria 1255
281 Ga0207654_10093465 3300025911 Bacteria 1839
282 Ga0207654_10465931 3300025911 Bacteria 888
283 Ga0207707_11431672 3300025912 Bacteria 550
284 Ga0207695_10798270 3300025913 Bacteria 824
285 Ga0207671_10001074 3300025914 Bacteria 33173
286 Ga0207693_10029468 3300025915 Bacteria 4335
287 Ga0207663_10208642 3300025916 Bacteria 1414
288 Ga0207660_10276744 3300025917 Bacteria 1331
289 Ga0207662_10072813 3300025918 Bacteria 2083
290 Ga0207662_10080323 3300025918 Bacteria 1989
291 Ga0207657_10008060 3300025919 Bacteria 10742
292 Ga0207657_10041042 3300025919 Bacteria 4094
293 Ga0207652_10084553 3300025921 Bacteria 2780
294 Ga0207681_10106382 3300025923 Bacteria 2033
295 Ga0207681_10471418 3300025923 Bacteria 1024
296 Ga0207681_10912793 3300025923 Bacteria 736
297 Ga0207694_10403009 3300025924 Bacteria 1137
298 Ga0207694_10578208 3300025924 Bacteria 944
299 Ga0207650_10268470 3300025925 Bacteria 1386
300 Ga0207650_10848464 3300025925 Bacteria 775
301 Ga0207659_10185582 3300025926 Bacteria 1651
302 Ga0207687_10716317 3300025927 Bacteria 850
303 Ga0207700_10172544 3300025928 Bacteria 1805
304 Ga0207664_10532410 3300025929 Bacteria 1053
305 Ga0207644_10098952 3300025931 Bacteria 2187
306 Ga0207644_10882029 3300025931 Bacteria 749
307 Ga0207690_10027349 3300025932 Bacteria 3604
308 Ga0207690_10591819 3300025932 Bacteria 905
309 Ga0207690_11682718 3300025932 Bacteria 530
310 Ga0207706_10016619 3300025933 Bacteria 6641
311 Ga0207706_10087563 3300025933 Bacteria 2739
312 Ga0207686_10325945 3300025934 Bacteria 1149
313 Ga0207686_10494202 3300025934 Bacteria 948
314 Ga0207670_10255040 3300025936 Bacteria 1357
315 Ga0207669_10006486 3300025937 Bacteria 5353
316 Ga0207669_10029206 3300025937 Bacteria 3046
317 Ga0207669_10087837 3300025937 Bacteria 2015
318 Ga0207704_10099740 3300025938 Bacteria 1932
319 Ga0207691_10002002 3300025940 Bacteria 19933
320 Ga0207691_10709187 3300025940 Bacteria 848
321 Ga0207689_10030049 3300025942 Bacteria 4530
322 Ga0207689_10211473 3300025942 Bacteria 1602
323 Ga0207689_10410290 3300025942 Bacteria 1130
324 Ga0207689_10743840 3300025942 Bacteria 827
325 Ga0207661_10340521 3300025944 Bacteria 1351
326 Ga0207679_10392666 3300025945 Bacteria 1219
327 Ga0207679_11643358 3300025945 Bacteria 588
328 Ga0207679_11712485 3300025945 Bacteria 575
329 Ga0207667_10002756 3300025949 Bacteria 21724
330 Ga0207667_10599337 3300025949 Bacteria 1111
331 Ga0207651_10114925 3300025960 Bacteria 2028
332 Ga0207651_10367600 3300025960 Bacteria 1216
333 Ga0207651_10440773 3300025960 Bacteria 1116
334 Ga0207712_10135791 3300025961 Bacteria 1881
335 Ga0207712_10627168 3300025961 Bacteria 932
336 Ga0207668_10121024 3300025972 Bacteria 1982
337 Ga0207668_10222582 3300025972 Bacteria 1516
338 Ga0207668_10435856 3300025972 Bacteria 1115
339 Ga0207668_11104882 3300025972 Bacteria 711
340 Ga0207668_11857854 3300025972 Bacteria 543
341 Ga0207640_10258938 3300025981 Bacteria 1354
342 Ga0207640_10674701 3300025981 Bacteria 883
343 Ga0207658_10024826 3300025986 Bacteria 4195
344 Ga0207639_10007867 3300026041 Bacteria 7280
345 Ga0207639_10030355 3300026041 Bacteria 3964
346 Ga0207639_11034253 3300026041 Bacteria 770
347 Ga0207678_10050919 3300026067 Bacteria 3577
348 Ga0207678_10061242 3300026067 Bacteria 3237
349 Ga0207678_10109637 3300026067 Bacteria 2355
350 Ga0207678_10174871 3300026067 Bacteria 1833
351 Ga0207678_10639362 3300026067 Bacteria 934
352 Ga0207708_10079350 3300026075 Bacteria 2521
353 Ga0207708_10432885 3300026075 Bacteria 1093
354 Ga0207708_10467344 3300026075 Bacteria 1053
355 Ga0207702_10646157 3300026078 Bacteria 1040
356 Ga0207702_11373941 3300026078 Bacteria 700
357 Ga0207641_11623367 3300026088 Bacteria 648
358 Ga0207648_10065236 3300026089 Bacteria 3174
359 Ga0207648_10474669 3300026089 Bacteria 1142
360 Ga0207648_10678657 3300026089 Bacteria 954
361 Ga0207648_11158715 3300026089 Bacteria 726
362 Ga0207676_10324571 3300026095 Bacteria 1414
363 Ga0207674_10049517 3300026116 Bacteria 4296
364 Ga0207674_10082512 3300026116 Bacteria 3216
365 Ga0207675_100066743 3300026118 Bacteria 3363
366 Ga0207675_100106057 3300026118 Bacteria 2649
367 Ga0207675_100260892 3300026118 Bacteria 1679
368 Ga0207683_10028928 3300026121 Bacteria 4795
369 Ga0207683_10088805 3300026121 Bacteria 2751
370 Ga0207683_10191288 3300026121 Bacteria 1858
371 Ga0207698_10505329 3300026142 Bacteria 1177
372 Ga0207698_11530459 3300026142 Bacteria 682
373 Ga0209813_10001475 3300027866 Bacteria 5291
374 Ga0209813_10012003 3300027866 Bacteria 2278
375 Ga0207428_10340682 3300027907 Bacteria 1104
376 Ga0268266_10000321 3300028379 Bacteria 75565
377 Ga0268266_10202672 3300028379 Bacteria 1816
378 Ga0268266_11539093 3300028379 Bacteria 641
379 Ga0268265_11016917 3300028380 Bacteria 819
380 Ga0268265_11057408 3300028380 Bacteria 804
381 Ga0268264_10291787 3300028381 Bacteria 1532
382 Ga0268264_11752435 3300028381 Bacteria 631
383 Ga0265332_10109621 3300031238 Bacteria 1163
384 Ga0265325_10113444 3300031241 Bacteria 1314
385 Ga0265340_10137776 3300031247 Bacteria 1117
386 Ga0265340_10139947 3300031247 Bacteria 1107
387 Ga0265340_10232471 3300031247 Bacteria 824
388 Ga0265339_10150081 3300031249 Bacteria 1179
389 Ga0265339_10490976 3300031249 Bacteria 568
390 Ga0265331_10014022 3300031250 Bacteria 4284
391 Ga0265331_10030202 3300031250 Bacteria 2699
392 Ga0265327_10073433 3300031251 Bacteria 1706
393 Ga0265313_10126730 3300031595 Bacteria 1109
394 Ga0316579_10104827 3300031691 Bacteria 1355
395 Ga0265314_10170794 3300031711 Bacteria 1313
396 Ga0307405_10123306 3300031731 Bacteria 1777
397 Ga0307405_11454068 3300031731 Bacteria 601
398 Ga0316577_10030400 3300031733 Bacteria 3016
399 Ga0307410_10228305 3300031852 Bacteria 1436
400 Ga0307406_10237184 3300031901 Bacteria 1366
401 Ga0307412_10244933 3300031911 Bacteria 1389
402 Ga0307412_10822154 3300031911 Bacteria 808
403 Ga0307412_10906346 3300031911 Bacteria 773
404 Ga0307409_100307063 3300031995 Bacteria 1479
405 Ga0307409_100575912 3300031995 Bacteria 1109
406 Ga0307416_100293889 3300032002 Bacteria 1610
407 Ga0307416_101707444 3300032002 Bacteria 734
408 Ga0307414_10201119 3300032004 Bacteria 1620
409 Ga0307414_10270591 3300032004 Bacteria 1422
410 Ga0307414_10287108 3300032004 Bacteria 1385
411 Ga0307414_11575382 3300032004 Bacteria 612
412 Ga0307411_11426780 3300032005 Bacteria 634
413 Ga0316593_10001756 3300032168 Bacteria 4918
414 Ga0316593_10405327 3300032168 Bacteria 527
415 Ga0316592_1021521 3300033524 Bacteria 1374
416 Ga0316596_1001896 3300033541 Bacteria 4374
417 Ga0373948_0029351 3300034817 Bacteria 1100
418 Ga0373958_0011963 3300034819 Bacteria 1477
419 Ga0373938_0116204 3300034957 Bacteria 685
420 Ga0373938_0151715 3300034957 Bacteria 617
421 Ga0373926_0306060 3300035083 Bacteria 621
422 Ga0373928_0070076 3300035084 Bacteria 865
423 Ga0373934_0189680 3300035086 Bacteria 845
424 Ga0373944_0007536 3300035089 Bacteria 2919
425 Ga0373949_0012177 3300035090 Bacteria 1900
426 Ga0373951_0006195 3300035091 Bacteria 2742
427 Ga0373923_0009752 3300035111 Bacteria 3472
428 Ga0373932_0015007 3300035112 Bacteria 1958
429 Ga0373932_0180157 3300035112 Bacteria 741
430 Ga0373936_0007704 3300035113 Bacteria 4044
431 Ga0373939_0057027 3300035114 Bacteria 1231
432 Ga0373939_0190063 3300035114 Bacteria 771
433 Ga0373939_0319300 3300035114 Bacteria 624
434 Ga0373941_0049230 3300035115 Bacteria 1333
435 Ga0373953_0131988 3300035117 Bacteria 1065
436 Ga0373954_0017164 3300035118 Bacteria 3246
437 Ga0373956_0002024 3300035119 Bacteria 8399
438 Ga0373957_0047796 3300035120 Bacteria 1628
439 Ga0373960_0044925 3300035121 Bacteria 1291
440 Ga0373943_0118430 3300035170 Bacteria 1405
441 Ga0373946_0389032 3300035171 Bacteria 702
442 Ga0373942_0037200 3300035207 Bacteria 1314
443 Ga0373942_0045379 3300035207 Bacteria 1214
444 Ga0373961_0008082 3300035241 Bacteria 2556
445 Ga0373962_0004622 3300035242 Bacteria 3328
446 Ga0373962_0055407 3300035242 Bacteria 1152
447 Ga0316574_0220696 3300035398 Bacteria 1215
448 Ga0373931_0002939 3300035691 Bacteria 7603
449 Ga0373931_0073097 3300035691 Bacteria 1876
