F475935
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 698 | 392 | 698 | 143 |
Family's Representative Sequence
| Representative Sequence | 3300003320|rootH2_10008940|rootH2_1000894032 |
| Length | 175 |
| Sequence | MSTHRNAGRKFSRTKGHRRALFANMAAALIKHEQIVTTLPKAKDLRPVVEKLITLAKKGGLANYRLAIARMRDETSAKKMFDVIGPRYKDRSGGYTRIMKAGFRYGDSAPMAVIELVDRDISAKGLDSGPVFNDEGEEVQTEAAHADKGDNTKPTGPKGGATKKVAAPRRVSSGG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 2 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 3 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 4 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 5 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 6 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 7 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 8 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 44 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 47 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 54 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 56 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 57 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 58 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 60 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 61 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 62 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 63 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 64 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 65 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 66 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 67 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 68 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 69 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 70 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 71 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 72 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 73 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 74 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 75 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 78 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 79 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 80 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 82 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 83 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 84 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 85 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 86 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 87 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 88 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 90 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Metagenome | Rhizosphere |
| 105 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 117 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 121 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 122 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 123 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 124 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 125 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 185 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 186 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 190 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 191 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 192 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 193 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 194 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 195 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 196 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 197 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 198 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 199 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 200 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 201 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 202 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 203 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 204 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 205 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 206 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 207 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 208 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 