450 Ga0373931_0366445 3300035691 Bacteria 905
451 Ga0373935_1406871 3300035692 Bacteria 521
452 Ga0373927_0062132 3300035695 Bacteria 2415
453 Ga0373927_1017743 3300035695 Bacteria 546
454 Ga0373933_0002755 3300035724 Bacteria 9806
455 Ga0373947_0028367 3300035725 Bacteria 3281
456 Ga0373937_0005145 3300036401 Bacteria 11151
457 Ga0373925_0052266 3300037068 Bacteria 3052
458 Ga0395899_0176446 3300037312 Bacteria 1502
459 Ga0395900_0820320 3300037418 Bacteria 857
460 Ga0436364_0013783 3300037853 Bacteria 29941
461 Ga0436364_0082147 3300037853 Bacteria 4075
462 Ga0436364_1091066 3300037853 Bacteria 1438
463 Ga0395901_0507376 3300038443 Bacteria 1227
464 Ga0395901_1272046 3300038443 Bacteria 698
465 Ga0436365_0675022 3300039437 Bacteria 1323
466 Ga0436365_1082399 3300039437 Bacteria 1188
467 Ga0436365_1136540 3300039437 Bacteria 40433
468 Ga0436365_1253031 3300039437 Bacteria 47093
469 Ga0436360_0200295 3300039438 Bacteria 1091
470 Ga0436363_0121335 3300039450 Bacteria 5796
471 Ga0436363_0746062 3300039450 Bacteria 9943
472 Ga0436362_0941402 3300039453 Bacteria 4603
473 Ga0451800_0588366 3300041459 Bacteria 539
474 Ga0451849_0727082 3300041505 Bacteria 595
475 Ga0439455_0203462 3300042012 Bacteria 573
476 Ga0439446_0159324 3300042156 Bacteria 746
477 Ga0439458_0113097 3300042157 Bacteria 711
478 Ga0439434_0099164 3300042435 Bacteria 938
479 Ga0439434_0306687 3300042435 Bacteria 549
480 Ga0439459_0034184 3300042438 Bacteria 1050
481 Ga0439459_0098213 3300042438 Bacteria 713
482 Ga0439464_0228099 3300042439 Bacteria 598
483 Ga0439464_0257175 3300042439 Bacteria 565
484 Ga0466964_0245847 3300044706 Bacteria 880
485 Ga0453684_0923212 3300044712 Bacteria 933
486 Ga0451576_1467352 3300045051 Bacteria 709
487 Ga0495603_0018592 3300046455 Bacteria 4204
488 Ga0495629_0055859 3300046459 Bacteria 2761
489 Ga0495641_0018852 3300046461 Bacteria 3548
490 Ga0495651_0001390 3300046462 Bacteria 18780
491 Ga0495653_0003820 3300046463 Bacteria 12184
492 Ga0495605_0235909 3300046474 Bacteria 786
493 Ga0495639_0017560 3300046475 Bacteria 3109
494 Ga0495662_0202270 3300046476 Bacteria 979
495 Ga0495664_0003117 3300046477 Bacteria 9004
496 Ga0495664_0598038 3300046477 Bacteria 655
497 Ga0495584_0027432 3300046491 Bacteria 2886
498 Ga0495618_0006824 3300046514 Bacteria 6914
499 Ga0495628_0002285 3300046516 Bacteria 17341
500 Ga0495630_0251052 3300046517 Bacteria 1351
501 Ga0495644_0239872 3300046523 Bacteria 703
502 Ga0495663_0035043 3300046525 Bacteria 1506
503 Ga0495666_0298423 3300046526 Bacteria 729
504 Ga0495652_0030282 3300046529 Bacteria 4747
505 Ga0495665_0370602 3300046531 Bacteria 728
506 Ga0495640_0004112 3300046533 Bacteria 11640
507 Ga0495586_0080681 3300046535 Bacteria 1787
508 Ga0495587_0001073 3300046536 Bacteria 17964
509 Ga0495645_0046486 3300046543 Bacteria 3163
510 Ga0495645_0326268 3300046543 Bacteria 995
511 Ga0495622_0018184 3300046557 Bacteria 3274
512 Ga0495667_0013645 3300046559 Bacteria 5492
513 Ga0495656_0023382 3300046615 Bacteria 2432
514 Ga0495668_0128220 3300046616 Bacteria 1389
515 Ga0495668_0205261 3300046616 Bacteria 1079
516 Ga0495625_0116698 3300046660 Bacteria 1820
517 Ga0495625_0540551 3300046660 Bacteria 707
518 Ga0495635_0151203 3300046663 Bacteria 1580
519 Ga0495588_0433890 3300046674 Bacteria 689
520 Ga0495599_0006958 3300046678 Bacteria 6841
521 Ga0495623_0000858 3300046679 Bacteria 20593
522 Ga0495658_0019075 3300046683 Bacteria 3575
523 Ga0495624_0402695 3300046690 Bacteria 821
524 Ga0495589_0394292 3300046794 Bacteria 636
525 Ga0495600_0025274 3300046809 Bacteria 3827
526 Ga0495581_0346976 3300047315 Bacteria 866
527 Ga0495604_0016633 3300047317 Bacteria 5881
528 Ga0495674_0026345 3300047319 Bacteria 5319
529 Ga0495676_0196414 3300047321 Bacteria 1404
530 Ga0495680_0166049 3300047322 Bacteria 1600
531 Ga0495675_0004449 3300047444 Bacteria 8477
532 Ga0495685_151400 3300047447 Bacteria 753
533 Ga0495684_0101459 3300047471 Bacteria 2175
534 Ga0495593_0215573 3300047673 Bacteria 963
535 Ga0495602_0005814 3300048088 Bacteria 12947
536 Ga0495614_0047303 3300048089 Bacteria 1845
537 Ga0495615_0010635 3300048090 Bacteria 1846
538 Ga0496100_0040182 3300048903 Bacteria 2974
539 Ga0496100_0277972 3300048903 Bacteria 1247
540 Ga0496100_0462045 3300048903 Bacteria 974
541 Ga0496101_0039133 3300048904 Bacteria 3370
542 Ga0496101_0044118 3300048904 Bacteria 3190
543 Ga0496102_0174294 3300048905 Bacteria 2025
544 Ga0496102_1662577 3300048905 Bacteria 556
545 Ga0496102_1732784 3300048905 Bacteria 542
546 Ga0496103_0132575 3300048906 Bacteria 1591
547 Ga0496104_0000088 3300048907 Bacteria 88904
548 Ga0496104_0023841 3300048907 Bacteria 5627
549 Ga0496104_0028047 3300048907 Bacteria 5216
550 Ga0496104_0030947 3300048907 Bacteria 4975
551 Ga0496105_0047392 3300048908 Bacteria 3547
552 Ga0496105_0284621 3300048908 Bacteria 1332
553 Ga0496105_0365399 3300048908 Bacteria 1150
554 Ga0496105_0602574 3300048908 Bacteria 852
555 Ga0496105_0978370 3300048908 Bacteria 634
556 Ga0496106_0261457 3300048909 Bacteria 1385
557 Ga0496106_0585041 3300048909 Bacteria 894
558 Ga0496107_0003748 3300048910 Bacteria 10211
559 Ga0496107_0053847 3300048910 Bacteria 2902
560 Ga0496108_0002261 3300048911 Bacteria 15425
561 Ga0496108_0010640 3300048911 Bacteria 7463
562 Ga0496108_0177620 3300048911 Bacteria 1844
563 Ga0496109_0061535 3300048912 Bacteria 3432
564 Ga0496109_0087108 3300048912 Bacteria 2884
565 Ga0496109_0113087 3300048912 Bacteria 2525
566 Ga0496109_0200576 3300048912 Bacteria 1875
567 Ga0496109_0717742 3300048912 Bacteria 937
568 Ga0496110_0000247 3300048913 Bacteria 35042
569 Ga0496110_0234157 3300048913 Bacteria 1671
570 Ga0496110_0246820 3300048913 Bacteria 1625
571 Ga0496111_0010748 3300048914 Bacteria 6155
572 Ga0496111_0278741 3300048914 Bacteria 1240
573 Ga0496111_0792183 3300048914 Bacteria 686
574 Ga0496112_0035456 3300048915 Bacteria 4860
575 Ga0496112_0512116 3300048915 Bacteria 1135
576 Ga0496112_1351931 3300048915 Bacteria 627
577 Ga0496112_1411252 3300048915 Bacteria 611
578 Ga0496112_1478971 3300048915 Bacteria 593
579 Ga0496112_1794876 3300048915 Bacteria 525
580 Ga0496113_0001313 3300048916 Bacteria 13743
581 Ga0496113_0930206 3300048916 Bacteria 687
582 Ga0496113_1426100 3300048916 Bacteria 536
583 Ga0496114_0007247 3300048917 Bacteria 8760
584 Ga0496114_0170118 3300048917 Bacteria 1898
585 Ga0496114_0236348 3300048917 Bacteria 1606
586 Ga0496114_0372429 3300048917 Bacteria 1264
587 Ga0496115_0246525 3300048918 Bacteria 1471
588 Ga0496115_0259984 3300048918 Bacteria 1428
589 Ga0496121_0163832 3300048924 Bacteria 1623
590 Ga0496125_0431873 3300048928 Bacteria 760
591 Ga0501312_117548 3300049528 Bacteria 512
592 Ga0501314_047503 3300049530 Bacteria 513
593 Ga0501031_0313306 3300049568 Bacteria 1017
594 Ga0501033_0223246 3300049570 Bacteria 1340
595 Ga0501034_0360779 3300049571 Bacteria 1380
596 Ga0501034_0578963 3300049571 Bacteria 1030
597 Ga0501034_0649337 3300049571 Bacteria 957
598 Ga0501036_0823045 3300049572 Bacteria 764
599 Ga0501037_0158178 3300049573 Bacteria 1616
600 Ga0501038_0084772 3300049574 Bacteria 2666
601 Ga0501038_0252317 3300049574 Bacteria 1397
602 Ga0501038_0890604 3300049574 Bacteria 657
603 Ga0501039_0019036 3300049575 Bacteria 5268
604 Ga0501039_0702342 3300049575 Bacteria 791
605 Ga0501041_0200918 3300049577 Bacteria 1249
606 Ga0501043_0172472 3300049579 Bacteria 1687
607 Ga0501043_0418395 3300049579 Bacteria 1010
608 Ga0501046_0065905 3300049580 Bacteria 2824
609 Ga0501047_0418013 3300049581 Bacteria 1172
610 Ga0501047_0467263 3300049581 Bacteria 1090
611 Ga0501048_0000501 3300049582 Bacteria 27413
612 Ga0501048_0121695 3300049582 Bacteria 1844
613 Ga0501068_0543316 3300049584 Bacteria 755
614 Ga0501068_0860573 3300049584 Bacteria 596
615 Ga0501070_0590375 3300049586 Bacteria 886
616 Ga0501071_0648387 3300049587 Bacteria 812
617 Ga0501071_1590986 3300049587 Bacteria 504
618 Ga0501072_0008237 3300049588 Bacteria 7920
619 Ga0501073_0039915 3300049589 Bacteria 3324
620 Ga0501073_0064968 3300049589 Bacteria 2545
621 Ga0501075_0032918 3300049591 Bacteria 3855
622 Ga0501075_0796527 3300049591 Bacteria 719
623 Ga0501076_0104572 3300049592 Bacteria 2284
624 Ga0501077_0068868 3300049593 Bacteria 2243
625 Ga0501079_0063290 3300049741 Bacteria 2854
626 Ga0501079_0196121 3300049741 Bacteria 1576
627 Ga0501080_0039373 3300049742 Bacteria 4412
628 Ga0501080_0469768 3300049742 Bacteria 1126
629 Ga0501080_0684087 3300049742 Bacteria 906
630 Ga0501081_0097039 3300049743 Bacteria 2079
631 Ga0501081_0693041 3300049743 Bacteria 765
632 Ga0501081_1251931 3300049743 Bacteria 562
633 Ga0501083_0224809 3300049744 Bacteria 1223
634 Ga0501083_0308383 3300049744 Bacteria 1029
635 Ga0501035_0004418 3300049822 Bacteria 13348
636 Ga0501035_0440251 3300049822 Bacteria 1079
637 Ga0501044_0149205 3300049823 Bacteria 2321
638 Ga0501044_0317755 3300049823 Bacteria 1482
639 Ga0501044_1522873 3300049823 Bacteria 534
640 Ga0501045_0004375 3300049824 Bacteria 9740
641 Ga0501045_0169887 3300049824 Bacteria 1624
642 nmdc:mga03683_33689_c1 3300050489 Bacteria 2069
643 nmdc:mga03n38_191549_c1 3300050490 Bacteria 1054
644 nmdc:mga03n38_24560_c1 3300050490 Bacteria 2465
645 nmdc:mga0yw44_1180623_c1 3300050492 Bacteria 516
646 nmdc:mga0yw44_263960_c1 3300050492 Bacteria 1148
647 nmdc:mga0yw44_716274_c1 3300050492 Bacteria 680
648 nmdc:mga06z11_3658_c1 3300050494 Bacteria 5969
649 nmdc:mga06z11_4901_c1 3300050494 Bacteria 5311
650 nmdc:mga04h51_294867_c1 3300050495 Bacteria 660
651 nmdc:mga04h51_4045_c1 3300050495 Bacteria 3615
652 nmdc:mga04h51_8312_c1 3300050495 Bacteria 2276
653 nmdc:mga07m45_410029_c1 3300050496 Bacteria 786
654 nmdc:mga07m45_493059_c1 3300050496 Bacteria 709
655 nmdc:mga07m45_621348_c1 3300050496 Bacteria 623
656 nmdc:mga05p37_1734867_c1 3300050507 Bacteria 606
657 nmdc:mga05p37_469266_c1 3300050507 Bacteria 1453
658 nmdc:mga05p37_494293_c1 3300050507 Bacteria 1406
659 nmdc:mga05p37_520166_c1 3300050507 Bacteria 1361
660 nmdc:mga0qj67_4050_c1 3300050509 Bacteria 10619
661 nmdc:mga0qj67_55208_c1 3300050509 Bacteria 3146
662 nmdc:mga06r32_15718_c1 3300050510 Bacteria 6877
663 nmdc:mga06r32_276680_c1 3300050510 Bacteria 1666
664 nmdc:mga06r32_290482_c1 3300050510 Bacteria 1622
665 nmdc:mga08y16_397612_c1 3300050511 Bacteria 1411
666 nmdc:mga08y16_496760_c1 3300050511 Bacteria 1240
667 nmdc:mga08y16_704644_c1 3300050511 Bacteria 1009
668 nmdc:mga0n895_49974_c1 3300050512 Bacteria 4099
669 nmdc:mga0n895_781857_c1 3300050512 Bacteria 946
670 nmdc:mga0rr50_81104_c1 3300050513 Bacteria 2503
671 Ga0495601_0000869 3300053077 Bacteria 16487
672 Ga0495601_0004843 3300053077 Bacteria 7807
673 Ga0495612_0022193 3300053078 Bacteria 2544
674 Ga0495612_0024354 3300053078 Bacteria 2429
675 Ga0495595_0001114 3300053084 Bacteria 10394
676 Ga0495619_0058599 3300053085 Bacteria 2557
677 Ga0500554_244895 3300053102 Bacteria 592
678 Ga0500555_034637 3300053103 Bacteria 1421
679 Ga0500556_0000636 3300053104 Bacteria 22036
680 Ga0500562_006251 3300053108 Bacteria 3005
681 Ga0500618_012222 3300053125 Bacteria 2252
682 Ga0500604_0000294 3300053151 Bacteria 13881
683 Ga0500634_0000031 3300053161 Bacteria 75547
684 Ga0500645_176473 3300053730 Bacteria 582
685 Ga0501084_0002334 3300054114 Bacteria 15249
686 Ga0587070_092728 3300059491 Bacteria 682
687 Ga0587077_141000 3300059493 Bacteria 621
688 Ga0587083_0162689 3300059505 Bacteria 612
689 Ga0587085_114071 3300059506 Bacteria 586
690 Ga0587090_132170 3300059510 Bacteria 551
691 Ga0587106_024404 3300059605 Bacteria 925
692 Ga0587117_119745 3300059627 Bacteria 520
693 Ga0587068_010137 3300059641 Bacteria 1400
694 Ga0587076_083926 3300059645 Bacteria 685
695 Ga0587114_032785 3300059655 Bacteria 804
696 Ga0587124_030979 3300059660 Bacteria 591
697 Ga0587111_0126619 3300060346 Bacteria 663
698 Ga0501082_0420320 3300060353 Bacteria 1167

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049571 Ga0501034_0649337 Ga0501034_0649337_13_585 128
2 3300003791 Ga0055530_10004418 Ga0055530_100044189 137
3 3300003794 Ga0055531_10007563 Ga0055531_100075631 137
4 3300004625 Ga0055543_1006406 Ga0055543_10064062 137
5 3300005262 Ga0065165_1000506 Ga0065165_10005069 137
6 3300032168 Ga0316593_10001756 Ga0316593_100017567 137
7 3300041459 Ga0451800_0588366 Ga0451800_0588366_16_441 138
8 3300005347 Ga0070668_100719648 Ga0070668_1007196482 139
9 3300005455 Ga0070663_100361999 Ga0070663_1003619991 139
10 3300005459 Ga0068867_102111338 Ga0068867_1021113381 139
11 3300005615 Ga0070702_100611238 Ga0070702_1006112381 139
12 3300005937 Ga0081455_10001008 Ga0081455_1000100817 139
13 3300005937 Ga0081455_10845990 Ga0081455_108459902 139
14 3300009551 Ga0105238_10689867 Ga0105238_106898672 139
15 3300011119 Ga0105246_10285884 Ga0105246_102858843 139
16 3300013306 Ga0163162_10159336 Ga0163162_101593363 139
17 3300013307 Ga0157372_10210380 Ga0157372_102103802 139
18 3300021358 Ga0213873_10001663 Ga0213873_100016634 139
19 3300021377 Ga0213874_10001065 Ga0213874_100010651 139
20 3300021377 Ga0213874_10091819 Ga0213874_100918191 139
21 3300021384 Ga0213876_10001556 Ga0213876_100015568 139
22 3300021384 Ga0213876_10003867 Ga0213876_1000386714 139
23 3300021388 Ga0213875_10004174 Ga0213875_100041746 139
24 3300021388 Ga0213875_10295883 Ga0213875_102958832 139
25 3300021441 Ga0213871_10163663 Ga0213871_101636631 139
26 3300037853 Ga0436364_0013783 Ga0436364_0013783_5807_6232 139
27 3300037853 Ga0436364_0082147 Ga0436364_0082147_3026_3451 139
28 3300037853 Ga0436364_1091066 Ga0436364_1091066_396_821 139
29 3300039437 Ga0436365_0675022 Ga0436365_0675022_493_918 139
30 3300039437 Ga0436365_1136540 Ga0436365_1136540_21003_21428 139
31 3300039437 Ga0436365_1253031 Ga0436365_1253031_29468_29893 139
32 3300039438 Ga0436360_0200295 Ga0436360_0200295_529_954 139
33 3300039450 Ga0436363_0121335 Ga0436363_0121335_3190_3615 139
34 3300039450 Ga0436363_0746062 Ga0436363_0746062_331_756 139
35 3300039453 Ga0436362_0941402 Ga0436362_0941402_1338_1763 139
36 3300049528 Ga0501312_117548 Ga0501312_117548_67_495 139
37 3300049571 Ga0501034_0360779 Ga0501034_0360779_470_895 139
38 3300049573 Ga0501037_0158178 Ga0501037_0158178_73_498 139
39 3300049574 Ga0501038_0890604 Ga0501038_0890604_82_507 139
40 3300049575 Ga0501039_0702342 Ga0501039_0702342_285_710 139
41 3300049579 Ga0501043_0418395 Ga0501043_0418395_317_742 139
42 3300049581 Ga0501047_0418013 Ga0501047_0418013_512_937 139
43 3300049589 Ga0501073_0039915 Ga0501073_0039915_61_486 139
44 3300049742 Ga0501080_0469768 Ga0501080_0469768_630_1055 139
45 3300049822 Ga0501035_0004418 Ga0501035_0004418_3054_3479 139
46 3300049823 Ga0501044_0317755 Ga0501044_0317755_802_1227 139
47 3300005330 Ga0070690_100876114 Ga0070690_1008761141 140
48 3300005347 Ga0070668_100157394 Ga0070668_1001573942 140
49 3300005347 Ga0070668_100420854 Ga0070668_1004208542 140
50 3300005354 Ga0070675_101088783 Ga0070675_1010887831 140
51 3300005356 Ga0070674_100013740 Ga0070674_1000137405 140
52 3300005356 Ga0070674_101057155 Ga0070674_1010571552 140
53 3300005364 Ga0070673_100089902 Ga0070673_1000899021 140
54 3300005441 Ga0070700_100761180 Ga0070700_1007611801 140
55 3300005444 Ga0070694_100076528 Ga0070694_1000765282 140
56 3300005543 Ga0070672_100075101 Ga0070672_1000751014 140
57 3300005545 Ga0070695_100024268 Ga0070695_1000242684 140
58 3300005617 Ga0068859_102716734 Ga0068859_1027167341 140
59 3300005719 Ga0068861_100060641 Ga0068861_1000606412 140
60 3300005719 Ga0068861_100102933 Ga0068861_1001029333 140
61 3300005841 Ga0068863_100873163 Ga0068863_1008731632 140
62 3300005843 Ga0068860_100135090 Ga0068860_1001350902 140
63 3300005844 Ga0068862_100530458 Ga0068862_1005304582 140
64 3300005983 Ga0081540_1000645 Ga0081540_100064528 140
65 3300005983 Ga0081540_1006488 Ga0081540_100648814 140
66 3300006038 Ga0075365_10013271 Ga0075365_100132714 140
67 3300006038 Ga0075365_10211809 Ga0075365_102118092 140
68 3300006042 Ga0075368_10002307 Ga0075368_100023072 140
69 3300006042 Ga0075368_10072020 Ga0075368_100720202 140
70 3300006048 Ga0075363_100031808 Ga0075363_1000318082 140
71 3300006048 Ga0075363_100077507 Ga0075363_1000775072 140