209 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 210 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 211 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 212 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 213 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 214 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 215 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 216 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 217 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 218 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 219 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 220 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 221 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 222 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 223 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 224 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 225 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 226 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 227 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 228 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 229 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 230 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 231 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 232 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 233 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 234 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 235 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 236 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 237 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 238 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 239 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 240 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 241 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 242 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 243 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 244 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 245 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 246 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 247 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 248 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 249 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 250 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 251 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 252 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 253 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 254 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 255 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 256 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 257 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 258 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 259 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 260 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 261 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 309 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 310 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 311 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 312 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 313 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 314 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 315 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 316 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 317 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 318 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 319 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 320 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 321 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 322 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 323 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 324 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 325 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 326 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 327 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 328 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 331 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 332 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 335 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 349 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 351 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 353 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 355 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 356 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 357 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 358 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 359 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 360 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 361 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 362 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 363 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 364 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 365 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 366 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 367 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 372 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 373 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 374 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 375 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 376 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 377 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 378 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 379 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 380 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 381 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 382 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 383 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 384 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 385 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 386 | 3300059627 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 387 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 388 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 389 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 390 | 3300059660 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 391 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 392 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.42 |
| Metatranscriptomes | 2.58 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.59 |
| Nodule | 0 |
| Rhizoplane | 7.45 |
| Rhizosphere | 83.24 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.72 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24737J22298_10227841 | 3300001990 | Bacteria | 550 |
| 2 | JGI24751J29686_10060711 | 3300002459 | Bacteria | 779 |
| 3 | rootH2_10008940 | 3300003320 | Bacteria | 20037 |
| 4 | Ga0055530_10004418 | 3300003791 | Bacteria | 7239 |
| 5 | Ga0055531_10007563 | 3300003794 | Bacteria | 5895 |
| 6 | Ga0055543_1006406 | 3300004625 | Bacteria | 2849 |
| 7 | Ga0065165_1000506 | 3300005262 | Bacteria | 60005 |
| 8 | Ga0065715_10016107 | 3300005293 | Bacteria | 1669 |
| 9 | Ga0070658_10188377 | 3300005327 | Bacteria | 1738 |
| 10 | Ga0070658_10230109 | 3300005327 | Bacteria | 1569 |
| 11 | Ga0070676_10399633 | 3300005328 | Bacteria | 956 |
| 12 | Ga0070683_100374447 | 3300005329 | Bacteria | 1357 |
| 13 | Ga0070690_100876114 | 3300005330 | Bacteria | 701 |
| 14 | Ga0070670_100498310 | 3300005331 | Bacteria | 1083 |
| 15 | Ga0070670_101259609 | 3300005331 | Bacteria | 676 |
| 16 | Ga0068869_100084029 | 3300005334 | Bacteria | 2382 |
| 17 | Ga0070666_10075059 | 3300005335 | Bacteria | 2305 |
| 18 | Ga0070666_10228902 | 3300005335 | Bacteria | 1312 |
| 19 | Ga0070682_100651426 | 3300005337 | Bacteria | 838 |
| 20 | Ga0068868_101311942 | 3300005338 | Bacteria | 673 |
| 21 | Ga0070660_100022840 | 3300005339 | Bacteria | 4631 |
| 22 | Ga0070691_10370003 | 3300005341 | Bacteria | 800 |
| 23 | Ga0070687_100054855 | 3300005343 | Bacteria | 2078 |
| 24 | Ga0070687_100077380 | 3300005343 | Bacteria | 1805 |
| 25 | Ga0070668_100023248 | 3300005347 | Bacteria | 4688 |
| 26 | Ga0070668_100102262 | 3300005347 | Bacteria | 2272 |
| 27 | Ga0070668_100157394 | 3300005347 | Bacteria | 1841 |
| 28 | Ga0070668_100160948 | 3300005347 | Bacteria | 1821 |
| 29 | Ga0070668_100420854 | 3300005347 | Bacteria | 1144 |
| 30 | Ga0070668_100719648 | 3300005347 | Bacteria | 881 |
| 31 | Ga0070669_100068818 | 3300005353 | Bacteria | 2614 |
| 32 | Ga0070669_100094668 | 3300005353 | Bacteria | 2245 |