72 3300006048 Ga0075363_100446614 Ga0075363_1004466142 140
73 3300006051 Ga0075364_10014487 Ga0075364_100144876 140
74 3300006051 Ga0075364_10029402 Ga0075364_100294023 140
75 3300006178 Ga0075367_10005654 Ga0075367_100056542 140
76 3300006178 Ga0075367_10038071 Ga0075367_100380713 140
77 3300006178 Ga0075367_10055587 Ga0075367_100555873 140
78 3300006178 Ga0075367_10117128 Ga0075367_101171282 140
79 3300006195 Ga0075366_10496428 Ga0075366_104964282 140
80 3300006358 Ga0068871_100354776 Ga0068871_1003547762 140
81 3300006844 Ga0075428_100008738 Ga0075428_10000873812 140
82 3300006844 Ga0075428_100009193 Ga0075428_1000091932 140
83 3300006844 Ga0075428_100121619 Ga0075428_1001216192 140
84 3300006846 Ga0075430_100025465 Ga0075430_1000254655 140
85 3300006846 Ga0075430_100299295 Ga0075430_1002992951 140
86 3300006846 Ga0075430_100628729 Ga0075430_1006287291 140
87 3300006847 Ga0075431_100383853 Ga0075431_1003838532 140
88 3300006847 Ga0075431_100389398 Ga0075431_1003893981 140
89 3300006852 Ga0075433_10501974 Ga0075433_105019742 140
90 3300006881 Ga0068865_101779295 Ga0068865_1017792952 140
91 3300006931 Ga0097620_102717067 Ga0097620_1027170671 140
92 3300007076 Ga0075435_100862694 Ga0075435_1008626942 140
93 3300009094 Ga0111539_10209396 Ga0111539_102093962 140
94 3300009094 Ga0111539_10588635 Ga0111539_105886352 140
95 3300009094 Ga0111539_11048699 Ga0111539_110486991 140
96 3300009094 Ga0111539_11386889 Ga0111539_113868892 140
97 3300009101 Ga0105247_11876775 Ga0105247_118767751 140
98 3300009147 Ga0114129_10106272 Ga0114129_101062722 140
99 3300009147 Ga0114129_10115748 Ga0114129_101157481 140
100 3300009147 Ga0114129_11051375 Ga0114129_110513751 140
101 3300009148 Ga0105243_12586280 Ga0105243_125862801 140
102 3300009174 Ga0105241_11854862 Ga0105241_118548621 140
103 3300009553 Ga0105249_10746546 Ga0105249_107465461 140
104 3300013105 Ga0157369_10323808 Ga0157369_103238082 140
105 3300013297 Ga0157378_11260127 Ga0157378_112601271 140
106 3300013306 Ga0163162_11838847 Ga0163162_118388471 140
107 3300013306 Ga0163162_12291817 Ga0163162_122918171 140
108 3300014325 Ga0163163_10591325 Ga0163163_105913252 140
109 3300014968 Ga0157379_11164017 Ga0157379_111640172 140
110 3300025885 Ga0207653_10284219 Ga0207653_102842191 140
111 3300025923 Ga0207681_10912793 Ga0207681_109127932 140
112 3300025942 Ga0207689_10211473 Ga0207689_102114731 140
113 3300025972 Ga0207668_10435856 Ga0207668_104358562 140
114 3300025972 Ga0207668_11104882 Ga0207668_111048822 140
115 3300026067 Ga0207678_10050919 Ga0207678_100509193 140
116 3300026075 Ga0207708_10079350 Ga0207708_100793503 140
117 3300026089 Ga0207648_10474669 Ga0207648_104746692 140
118 3300026118 Ga0207675_100066743 Ga0207675_1000667435 140
119 3300026142 Ga0207698_10505329 Ga0207698_105053292 140
120 3300027866 Ga0209813_10001475 Ga0209813_100014755 140
121 3300027866 Ga0209813_10012003 Ga0209813_100120031 140
122 3300027907 Ga0207428_10340682 Ga0207428_103406821 140
123 3300028379 Ga0268266_11539093 Ga0268266_115390931 140
124 3300028381 Ga0268264_10291787 Ga0268264_102917872 140
125 3300031691 Ga0316579_10104827 Ga0316579_101048272 140
126 3300034817 Ga0373948_0029351 Ga0373948_0029351_246_671 140
127 3300034819 Ga0373958_0011963 Ga0373958_0011963_788_1213 140
128 3300034957 Ga0373938_0116204 Ga0373938_0116204_192_617 140
129 3300035084 Ga0373928_0070076 Ga0373928_0070076_150_575 140
130 3300035090 Ga0373949_0012177 Ga0373949_0012177_389_814 140
131 3300035091 Ga0373951_0006195 Ga0373951_0006195_670_1095 140
132 3300035112 Ga0373932_0015007 Ga0373932_0015007_630_1055 140
133 3300035112 Ga0373932_0180157 Ga0373932_0180157_92_517 140
134 3300035114 Ga0373939_0319300 Ga0373939_0319300_180_605 140
135 3300035115 Ga0373941_0049230 Ga0373941_0049230_74_499 140
136 3300035121 Ga0373960_0044925 Ga0373960_0044925_303_728 140
137 3300035207 Ga0373942_0037200 Ga0373942_0037200_353_778 140
138 3300035241 Ga0373961_0008082 Ga0373961_0008082_25_450 140
139 3300035242 Ga0373962_0004622 Ga0373962_0004622_2658_3083 140
140 3300035691 Ga0373931_0002939 Ga0373931_0002939_3707_4132 140
141 3300037312 Ga0395899_0176446 Ga0395899_0176446_203_631 140
142 3300038443 Ga0395901_1272046 Ga0395901_1272046_195_623 140
143 3300039437 Ga0436365_1082399 Ga0436365_1082399_252_677 140
144 3300044706 Ga0466964_0245847 Ga0466964_0245847_264_689 140
145 3300046491 Ga0495584_0027432 Ga0495584_0027432_175_600 140
146 3300046616 Ga0495668_0205261 Ga0495668_0205261_35_460 140
147 3300047447 Ga0495685_151400 Ga0495685_151400_207_632 140
148 3300048903 Ga0496100_0462045 Ga0496100_0462045_464_889 140
149 3300048904 Ga0496101_0039133 Ga0496101_0039133_2422_2847 140
150 3300048904 Ga0496101_0044118 Ga0496101_0044118_16_441 140
151 3300048905 Ga0496102_1732784 Ga0496102_1732784_69_494 140
152 3300048907 Ga0496104_0000088 Ga0496104_0000088_16547_16972 140
153 3300048907 Ga0496104_0030947 Ga0496104_0030947_4455_4880 140
154 3300048908 Ga0496105_0284621 Ga0496105_0284621_644_1069 140
155 3300048908 Ga0496105_0365399 Ga0496105_0365399_474_899 140
156 3300048908 Ga0496105_0602574 Ga0496105_0602574_221_646 140
157 3300048909 Ga0496106_0261457 Ga0496106_0261457_272_697 140
158 3300048911 Ga0496108_0002261 Ga0496108_0002261_78_503 140
159 3300048911 Ga0496108_0010640 Ga0496108_0010640_3962_4387 140
160 3300048912 Ga0496109_0113087 Ga0496109_0113087_442_867 140
161 3300048912 Ga0496109_0200576 Ga0496109_0200576_917_1342 140
162 3300048912 Ga0496109_0717742 Ga0496109_0717742_320_745 140
163 3300048913 Ga0496110_0000247 Ga0496110_0000247_32134_32559 140
164 3300048914 Ga0496111_0010748 Ga0496111_0010748_1147_1572 140
165 3300048914 Ga0496111_0792183 Ga0496111_0792183_67_492 140
166 3300048915 Ga0496112_0035456 Ga0496112_0035456_792_1217 140
167 3300048915 Ga0496112_0512116 Ga0496112_0512116_278_703 140
168 3300048915 Ga0496112_1351931 Ga0496112_1351931_155_580 140
169 3300048915 Ga0496112_1794876 Ga0496112_1794876_65_490 140
170 3300048916 Ga0496113_0001313 Ga0496113_0001313_6575_7000 140
171 3300048916 Ga0496113_1426100 Ga0496113_1426100_100_525 140
172 3300048917 Ga0496114_0236348 Ga0496114_0236348_1113_1538 140
173 3300048917 Ga0496114_0372429 Ga0496114_0372429_503_928 140
174 3300048928 Ga0496125_0431873 Ga0496125_0431873_130_555 140
175 3300049574 Ga0501038_0252317 Ga0501038_0252317_37_495 140
176 3300049581 Ga0501047_0467263 Ga0501047_0467263_444_902 140
177 3300049582 Ga0501048_0000501 Ga0501048_0000501_4445_4870 140
178 3300049822 Ga0501035_0440251 Ga0501035_0440251_405_863 140
179 3300049823 Ga0501044_0149205 Ga0501044_0149205_1449_1907 140
180 3300050490 nmdc:mga03n38_191549_c1 nmdc:mga03n38_191549_c1_434_859 140
181 3300050492 nmdc:mga0yw44_263960_c1 nmdc:mga0yw44_263960_c1_654_1079 140
182 3300050492 nmdc:mga0yw44_716274_c1 nmdc:mga0yw44_716274_c1_210_635 140
183 3300050494 nmdc:mga06z11_3658_c1 nmdc:mga06z11_3658_c1_4708_5133 140
184 3300050494 nmdc:mga06z11_4901_c1 nmdc:mga06z11_4901_c1_2773_3198 140
185 3300050495 nmdc:mga04h51_294867_c1 nmdc:mga04h51_294867_c1_220_645 140
186 3300050495 nmdc:mga04h51_4045_c1 nmdc:mga04h51_4045_c1_1618_2043 140
187 3300050495 nmdc:mga04h51_8312_c1 nmdc:mga04h51_8312_c1_154_579 140
188 3300050507 nmdc:mga05p37_494293_c1 nmdc:mga05p37_494293_c1_192_617 140
189 3300050507 nmdc:mga05p37_520166_c1 nmdc:mga05p37_520166_c1_792_1217 140
190 3300050509 nmdc:mga0qj67_4050_c1 nmdc:mga0qj67_4050_c1_9529_9954 140
191 3300050509 nmdc:mga0qj67_55208_c1 nmdc:mga0qj67_55208_c1_636_1061 140
192 3300050510 nmdc:mga06r32_276680_c1 nmdc:mga06r32_276680_c1_284_709 140
193 3300050510 nmdc:mga06r32_290482_c1 nmdc:mga06r32_290482_c1_901_1326 140
194 3300050511 nmdc:mga08y16_397612_c1 nmdc:mga08y16_397612_c1_282_707 140
195 3300050511 nmdc:mga08y16_496760_c1 nmdc:mga08y16_496760_c1_785_1210 140
196 3300050511 nmdc:mga08y16_704644_c1 nmdc:mga08y16_704644_c1_155_580 140
197 3300050512 nmdc:mga0n895_781857_c1 nmdc:mga0n895_781857_c1_329_754 140
198 3300053104 Ga0500556_0000636 Ga0500556_0000636_12804_13229 140
199 3300053108 Ga0500562_006251 Ga0500562_006251_1154_1579 140
200 3300053730 Ga0500645_176473 Ga0500645_176473_72_497 140
201 3300059510 Ga0587090_132170 Ga0587090_132170_106_534 140
202 3300059655 Ga0587114_032785 Ga0587114_032785_363_791 140
203 3300001990 JGI24737J22298_10227841 JGI24737J22298_102278411 141
204 3300002459 JGI24751J29686_10060711 JGI24751J29686_100607111 141
205 3300003320 rootH2_10008940 rootH2_1000894032 141
206 3300005293 Ga0065715_10016107 Ga0065715_100161072 141
207 3300005327 Ga0070658_10188377 Ga0070658_101883772 141
208 3300005327 Ga0070658_10230109 Ga0070658_102301092 141
209 3300005328 Ga0070676_10399633 Ga0070676_103996332 141
210 3300005329 Ga0070683_100374447 Ga0070683_1003744472 141
211 3300005331 Ga0070670_100498310 Ga0070670_1004983101 141
212 3300005331 Ga0070670_101259609 Ga0070670_1012596091 141
213 3300005334 Ga0068869_100084029 Ga0068869_1000840292 141
214 3300005335 Ga0070666_10075059 Ga0070666_100750592 141
215 3300005335 Ga0070666_10228902 Ga0070666_102289022 141
216 3300005337 Ga0070682_100651426 Ga0070682_1006514262 141
217 3300005338 Ga0068868_101311942 Ga0068868_1013119421 141
218 3300005339 Ga0070660_100022840 Ga0070660_1000228402 141
219 3300005341 Ga0070691_10370003 Ga0070691_103700032 141
220 3300005343 Ga0070687_100054855 Ga0070687_1000548552 141
221 3300005343 Ga0070687_100077380 Ga0070687_1000773802 141
222 3300005347 Ga0070668_100023248 Ga0070668_1000232484 141
223 3300005347 Ga0070668_100102262 Ga0070668_1001022622 141
224 3300005347 Ga0070668_100160948 Ga0070668_1001609482 141
225 3300005353 Ga0070669_100068818 Ga0070669_1000688182 141
226 3300005353 Ga0070669_100094668 Ga0070669_1000946682 141
227 3300005353 Ga0070669_100448503 Ga0070669_1004485031 141
228 3300005354 Ga0070675_100087027 Ga0070675_1000870272 141
229 3300005355 Ga0070671_100076706 Ga0070671_1000767062 141
230 3300005355 Ga0070671_100259862 Ga0070671_1002598622 141
231 3300005355 Ga0070671_100412268 Ga0070671_1004122682 141
232 3300005356 Ga0070674_100016168 Ga0070674_1000161684 141
233 3300005356 Ga0070674_100089577 Ga0070674_1000895772 141
234 3300005356 Ga0070674_100145116 Ga0070674_1001451162 141
235 3300005364 Ga0070673_101135854 Ga0070673_1011358541 141
236 3300005364 Ga0070673_101316792 Ga0070673_1013167922 141
237 3300005365 Ga0070688_100078874 Ga0070688_1000788742 141
238 3300005365 Ga0070688_100293376 Ga0070688_1002933762 141
239 3300005365 Ga0070688_100301413 Ga0070688_1003014132 141
240 3300005366 Ga0070659_100091198 Ga0070659_1000911983 141
241 3300005366 Ga0070659_100160715 Ga0070659_1001607152 141
242 3300005367 Ga0070667_100105642 Ga0070667_1001056422 141
243 3300005434 Ga0070709_10051037 Ga0070709_100510371 141
244 3300005435 Ga0070714_100310697 Ga0070714_1003106972 141
245 3300005437 Ga0070710_10050631 Ga0070710_100506313 141
246 3300005438 Ga0070701_10645572 Ga0070701_106455721 141
247 3300005439 Ga0070711_100089797 Ga0070711_1000897972 141
248 3300005440 Ga0070705_100064360 Ga0070705_1000643602 141
249 3300005445 Ga0070708_100971503 Ga0070708_1009715031 141
250 3300005455 Ga0070663_100184639 Ga0070663_1001846393 141
251 3300005456 Ga0070678_100067859 Ga0070678_1000678593 141
252 3300005456 Ga0070678_100270022 Ga0070678_1002700222 141
253 3300005457 Ga0070662_100026862 Ga0070662_1000268626 141
254 3300005457 Ga0070662_100614966 Ga0070662_1006149661 141
255 3300005458 Ga0070681_10553155 Ga0070681_105531552 141
256 3300005459 Ga0068867_100048580 Ga0068867_1000485804 141
257 3300005459 Ga0068867_100528074 Ga0068867_1005280742 141
258 3300005466 Ga0070685_10425865 Ga0070685_104258651 141
259 3300005466 Ga0070685_10480609 Ga0070685_104806092 141
260 3300005530 Ga0070679_100103587 Ga0070679_1001035873 141
261 3300005530 Ga0070679_101343734 Ga0070679_1013437341 141
262 3300005539 Ga0068853_100018646 Ga0068853_1000186464 141
263 3300005543 Ga0070672_101136370 Ga0070672_1011363702 141
264 3300005544 Ga0070686_100044273 Ga0070686_1000442732 141
265 3300005545 Ga0070695_101466947 Ga0070695_1014669471 141
266 3300005546 Ga0070696_100048487 Ga0070696_1000484872 141
267 3300005548 Ga0070665_100475885 Ga0070665_1004758851 141
268 3300005549 Ga0070704_100684710 Ga0070704_1006847101 141
269 3300005549 Ga0070704_100739386 Ga0070704_1007393862 141
270 3300005563 Ga0068855_100110325 Ga0068855_1001103253 141
271 3300005563 Ga0068855_100132525 Ga0068855_1001325253 141
272 3300005564 Ga0070664_100272853 Ga0070664_1002728532 141
273 3300005564 Ga0070664_100476143 Ga0070664_1004761432 141
274 3300005577 Ga0068857_100027092 Ga0068857_1000270922 141
275 3300005577 Ga0068857_100473947 Ga0068857_1004739472 141
276 3300005578 Ga0068854_100069033 Ga0068854_1000690333 141
277 3300005578 Ga0068854_100581583 Ga0068854_1005815831 141
278 3300005578 Ga0068854_101072348 Ga0068854_1010723482 141
279 3300005614 Ga0068856_100059597 Ga0068856_1000595975 141
280 3300005614 Ga0068856_100789010 Ga0068856_1007890102 141
281 3300005614 Ga0068856_101404428 Ga0068856_1014044282 141
282 3300005615 Ga0070702_100211194 Ga0070702_1002111942 141
283 3300005615 Ga0070702_100589321 Ga0070702_1005893211 141
284 3300005616 Ga0068852_100009389 Ga0068852_1000093899 141
285 3300005617 Ga0068859_102071481 Ga0068859_1020714811 141
286 3300005618 Ga0068864_100766843 Ga0068864_1007668432 141
287 3300005718 Ga0068866_10035180 Ga0068866_100351802 141
288 3300005718 Ga0068866_10045031 Ga0068866_100450314 141
289 3300005719 Ga0068861_100131442 Ga0068861_1001314422 141
290 3300005834 Ga0068851_10030591 Ga0068851_100305914 141
291 3300005840 Ga0068870_10480352 Ga0068870_104803522 141
292 3300005841 Ga0068863_100081975 Ga0068863_1000819752 141
293 3300005843 Ga0068860_100177112 Ga0068860_1001771122 141
294 3300005843 Ga0068860_101459088 Ga0068860_1014590881 141
295 3300005844 Ga0068862_100329836 Ga0068862_1003298362 141
296 3300005844 Ga0068862_100467020 Ga0068862_1004670201 141
297 3300005844 Ga0068862_102702895 Ga0068862_1027028951 141
298 3300005983 Ga0081540_1000734 Ga0081540_10007349 141
299 3300006048 Ga0075363_100798400 Ga0075363_1007984001 141
300 3300006163 Ga0070715_10159103 Ga0070715_101591032 141
301 3300006175 Ga0070712_100083706 Ga0070712_1000837062 141
302 3300006177 Ga0075362_10031283 Ga0075362_100312834 141
303 3300006237 Ga0097621_100206917 Ga0097621_1002069172 141
304 3300006237 Ga0097621_100512812 Ga0097621_1005128122 141
305 3300006358 Ga0068871_100043163 Ga0068871_1000431634 141
306 3300006358 Ga0068871_100278538 Ga0068871_1002785382 141
307 3300006358 Ga0068871_100458606 Ga0068871_1004586062 141
308 3300006847 Ga0075431_100020387 Ga0075431_1000203872 141
309 3300006871 Ga0075434_100286014 Ga0075434_1002860143 141
310 3300006881 Ga0068865_100045722 Ga0068865_1000457224 141
311 3300006881 Ga0068865_100633562 Ga0068865_1006335622 141
312 3300006931 Ga0097620_102071727 Ga0097620_1020717271 141
313 3300007076 Ga0075435_100467424 Ga0075435_1004674242 141
314 3300009093 Ga0105240_10350162 Ga0105240_103501622 141
315 3300009098 Ga0105245_10623799 Ga0105245_106237992 141
316 3300009098 Ga0105245_10877289 Ga0105245_108772892 141
317 3300009101 Ga0105247_10140681 Ga0105247_101406812 141
318 3300009101 Ga0105247_10291122 Ga0105247_102911222 141
319 3300009147 Ga0114129_10001848 Ga0114129_1000184828 141
320 3300009147 Ga0114129_10033141 Ga0114129_100331418 141
321 3300009147 Ga0114129_11549916 Ga0114129_115499161 141
322 3300009147 Ga0114129_12588088 Ga0114129_125880881 141
323 3300009148 Ga0105243_10325230 Ga0105243_103252302 141
324 3300009148 Ga0105243_10501226 Ga0105243_105012262 141
325 3300009148 Ga0105243_10820777 Ga0105243_108207771 141
326 3300009148 Ga0105243_10854576 Ga0105243_108545762 141
327 3300009148 Ga0105243_11334671 Ga0105243_113346711 141
328 3300009174 Ga0105241_10041066 Ga0105241_100410662 141
329 3300009174 Ga0105241_10080308 Ga0105241_100803082 141
330 3300009174 Ga0105241_10462779 Ga0105241_104627792 141
331 3300009174 Ga0105241_10550767 Ga0105241_105507671 141
332 3300009174 Ga0105241_10907020 Ga0105241_109070202 141
333 3300009176 Ga0105242_11464485 Ga0105242_114644852 141
334 3300009177 Ga0105248_10394603 Ga0105248_103946032 141