| 33 | Ga0070669_100448503 | 3300005353 | Bacteria | 1063 |
| 34 | Ga0070675_100087027 | 3300005354 | Bacteria | 2612 |
| 35 | Ga0070675_101088783 | 3300005354 | Bacteria | 735 |
| 36 | Ga0070671_100076706 | 3300005355 | Bacteria | 2792 |
| 37 | Ga0070671_100259862 | 3300005355 | Bacteria | 1476 |
| 38 | Ga0070671_100412268 | 3300005355 | Bacteria | 1156 |
| 39 | Ga0070674_100013740 | 3300005356 | Bacteria | 5011 |
| 40 | Ga0070674_100016168 | 3300005356 | Bacteria | 4676 |
| 41 | Ga0070674_100089577 | 3300005356 | Bacteria | 2217 |
| 42 | Ga0070674_100145116 | 3300005356 | Bacteria | 1785 |
| 43 | Ga0070674_101057155 | 3300005356 | Bacteria | 715 |
| 44 | Ga0070673_100089902 | 3300005364 | Bacteria | 2508 |
| 45 | Ga0070673_101135854 | 3300005364 | Bacteria | 731 |
| 46 | Ga0070673_101316792 | 3300005364 | Bacteria | 679 |
| 47 | Ga0070688_100078874 | 3300005365 | Bacteria | 2125 |
| 48 | Ga0070688_100293376 | 3300005365 | Bacteria | 1173 |
| 49 | Ga0070688_100301413 | 3300005365 | Bacteria | 1158 |
| 50 | Ga0070659_100091198 | 3300005366 | Bacteria | 2442 |
| 51 | Ga0070659_100160715 | 3300005366 | Bacteria | 1836 |
| 52 | Ga0070667_100105642 | 3300005367 | Bacteria | 2437 |
| 53 | Ga0070709_10051037 | 3300005434 | Bacteria | 2594 |
| 54 | Ga0070714_100310697 | 3300005435 | Bacteria | 1472 |
| 55 | Ga0070710_10050631 | 3300005437 | Bacteria | 2329 |
| 56 | Ga0070701_10645572 | 3300005438 | Bacteria | 706 |
| 57 | Ga0070711_100089797 | 3300005439 | Bacteria | 2211 |
| 58 | Ga0070705_100064360 | 3300005440 | Bacteria | 2190 |
| 59 | Ga0070700_100761180 | 3300005441 | Bacteria | 776 |
| 60 | Ga0070694_100076528 | 3300005444 | Bacteria | 2317 |
| 61 | Ga0070708_100971503 | 3300005445 | Bacteria | 797 |
| 62 | Ga0070663_100184639 | 3300005455 | Bacteria | 1620 |
| 63 | Ga0070663_100361999 | 3300005455 | Bacteria | 1177 |
| 64 | Ga0070678_100067859 | 3300005456 | Bacteria | 2656 |
| 65 | Ga0070678_100270022 | 3300005456 | Bacteria | 1434 |
| 66 | Ga0070662_100026862 | 3300005457 | Bacteria | 3990 |
| 67 | Ga0070662_100614966 | 3300005457 | Bacteria | 915 |
| 68 | Ga0070681_10553155 | 3300005458 | Bacteria | 1065 |
| 69 | Ga0068867_100048580 | 3300005459 | Bacteria | 3122 |
| 70 | Ga0068867_100528074 | 3300005459 | Bacteria | 1019 |
| 71 | Ga0068867_102111338 | 3300005459 | Bacteria | 534 |
| 72 | Ga0070685_10425865 | 3300005466 | Bacteria | 924 |
| 73 | Ga0070685_10480609 | 3300005466 | Bacteria | 875 |
| 74 | Ga0070679_100103587 | 3300005530 | Bacteria | 2832 |
| 75 | Ga0070679_101343734 | 3300005530 | Bacteria | 661 |
| 76 | Ga0068853_100018646 | 3300005539 | Bacteria | 5744 |
| 77 | Ga0070672_100075101 | 3300005543 | Bacteria | 2698 |
| 78 | Ga0070672_101136370 | 3300005543 | Bacteria | 695 |
| 79 | Ga0070686_100044273 | 3300005544 | Bacteria | 2796 |
| 80 | Ga0070695_100024268 | 3300005545 | Bacteria | 3734 |
| 81 | Ga0070695_101466947 | 3300005545 | Bacteria | 567 |
| 82 | Ga0070696_100048487 | 3300005546 | Bacteria | 2949 |
| 83 | Ga0070665_100475885 | 3300005548 | Bacteria | 1260 |
| 84 | Ga0070704_100684710 | 3300005549 | Bacteria | 908 |
| 85 | Ga0070704_100739386 | 3300005549 | Bacteria | 875 |
| 86 | Ga0068855_100110325 | 3300005563 | Bacteria | 3159 |
| 87 | Ga0068855_100132525 | 3300005563 | Bacteria | 2845 |
| 88 | Ga0070664_100272853 | 3300005564 | Bacteria | 1524 |
| 89 | Ga0070664_100476143 | 3300005564 | Bacteria | 1149 |
| 90 | Ga0068857_100027092 | 3300005577 | Bacteria | 5055 |
| 91 | Ga0068857_100473947 | 3300005577 | Bacteria | 1172 |
| 92 | Ga0068854_100069033 | 3300005578 | Bacteria | 2579 |
| 93 | Ga0068854_100581583 | 3300005578 | Bacteria | 954 |
| 94 | Ga0068854_101072348 | 3300005578 | Bacteria | 717 |
| 95 | Ga0068856_100059597 | 3300005614 | Bacteria | 3770 |
| 96 | Ga0068856_100789010 | 3300005614 | Bacteria | 970 |
| 97 | Ga0068856_101404428 | 3300005614 | Bacteria | 713 |
| 98 | Ga0070702_100211194 | 3300005615 | Bacteria | 1292 |
| 99 | Ga0070702_100589321 | 3300005615 | Bacteria | 832 |
| 100 | Ga0070702_100611238 | 3300005615 | Bacteria | 819 |
| 101 | Ga0068852_100009389 | 3300005616 | Bacteria | 7263 |
| 102 | Ga0068859_102071481 | 3300005617 | Bacteria | 628 |
| 103 | Ga0068859_102716734 | 3300005617 | Bacteria | 544 |
| 104 | Ga0068864_100766843 | 3300005618 | Bacteria | 946 |
| 105 | Ga0068866_10035180 | 3300005718 | Bacteria | 2444 |