335 3300009177 Ga0105248_12696804 Ga0105248_126968041 141
336 3300009545 Ga0105237_10002619 Ga0105237_1000261910 141
337 3300009545 Ga0105237_10432658 Ga0105237_104326582 141
338 3300009545 Ga0105237_11367968 Ga0105237_113679681 141
339 3300009545 Ga0105237_11651062 Ga0105237_116510621 141
340 3300009551 Ga0105238_10163151 Ga0105238_101631512 141
341 3300009551 Ga0105238_10214223 Ga0105238_102142232 141
342 3300009551 Ga0105238_11098052 Ga0105238_110980521 141
343 3300009553 Ga0105249_10002122 Ga0105249_100021224 141
344 3300009553 Ga0105249_10365560 Ga0105249_103655601 141
345 3300010375 Ga0105239_10053471 Ga0105239_100534711 141
346 3300010375 Ga0105239_10226685 Ga0105239_102266853 141
347 3300010375 Ga0105239_10440662 Ga0105239_104406621 141
348 3300010375 Ga0105239_12113769 Ga0105239_121137691 141
349 3300011119 Ga0105246_10150375 Ga0105246_101503753 141
350 3300011119 Ga0105246_10294577 Ga0105246_102945772 141
351 3300011119 Ga0105246_10322992 Ga0105246_103229922 141
352 3300011119 Ga0105246_10691739 Ga0105246_106917392 141
353 3300012508 Ga0157315_1027020 Ga0157315_10270201 141
354 3300013100 Ga0157373_10105576 Ga0157373_101055762 141
355 3300013100 Ga0157373_10306784 Ga0157373_103067841 141
356 3300013102 Ga0157371_10237546 Ga0157371_102375462 141
357 3300013104 Ga0157370_10641788 Ga0157370_106417882 141
358 3300013105 Ga0157369_10858091 Ga0157369_108580912 141
359 3300013105 Ga0157369_11391374 Ga0157369_113913742 141
360 3300013296 Ga0157374_11260930 Ga0157374_112609302 141
361 3300013296 Ga0157374_11404218 Ga0157374_114042181 141
362 3300013297 Ga0157378_10130670 Ga0157378_101306703 141
363 3300013297 Ga0157378_10177698 Ga0157378_101776983 141
364 3300013297 Ga0157378_10234922 Ga0157378_102349222 141
365 3300013297 Ga0157378_10272888 Ga0157378_102728883 141
366 3300013306 Ga0163162_10510690 Ga0163162_105106902 141
367 3300013306 Ga0163162_11957209 Ga0163162_119572092 141
368 3300013307 Ga0157372_11236982 Ga0157372_112369822 141
369 3300013308 Ga0157375_10011899 Ga0157375_100118994 141
370 3300013308 Ga0157375_10106565 Ga0157375_101065653 141
371 3300013308 Ga0157375_10120676 Ga0157375_101206762 141
372 3300013308 Ga0157375_11623752 Ga0157375_116237522 141
373 3300013308 Ga0157375_11784236 Ga0157375_117842361 141
374 3300014326 Ga0157380_10349612 Ga0157380_103496122 141
375 3300014326 Ga0157380_11747375 Ga0157380_117473751 141
376 3300014497 Ga0182008_10073828 Ga0182008_100738282 141
377 3300014745 Ga0157377_10184481 Ga0157377_101844812 141
378 3300014968 Ga0157379_10467059 Ga0157379_104670592 141
379 3300014969 Ga0157376_10087464 Ga0157376_100874642 141
380 3300014969 Ga0157376_10541565 Ga0157376_105415652 141
381 3300014969 Ga0157376_10569693 Ga0157376_105696932 141
382 3300025231 Ga0207427_101221 Ga0207427_1012217 141
383 3300025261 Ga0209233_1000293 Ga0209233_100029311 141
384 3300025315 Ga0207697_10015360 Ga0207697_100153603 141
385 3300025893 Ga0207682_10008798 Ga0207682_100087984 141
386 3300025899 Ga0207642_10043600 Ga0207642_100436002 141
387 3300025900 Ga0207710_10039456 Ga0207710_100394562 141
388 3300025901 Ga0207688_10458048 Ga0207688_104580481 141
389 3300025903 Ga0207680_10139028 Ga0207680_101390283 141
390 3300025903 Ga0207680_10282532 Ga0207680_102825322 141
391 3300025905 Ga0207685_10034067 Ga0207685_100340672 141
392 3300025906 Ga0207699_11210720 Ga0207699_112107201 141
393 3300025907 Ga0207645_10057305 Ga0207645_100573051 141
394 3300025907 Ga0207645_10551560 Ga0207645_105515601 141
395 3300025908 Ga0207643_10060863 Ga0207643_100608632 141
396 3300025909 Ga0207705_10289316 Ga0207705_102893162 141
397 3300025911 Ga0207654_10093465 Ga0207654_100934652 141
398 3300025911 Ga0207654_10465931 Ga0207654_104659311 141
399 3300025912 Ga0207707_11431672 Ga0207707_114316721 141
400 3300025913 Ga0207695_10798270 Ga0207695_107982702 141
401 3300025914 Ga0207671_10001074 Ga0207671_1000107410 141
402 3300025915 Ga0207693_10029468 Ga0207693_100294682 141
403 3300025916 Ga0207663_10208642 Ga0207663_102086422 141
404 3300025917 Ga0207660_10276744 Ga0207660_102767442 141
405 3300025918 Ga0207662_10072813 Ga0207662_100728133 141
406 3300025918 Ga0207662_10080323 Ga0207662_100803232 141
407 3300025919 Ga0207657_10008060 Ga0207657_100080601 141
408 3300025919 Ga0207657_10041042 Ga0207657_100410425 141
409 3300025921 Ga0207652_10084553 Ga0207652_100845533 141
410 3300025923 Ga0207681_10106382 Ga0207681_101063822 141
411 3300025923 Ga0207681_10471418 Ga0207681_104714182 141
412 3300025924 Ga0207694_10403009 Ga0207694_104030092 141
413 3300025924 Ga0207694_10578208 Ga0207694_105782082 141
414 3300025925 Ga0207650_10268470 Ga0207650_102684701 141
415 3300025925 Ga0207650_10848464 Ga0207650_108484642 141
416 3300025926 Ga0207659_10185582 Ga0207659_101855821 141
417 3300025927 Ga0207687_10716317 Ga0207687_107163172 141
418 3300025928 Ga0207700_10172544 Ga0207700_101725442 141
419 3300025929 Ga0207664_10532410 Ga0207664_105324101 141
420 3300025931 Ga0207644_10098952 Ga0207644_100989522 141
421 3300025931 Ga0207644_10882029 Ga0207644_108820292 141
422 3300025932 Ga0207690_10027349 Ga0207690_100273493 141
423 3300025932 Ga0207690_10591819 Ga0207690_105918191 141
424 3300025932 Ga0207690_11682718 Ga0207690_116827181 141
425 3300025933 Ga0207706_10016619 Ga0207706_100166197 141
426 3300025933 Ga0207706_10087563 Ga0207706_100875633 141
427 3300025934 Ga0207686_10325945 Ga0207686_103259452 141
428 3300025934 Ga0207686_10494202 Ga0207686_104942022 141
429 3300025936 Ga0207670_10255040 Ga0207670_102550402 141
430 3300025937 Ga0207669_10006486 Ga0207669_100064863 141
431 3300025937 Ga0207669_10029206 Ga0207669_100292062 141
432 3300025937 Ga0207669_10087837 Ga0207669_100878372 141
433 3300025938 Ga0207704_10099740 Ga0207704_100997402 141
434 3300025940 Ga0207691_10002002 Ga0207691_1000200224 141
435 3300025940 Ga0207691_10709187 Ga0207691_107091872 141
436 3300025942 Ga0207689_10030049 Ga0207689_100300494 141
437 3300025942 Ga0207689_10410290 Ga0207689_104102901 141
438 3300025942 Ga0207689_10743840 Ga0207689_107438402 141
439 3300025944 Ga0207661_10340521 Ga0207661_103405212 141
440 3300025945 Ga0207679_10392666 Ga0207679_103926662 141
441 3300025945 Ga0207679_11643358 Ga0207679_116433581 141
442 3300025945 Ga0207679_11712485 Ga0207679_117124851 141
443 3300025949 Ga0207667_10002756 Ga0207667_100027567 141
444 3300025949 Ga0207667_10599337 Ga0207667_105993372 141
445 3300025960 Ga0207651_10114925 Ga0207651_101149252 141
446 3300025960 Ga0207651_10367600 Ga0207651_103676002 141
447 3300025960 Ga0207651_10440773 Ga0207651_104407732 141
448 3300025961 Ga0207712_10135791 Ga0207712_101357913 141
449 3300025961 Ga0207712_10627168 Ga0207712_106271682 141
450 3300025972 Ga0207668_10121024 Ga0207668_101210242 141
451 3300025972 Ga0207668_10222582 Ga0207668_102225822 141
452 3300025972 Ga0207668_11857854 Ga0207668_118578541 141
453 3300025981 Ga0207640_10258938 Ga0207640_102589382 141
454 3300025981 Ga0207640_10674701 Ga0207640_106747012 141
455 3300025986 Ga0207658_10024826 Ga0207658_100248266 141
456 3300026041 Ga0207639_10007867 Ga0207639_100078675 141
457 3300026041 Ga0207639_10030355 Ga0207639_100303551 141
458 3300026041 Ga0207639_11034253 Ga0207639_110342532 141
459 3300026067 Ga0207678_10061242 Ga0207678_100612424 141
460 3300026067 Ga0207678_10109637 Ga0207678_101096372 141
461 3300026067 Ga0207678_10174871 Ga0207678_101748712 141
462 3300026067 Ga0207678_10639362 Ga0207678_106393621 141
463 3300026075 Ga0207708_10432885 Ga0207708_104328852 141
464 3300026075 Ga0207708_10467344 Ga0207708_104673442 141
465 3300026078 Ga0207702_10646157 Ga0207702_106461571 141
466 3300026078 Ga0207702_11373941 Ga0207702_113739412 141
467 3300026088 Ga0207641_11623367 Ga0207641_116233671 141
468 3300026089 Ga0207648_10065236 Ga0207648_100652362 141
469 3300026089 Ga0207648_10678657 Ga0207648_106786572 141
470 3300026089 Ga0207648_11158715 Ga0207648_111587152 141
471 3300026095 Ga0207676_10324571 Ga0207676_103245712 141
472 3300026116 Ga0207674_10049517 Ga0207674_100495175 141
473 3300026116 Ga0207674_10082512 Ga0207674_100825122 141