| 106 | Ga0068866_10045031 | 3300005718 | Bacteria | 2211 |
| 107 | Ga0068861_100060641 | 3300005719 | Bacteria | 2900 |
| 108 | Ga0068861_100102933 | 3300005719 | Bacteria | 2274 |
| 109 | Ga0068861_100131442 | 3300005719 | Bacteria | 2032 |
| 110 | Ga0068851_10030591 | 3300005834 | Bacteria | 2670 |
| 111 | Ga0068870_10480352 | 3300005840 | Bacteria | 824 |
| 112 | Ga0068863_100081975 | 3300005841 | Bacteria | 3056 |
| 113 | Ga0068863_100873163 | 3300005841 | Bacteria | 899 |
| 114 | Ga0068860_100135090 | 3300005843 | Bacteria | 2368 |
| 115 | Ga0068860_100177112 | 3300005843 | Bacteria | 2061 |
| 116 | Ga0068860_101459088 | 3300005843 | Bacteria | 706 |
| 117 | Ga0068862_100329836 | 3300005844 | Bacteria | 1411 |
| 118 | Ga0068862_100467020 | 3300005844 | Bacteria | 1192 |
| 119 | Ga0068862_100530458 | 3300005844 | Bacteria | 1121 |
| 120 | Ga0068862_102702895 | 3300005844 | Bacteria | 508 |
| 121 | Ga0081455_10001008 | 3300005937 | Bacteria | 35646 |
| 122 | Ga0081455_10845990 | 3300005937 | Bacteria | 572 |
| 123 | Ga0081540_1000645 | 3300005983 | Bacteria | 33098 |
| 124 | Ga0081540_1000734 | 3300005983 | Bacteria | 30203 |
| 125 | Ga0081540_1006488 | 3300005983 | Bacteria | 8508 |
| 126 | Ga0075365_10013271 | 3300006038 | Bacteria | 4917 |
| 127 | Ga0075365_10211809 | 3300006038 | Bacteria | 1358 |
| 128 | Ga0075368_10002307 | 3300006042 | Bacteria | 6194 |
| 129 | Ga0075368_10072020 | 3300006042 | Bacteria | 1397 |
| 130 | Ga0075363_100031808 | 3300006048 | Bacteria | 2737 |
| 131 | Ga0075363_100077507 | 3300006048 | Bacteria | 1814 |
| 132 | Ga0075363_100446614 | 3300006048 | Bacteria | 763 |
| 133 | Ga0075363_100798400 | 3300006048 | Bacteria | 574 |
| 134 | Ga0075364_10014487 | 3300006051 | Bacteria | 4873 |
| 135 | Ga0075364_10029402 | 3300006051 | Bacteria | 3524 |
| 136 | Ga0070715_10159103 | 3300006163 | Bacteria | 1114 |
| 137 | Ga0070712_100083706 | 3300006175 | Bacteria | 2317 |
| 138 | Ga0075362_10031283 | 3300006177 | Bacteria | 2302 |
| 139 | Ga0075367_10005654 | 3300006178 | Bacteria | 6237 |
| 140 | Ga0075367_10038071 | 3300006178 | Bacteria | 2798 |
| 141 | Ga0075367_10055587 | 3300006178 | Bacteria | 2349 |
| 142 | Ga0075367_10117128 | 3300006178 | Bacteria | 1639 |
| 143 | Ga0075366_10496428 | 3300006195 | Bacteria | 754 |
| 144 | Ga0097621_100206917 | 3300006237 | Bacteria | 1705 |
| 145 | Ga0097621_100512812 | 3300006237 | Bacteria | 1087 |
| 146 | Ga0068871_100043163 | 3300006358 | Bacteria | 3622 |
| 147 | Ga0068871_100278538 | 3300006358 | Bacteria | 1463 |
| 148 | Ga0068871_100354776 | 3300006358 | Bacteria | 1298 |
| 149 | Ga0068871_100458606 | 3300006358 | Bacteria | 1143 |
| 150 | Ga0075428_100008738 | 3300006844 | Bacteria | 11235 |
| 151 | Ga0075428_100009193 | 3300006844 | Bacteria | 10965 |
| 152 | Ga0075428_100121619 | 3300006844 | Bacteria | 2843 |
| 153 | Ga0075430_100025465 | 3300006846 | Bacteria | 5033 |
| 154 | Ga0075430_100299295 | 3300006846 | Bacteria | 1331 |
| 155 | Ga0075430_100628729 | 3300006846 | Bacteria | 886 |
| 156 | Ga0075431_100020387 | 3300006847 | Bacteria | 6774 |
| 157 | Ga0075431_100383853 | 3300006847 | Bacteria | 1408 |
| 158 | Ga0075431_100389398 | 3300006847 | Bacteria | 1396 |
| 159 | Ga0075433_10501974 | 3300006852 | Bacteria | 1068 |
| 160 | Ga0075434_100286014 | 3300006871 | Bacteria | 1668 |
| 161 | Ga0068865_100045722 | 3300006881 | Bacteria | 3002 |
| 162 | Ga0068865_100633562 | 3300006881 | Bacteria | 907 |
| 163 | Ga0068865_101779295 | 3300006881 | Bacteria | 556 |
| 164 | Ga0097620_102071727 | 3300006931 | Bacteria | 628 |
| 165 | Ga0097620_102717067 | 3300006931 | Bacteria | 544 |
| 166 | Ga0075435_100467424 | 3300007076 | Bacteria | 1089 |
| 167 | Ga0075435_100862694 | 3300007076 | Bacteria | 789 |
| 168 | Ga0105240_10350162 | 3300009093 | Bacteria | 1676 |
| 169 | Ga0111539_10209396 | 3300009094 | Bacteria | 2272 |
| 170 | Ga0111539_10588635 | 3300009094 | Bacteria | 1296 |
| 171 | Ga0111539_11048699 | 3300009094 | Bacteria | 948 |
| 172 | Ga0111539_11386889 | 3300009094 | Bacteria | 815 |
| 173 | Ga0105245_10623799 | 3300009098 | Bacteria | 1106 |
| 174 | Ga0105245_10877289 | 3300009098 | Bacteria | 938 |
| 175 | Ga0105247_10140681 | 3300009101 | Bacteria | 1581 |
| 176 | Ga0105247_10291122 | 3300009101 | Bacteria | 1130 |
| 177 | Ga0105247_11876775 | 3300009101 | Bacteria | 501 |