474 3300026118 Ga0207675_100106057 Ga0207675_1001060573 141
475 3300026118 Ga0207675_100260892 Ga0207675_1002608922 141
476 3300026121 Ga0207683_10028928 Ga0207683_100289284 141
477 3300026121 Ga0207683_10088805 Ga0207683_100888053 141
478 3300026121 Ga0207683_10191288 Ga0207683_101912882 141
479 3300026142 Ga0207698_11530459 Ga0207698_115304591 141
480 3300028379 Ga0268266_10000321 Ga0268266_1000032135 141
481 3300028379 Ga0268266_10202672 Ga0268266_102026722 141
482 3300028380 Ga0268265_11016917 Ga0268265_110169172 141
483 3300028380 Ga0268265_11057408 Ga0268265_110574082 141
484 3300028381 Ga0268264_11752435 Ga0268264_117524351 141
485 3300031238 Ga0265332_10109621 Ga0265332_101096212 141
486 3300031241 Ga0265325_10113444 Ga0265325_101134442 141
487 3300031247 Ga0265340_10137776 Ga0265340_101377762 141
488 3300031247 Ga0265340_10139947 Ga0265340_101399472 141
489 3300031247 Ga0265340_10232471 Ga0265340_102324711 141
490 3300031249 Ga0265339_10150081 Ga0265339_101500812 141
491 3300031249 Ga0265339_10490976 Ga0265339_104909761 141
492 3300031250 Ga0265331_10014022 Ga0265331_100140222 141
493 3300031250 Ga0265331_10030202 Ga0265331_100302022 141
494 3300031251 Ga0265327_10073433 Ga0265327_100734332 141
495 3300031595 Ga0265313_10126730 Ga0265313_101267301 141
496 3300031711 Ga0265314_10170794 Ga0265314_101707941 141
497 3300031731 Ga0307405_10123306 Ga0307405_101233062 141
498 3300031731 Ga0307405_11454068 Ga0307405_114540681 141
499 3300031733 Ga0316577_10030400 Ga0316577_100304001 141
500 3300031852 Ga0307410_10228305 Ga0307410_102283052 141
501 3300031901 Ga0307406_10237184 Ga0307406_102371842 141
502 3300031911 Ga0307412_10244933 Ga0307412_102449332 141
503 3300031911 Ga0307412_10822154 Ga0307412_108221541 141
504 3300031911 Ga0307412_10906346 Ga0307412_109063461 141
505 3300031995 Ga0307409_100307063 Ga0307409_1003070632 141
506 3300031995 Ga0307409_100575912 Ga0307409_1005759121 141
507 3300032002 Ga0307416_100293889 Ga0307416_1002938892 141
508 3300032002 Ga0307416_101707444 Ga0307416_1017074442 141
509 3300032004 Ga0307414_10201119 Ga0307414_102011192 141
510 3300032004 Ga0307414_10270591 Ga0307414_102705912 141
511 3300032004 Ga0307414_10287108 Ga0307414_102871082 141
512 3300032004 Ga0307414_11575382 Ga0307414_115753821 141
513 3300032005 Ga0307411_11426780 Ga0307411_114267801 141
514 3300032168 Ga0316593_10405327 Ga0316593_104053271 141
515 3300033524 Ga0316592_1021521 Ga0316592_10215212 141
516 3300033541 Ga0316596_1001896 Ga0316596_10018966 141
517 3300034957 Ga0373938_0151715 Ga0373938_0151715_100_531 141
518 3300035083 Ga0373926_0306060 Ga0373926_0306060_146_577 141
519 3300035086 Ga0373934_0189680 Ga0373934_0189680_294_725 141
520 3300035089 Ga0373944_0007536 Ga0373944_0007536_2258_2689 141
521 3300035111 Ga0373923_0009752 Ga0373923_0009752_527_958 141
522 3300035113 Ga0373936_0007704 Ga0373936_0007704_2908_3339 141
523 3300035114 Ga0373939_0057027 Ga0373939_0057027_632_1057 141
524 3300035114 Ga0373939_0190063 Ga0373939_0190063_29_454 141
525 3300035117 Ga0373953_0131988 Ga0373953_0131988_370_801 141
526 3300035118 Ga0373954_0017164 Ga0373954_0017164_152_583 141
527 3300035119 Ga0373956_0002024 Ga0373956_0002024_7740_8171 141
528 3300035120 Ga0373957_0047796 Ga0373957_0047796_802_1233 141
529 3300035170 Ga0373943_0118430 Ga0373943_0118430_693_1124 141
530 3300035171 Ga0373946_0389032 Ga0373946_0389032_204_635 141
531 3300035207 Ga0373942_0045379 Ga0373942_0045379_748_1173 141
532 3300035242 Ga0373962_0055407 Ga0373962_0055407_493_918 141
533 3300035398 Ga0316574_0220696 Ga0316574_0220696_391_822 141
534 3300035691 Ga0373931_0073097 Ga0373931_0073097_1309_1734 141
535 3300035691 Ga0373931_0366445 Ga0373931_0366445_32_466 141
536 3300035692 Ga0373935_1406871 Ga0373935_1406871_18_449 141
537 3300035695 Ga0373927_0062132 Ga0373927_0062132_1936_2367 141
538 3300035695 Ga0373927_1017743 Ga0373927_1017743_81_512 141
539 3300035724 Ga0373933_0002755 Ga0373933_0002755_6256_6687 141
540 3300035725 Ga0373947_0028367 Ga0373947_0028367_910_1341 141
541 3300036401 Ga0373937_0005145 Ga0373937_0005145_5935_6366 141
542 3300037068 Ga0373925_0052266 Ga0373925_0052266_755_1186 141
543 3300037418 Ga0395900_0820320 Ga0395900_0820320_359_793 141
544 3300038443 Ga0395901_0507376 Ga0395901_0507376_289_723 141
545 3300041505 Ga0451849_0727082 Ga0451849_0727082_49_477 141
546 3300042012 Ga0439455_0203462 Ga0439455_0203462_115_549 141
547 3300042156 Ga0439446_0159324 Ga0439446_0159324_30_458 141
548 3300042157 Ga0439458_0113097 Ga0439458_0113097_200_634 141
549 3300042435 Ga0439434_0099164 Ga0439434_0099164_298_726 141
550 3300042435 Ga0439434_0306687 Ga0439434_0306687_25_450 141
551 3300042438 Ga0439459_0034184 Ga0439459_0034184_338_766 141
552 3300042438 Ga0439459_0098213 Ga0439459_0098213_73_507 141
553 3300042439 Ga0439464_0228099 Ga0439464_0228099_117_551 141
554 3300042439 Ga0439464_0257175 Ga0439464_0257175_84_518 141
555 3300044712 Ga0453684_0923212 Ga0453684_0923212_180_608 141
556 3300045051 Ga0451576_1467352 Ga0451576_1467352_233_664 141
557 3300046455 Ga0495603_0018592 Ga0495603_0018592_167_598 141
558 3300046459 Ga0495629_0055859 Ga0495629_0055859_75_506 141
559 3300046461 Ga0495641_0018852 Ga0495641_0018852_2144_2575 141
560 3300046462 Ga0495651_0001390 Ga0495651_0001390_12924_13355 141
561 3300046463 Ga0495653_0003820 Ga0495653_0003820_4424_4855 141
562 3300046474 Ga0495605_0235909 Ga0495605_0235909_164_589 141
563 3300046475 Ga0495639_0017560 Ga0495639_0017560_2391_2822 141
564 3300046476 Ga0495662_0202270 Ga0495662_0202270_523_954 141
565 3300046477 Ga0495664_0003117 Ga0495664_0003117_3646_4077 141
566 3300046477 Ga0495664_0598038 Ga0495664_0598038_11_442 141
567 3300046514 Ga0495618_0006824 Ga0495618_0006824_697_1128 141
568 3300046516 Ga0495628_0002285 Ga0495628_0002285_2825_3256 141
569 3300046517 Ga0495630_0251052 Ga0495630_0251052_889_1320 141
570 3300046523 Ga0495644_0239872 Ga0495644_0239872_59_538 141
571 3300046525 Ga0495663_0035043 Ga0495663_0035043_327_752 141
572 3300046526 Ga0495666_0298423 Ga0495666_0298423_234_665 141
573 3300046529 Ga0495652_0030282 Ga0495652_0030282_3514_3945 141
574 3300046531 Ga0495665_0370602 Ga0495665_0370602_195_626 141
575 3300046533 Ga0495640_0004112 Ga0495640_0004112_10101_10532 141
576 3300046535 Ga0495586_0080681 Ga0495586_0080681_642_1073 141
577 3300046536 Ga0495587_0001073 Ga0495587_0001073_5495_5926 141
578 3300046543 Ga0495645_0046486 Ga0495645_0046486_215_646 141
579 3300046543 Ga0495645_0326268 Ga0495645_0326268_54_485 141
580 3300046557 Ga0495622_0018184 Ga0495622_0018184_841_1272 141
581 3300046559 Ga0495667_0013645 Ga0495667_0013645_411_842 141
582 3300046615 Ga0495656_0023382 Ga0495656_0023382_1925_2350 141
583 3300046616 Ga0495668_0128220 Ga0495668_0128220_420_854 141
584 3300046660 Ga0495625_0116698 Ga0495625_0116698_455_889 141
585 3300046660 Ga0495625_0540551 Ga0495625_0540551_54_482 141
586 3300046663 Ga0495635_0151203 Ga0495635_0151203_54_485 141
587 3300046674 Ga0495588_0433890 Ga0495588_0433890_88_519 141
588 3300046678 Ga0495599_0006958 Ga0495599_0006958_88_519 141
589 3300046679 Ga0495623_0000858 Ga0495623_0000858_16117_16548 141
590 3300046683 Ga0495658_0019075 Ga0495658_0019075_755_1186 141
591 3300046690 Ga0495624_0402695 Ga0495624_0402695_64_495 141
592 3300046794 Ga0495589_0394292 Ga0495589_0394292_135_614 141
593 3300046809 Ga0495600_0025274 Ga0495600_0025274_16_447 141
594 3300047315 Ga0495581_0346976 Ga0495581_0346976_26_457 141
595 3300047317 Ga0495604_0016633 Ga0495604_0016633_2330_2761 141
596 3300047319 Ga0495674_0026345 Ga0495674_0026345_245_676 141
597 3300047321 Ga0495676_0196414 Ga0495676_0196414_219_650 141
598 3300047322 Ga0495680_0166049 Ga0495680_0166049_368_799 141
599 3300047444 Ga0495675_0004449 Ga0495675_0004449_616_1047 141
600 3300047471 Ga0495684_0101459 Ga0495684_0101459_539_970 141
601 3300047673 Ga0495593_0215573 Ga0495593_0215573_98_529 141
602 3300048088 Ga0495602_0005814 Ga0495602_0005814_443_874 141
603 3300048089 Ga0495614_0047303 Ga0495614_0047303_363_794 141
604 3300048090 Ga0495615_0010635 Ga0495615_0010635_953_1378 141
605 3300048903 Ga0496100_0040182 Ga0496100_0040182_251_682 141
606 3300048903 Ga0496100_0277972 Ga0496100_0277972_610_1089 141
607 3300048905 Ga0496102_0174294 Ga0496102_0174294_407_886 141
608 3300048905 Ga0496102_1662577 Ga0496102_1662577_11_451 141
609 3300048906 Ga0496103_0132575 Ga0496103_0132575_267_698 141
610 3300048907 Ga0496104_0023841 Ga0496104_0023841_352_783 141
611 3300048907 Ga0496104_0028047 Ga0496104_0028047_3333_3812 141
612 3300048908 Ga0496105_0047392 Ga0496105_0047392_295_726 141
613 3300048908 Ga0496105_0978370 Ga0496105_0978370_16_495 141
614 3300048909 Ga0496106_0585041 Ga0496106_0585041_363_794 141
615 3300048910 Ga0496107_0003748 Ga0496107_0003748_9098_9577 141
616 3300048910 Ga0496107_0053847 Ga0496107_0053847_538_969 141
617 3300048911 Ga0496108_0177620 Ga0496108_0177620_174_599 141
618 3300048912 Ga0496109_0061535 Ga0496109_0061535_1908_2339 141
619 3300048912 Ga0496109_0087108 Ga0496109_0087108_936_1415 141
620 3300048913 Ga0496110_0234157 Ga0496110_0234157_748_1176 141
621 3300048913 Ga0496110_0246820 Ga0496110_0246820_418_849 141
622 3300048914 Ga0496111_0278741 Ga0496111_0278741_673_1104 141
623 3300048915 Ga0496112_1411252 Ga0496112_1411252_164_598 141
624 3300048915 Ga0496112_1478971 Ga0496112_1478971_128_556 141
625 3300048916 Ga0496113_0930206 Ga0496113_0930206_138_569 141
626 3300048917 Ga0496114_0007247 Ga0496114_0007247_2267_2698 141
627 3300048917 Ga0496114_0170118 Ga0496114_0170118_316_795 141
628 3300048918 Ga0496115_0246525 Ga0496115_0246525_109_540 141
629 3300048918 Ga0496115_0259984 Ga0496115_0259984_542_1021 141
630 3300048924 Ga0496121_0163832 Ga0496121_0163832_260_700 141
631 3300049530 Ga0501314_047503 Ga0501314_047503_74_499 141
632 3300049568 Ga0501031_0313306 Ga0501031_0313306_216_644 141
633 3300049570 Ga0501033_0223246 Ga0501033_0223246_197_625 141
634 3300049571 Ga0501034_0578963 Ga0501034_0578963_491_919 141
635 3300049572 Ga0501036_0823045 Ga0501036_0823045_181_609 141
636 3300049574 Ga0501038_0084772 Ga0501038_0084772_1503_1931 141
637 3300049575 Ga0501039_0019036 Ga0501039_0019036_3804_4232 141
638 3300049577 Ga0501041_0200918 Ga0501041_0200918_807_1235 141
639 3300049579 Ga0501043_0172472 Ga0501043_0172472_353_781 141
640 3300049580 Ga0501046_0065905 Ga0501046_0065905_328_756 141
641 3300049582 Ga0501048_0121695 Ga0501048_0121695_47_475 141
642 3300049584 Ga0501068_0543316 Ga0501068_0543316_230_658 141
643 3300049584 Ga0501068_0860573 Ga0501068_0860573_35_469 141
644 3300049586 Ga0501070_0590375 Ga0501070_0590375_370_798 141
645 3300049587 Ga0501071_0648387 Ga0501071_0648387_66_494 141
646 3300049587 Ga0501071_1590986 Ga0501071_1590986_29_463 141
647 3300049588 Ga0501072_0008237 Ga0501072_0008237_6412_6840 141
648 3300049589 Ga0501073_0064968 Ga0501073_0064968_334_762 141
649 3300049591 Ga0501075_0032918 Ga0501075_0032918_1915_2343 141
650 3300049591 Ga0501075_0796527 Ga0501075_0796527_53_481 141
651 3300049592 Ga0501076_0104572 Ga0501076_0104572_245_673 141
652 3300049593 Ga0501077_0068868 Ga0501077_0068868_1716_2144 141
653 3300049741 Ga0501079_0063290 Ga0501079_0063290_2041_2466 141
654 3300049741 Ga0501079_0196121 Ga0501079_0196121_1040_1468 141
655 3300049742 Ga0501080_0039373 Ga0501080_0039373_2393_2821 141
656 3300049742 Ga0501080_0684087 Ga0501080_0684087_209_640 141
657 3300049743 Ga0501081_0097039 Ga0501081_0097039_1036_1464 141
658 3300049743 Ga0501081_0693041 Ga0501081_0693041_288_716 141
659 3300049743 Ga0501081_1251931 Ga0501081_1251931_77_514 141
660 3300049744 Ga0501083_0224809 Ga0501083_0224809_222_653 141
661 3300049744 Ga0501083_0308383 Ga0501083_0308383_231_659 141
662 3300049823 Ga0501044_1522873 Ga0501044_1522873_25_456 141
663 3300049824 Ga0501045_0004375 Ga0501045_0004375_4293_4721 141
664 3300049824 Ga0501045_0169887 Ga0501045_0169887_519_947 141
665 3300050489 nmdc:mga03683_33689_c1 nmdc:mga03683_33689_c1_715_1143 141
666 3300050490 nmdc:mga03n38_24560_c1 nmdc:mga03n38_24560_c1_1314_1742 141
667 3300050492 nmdc:mga0yw44_1180623_c1 nmdc:mga0yw44_1180623_c1_73_501 141
668 3300050496 nmdc:mga07m45_410029_c1 nmdc:mga07m45_410029_c1_76_510 141
669 3300050496 nmdc:mga07m45_493059_c1 nmdc:mga07m45_493059_c1_62_499 141
670 3300050496 nmdc:mga07m45_621348_c1 nmdc:mga07m45_621348_c1_34_459 141
671 3300050507 nmdc:mga05p37_1734867_c1 nmdc:mga05p37_1734867_c1_93_527 141
672 3300050507 nmdc:mga05p37_469266_c1 nmdc:mga05p37_469266_c1_89_520 141
673 3300050510 nmdc:mga06r32_15718_c1 nmdc:mga06r32_15718_c1_3844_4272 141
674 3300050512 nmdc:mga0n895_49974_c1 nmdc:mga0n895_49974_c1_746_1177 141
675 3300050513 nmdc:mga0rr50_81104_c1 nmdc:mga0rr50_81104_c1_205_636 141
676 3300053077 Ga0495601_0000869 Ga0495601_0000869_9216_9647 141
677 3300053077 Ga0495601_0004843 Ga0495601_0004843_6578_7009 141
678 3300053078 Ga0495612_0022193 Ga0495612_0022193_2026_2457 141
679 3300053078 Ga0495612_0024354 Ga0495612_0024354_54_485 141
680 3300053084 Ga0495595_0001114 Ga0495595_0001114_3641_4072 141
681 3300053085 Ga0495619_0058599 Ga0495619_0058599_2048_2479 141
682 3300053102 Ga0500554_244895 Ga0500554_244895_38_466 141
683 3300053103 Ga0500555_034637 Ga0500555_034637_314_745 141
684 3300053125 Ga0500618_012222 Ga0500618_012222_1228_1659 141
685 3300053151 Ga0500604_0000294 Ga0500604_0000294_12759_13184 141
686 3300053161 Ga0500634_0000031 Ga0500634_0000031_16543_16968 141
687 3300054114 Ga0501084_0002334 Ga0501084_0002334_7426_7854 141
688 3300059491 Ga0587070_092728 Ga0587070_092728_95_520 141
689 3300059493 Ga0587077_141000 Ga0587077_141000_181_606 141
690 3300059505 Ga0587083_0162689 Ga0587083_0162689_175_600 141
691 3300059506 Ga0587085_114071 Ga0587085_114071_18_443 141
692 3300059605 Ga0587106_024404 Ga0587106_024404_180_611 141
693 3300059627 Ga0587117_119745 Ga0587117_119745_83_508 141
694 3300059641 Ga0587068_010137 Ga0587068_010137_962_1387 141
695 3300059645 Ga0587076_083926 Ga0587076_083926_18_443 141
696 3300059660 Ga0587124_030979 Ga0587124_030979_153_578 141
697 3300060346 Ga0587111_0126619 Ga0587111_0126619_19_444 141
698 3300060353 Ga0501082_0420320 Ga0501082_0420320_110_544 141

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01196

Ribosomal_L17

Ribosomal protein L17

21

117

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xym-assembly1.cif.gz_N large subunit of mycobacterium smegmatis 0.9573 10 116
7sfr-assembly1.cif.gz_N unmethylated mtb ribosome 50s with seq-9 0.9512 9 116
7pkt-assembly1.cif.gz_m large subunit of the chlamydomonas reinhardtii mitoribosome 0.9355 10 120
8cvm-assembly1.cif.gz_m cutibacterium acnes 50s ribosomal subunit with p-site trna and sarecycline bound in the local refined map 0.9351 9 116
4v4p-assembly1.cif.gz_A0 crystal structure of 70s ribosome with thrs operator and trnas. 0.9305 14 116
ID Description Score Start End Superfamily
5v7qN00 Alpha Beta;Alpha-Beta Complex;50s Ribosomal Protein L17; Chain: A,;Ribosomal protein L17 0.9468 9 116 3.90.1030.10
1vt2N01 Alpha Beta;Alpha-Beta Complex;50s Ribosomal Protein L17; Chain: A,;Ribosomal protein L17 0.9429 13 115 3.90.1030.10
1vs8N01 Alpha Beta;Alpha-Beta Complex;50s Ribosomal Protein L17; Chain: A,;Ribosomal protein L17 0.9392 13 115 3.90.1030.10
1vt2N01 Alpha Beta;Alpha-Beta Complex;50s Ribosomal Protein L17; Chain: A,;Ribosomal protein L17 0.9343 13 115 3.90.1030.10
1vs8N01 Alpha Beta;Alpha-Beta Complex;50s Ribosomal Protein L17; Chain: A,;Ribosomal protein L17 0.9306 13 115 3.90.1030.10
ID Description Score Start End GO Terms
AF-A0A7C1Y7X7-F1-model_v4 50S ribosomal protein L17 0.9717 13 116 GO:0003735
GO:0006412
GO:0022625
AF-A0A2D8ZND3-F1-model_v4 50S ribosomal protein L17 0.9701 20 124 GO:0003735
GO:0006412
GO:0022625
AF-A0A836VM16-F1-model_v4 50S ribosomal protein L17 0.9679 16 127 GO:0003735
GO:0006412
GO:0022625
AF-A0A6I2ZF85-F1-model_v4 deleted 0.9596 9 116
AF-A0A7K1CVF8-F1-model_v4 Large ribosomal subunit protein bL17 0.9585 9 116 GO:0003735
GO:0006412
GO:0022625

Feature Viewer

pLDDT pTM Quality
81.45 0.71 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map