| 178 | Ga0114129_10001848 | 3300009147 | Bacteria | 28835 |
| 179 | Ga0114129_10033141 | 3300009147 | Bacteria | 7299 |
| 180 | Ga0114129_10106272 | 3300009147 | Bacteria | 3878 |
| 181 | Ga0114129_10115748 | 3300009147 | Bacteria | 3695 |
| 182 | Ga0114129_11051375 | 3300009147 | Bacteria | 1022 |
| 183 | Ga0114129_11549916 | 3300009147 | Bacteria | 813 |
| 184 | Ga0114129_12588088 | 3300009147 | Bacteria | 606 |
| 185 | Ga0105243_10325230 | 3300009148 | Bacteria | 1403 |
| 186 | Ga0105243_10501226 | 3300009148 | Bacteria | 1150 |
| 187 | Ga0105243_10820777 | 3300009148 | Bacteria | 918 |
| 188 | Ga0105243_10854576 | 3300009148 | Bacteria | 901 |
| 189 | Ga0105243_11334671 | 3300009148 | Bacteria | 736 |
| 190 | Ga0105243_12586280 | 3300009148 | Bacteria | 547 |
| 191 | Ga0105241_10041066 | 3300009174 | Bacteria | 3493 |
| 192 | Ga0105241_10080308 | 3300009174 | Bacteria | 2552 |
| 193 | Ga0105241_10462779 | 3300009174 | Bacteria | 1124 |
| 194 | Ga0105241_10550767 | 3300009174 | Bacteria | 1036 |
| 195 | Ga0105241_10907020 | 3300009174 | Bacteria | 819 |
| 196 | Ga0105241_11854862 | 3300009174 | Bacteria | 590 |
| 197 | Ga0105242_11464485 | 3300009176 | Bacteria | 712 |
| 198 | Ga0105248_10394603 | 3300009177 | Bacteria | 1558 |
| 199 | Ga0105248_12696804 | 3300009177 | Bacteria | 567 |
| 200 | Ga0105237_10002619 | 3300009545 | Bacteria | 22167 |
| 201 | Ga0105237_10432658 | 3300009545 | Bacteria | 1321 |
| 202 | Ga0105237_11367968 | 3300009545 | Bacteria | 714 |
| 203 | Ga0105237_11651062 | 3300009545 | Bacteria | 648 |
| 204 | Ga0105238_10163151 | 3300009551 | Bacteria | 2204 |
| 205 | Ga0105238_10214223 | 3300009551 | Bacteria | 1902 |
| 206 | Ga0105238_10689867 | 3300009551 | Bacteria | 1033 |
| 207 | Ga0105238_11098052 | 3300009551 | Bacteria | 818 |
| 208 | Ga0105249_10002122 | 3300009553 | Bacteria | 17209 |
| 209 | Ga0105249_10365560 | 3300009553 | Bacteria | 1465 |
| 210 | Ga0105249_10746546 | 3300009553 | Bacteria | 1041 |
| 211 | Ga0105239_10053471 | 3300010375 | Bacteria | 4430 |
| 212 | Ga0105239_10226685 | 3300010375 | Bacteria | 2096 |
| 213 | Ga0105239_10440662 | 3300010375 | Bacteria | 1477 |
| 214 | Ga0105239_12113769 | 3300010375 | Bacteria | 654 |
| 215 | Ga0105246_10150375 | 3300011119 | Bacteria | 1762 |
| 216 | Ga0105246_10285884 | 3300011119 | Bacteria | 1325 |
| 217 | Ga0105246_10294577 | 3300011119 | Bacteria | 1307 |
| 218 | Ga0105246_10322992 | 3300011119 | Bacteria | 1255 |
| 219 | Ga0105246_10691739 | 3300011119 | Bacteria | 893 |
| 220 | Ga0157315_1027020 | 3300012508 | Bacteria | 648 |
| 221 | Ga0157373_10105576 | 3300013100 | Bacteria | 1981 |
| 222 | Ga0157373_10306784 | 3300013100 | Bacteria | 1127 |
| 223 | Ga0157371_10237546 | 3300013102 | Bacteria | 1310 |
| 224 | Ga0157370_10641788 | 3300013104 | Bacteria | 971 |
| 225 | Ga0157369_10323808 | 3300013105 | Bacteria | 1602 |
| 226 | Ga0157369_10858091 | 3300013105 | Bacteria | 932 |
| 227 | Ga0157369_11391374 | 3300013105 | Bacteria | 714 |
| 228 | Ga0157374_11260930 | 3300013296 | Bacteria | 761 |
| 229 | Ga0157374_11404218 | 3300013296 | Bacteria | 721 |
| 230 | Ga0157378_10130670 | 3300013297 | Bacteria | 2324 |
| 231 | Ga0157378_10177698 | 3300013297 | Bacteria | 2001 |
| 232 | Ga0157378_10234922 | 3300013297 | Bacteria | 1749 |
| 233 | Ga0157378_10272888 | 3300013297 | Bacteria | 1627 |
| 234 | Ga0157378_11260127 | 3300013297 | Bacteria | 780 |
| 235 | Ga0163162_10159336 | 3300013306 | Bacteria | 2378 |
| 236 | Ga0163162_10510690 | 3300013306 | Bacteria | 1332 |
| 237 | Ga0163162_11838847 | 3300013306 | Bacteria | 693 |
| 238 | Ga0163162_11957209 | 3300013306 | Bacteria | 671 |
| 239 | Ga0163162_12291817 | 3300013306 | Bacteria | 620 |
| 240 | Ga0157372_10210380 | 3300013307 | Bacteria | 2254 |
| 241 | Ga0157372_11236982 | 3300013307 | Bacteria | 862 |
| 242 | Ga0157375_10011899 | 3300013308 | Bacteria | 7698 |
| 243 | Ga0157375_10106565 | 3300013308 | Bacteria | 2895 |
| 244 | Ga0157375_10120676 | 3300013308 | Bacteria | 2730 |
| 245 | Ga0157375_11623752 | 3300013308 | Bacteria | 765 |
| 246 | Ga0157375_11784236 | 3300013308 | Bacteria | 729 |
| 247 | Ga0163163_10591325 | 3300014325 | Bacteria | 1173 |
| 248 | Ga0157380_10349612 | 3300014326 | Bacteria | 1383 |
| 249 | Ga0157380_11747375 | 3300014326 | Bacteria | 680 |
| 250 | Ga0182008_10073828 | 3300014497 | Bacteria | 1678 |
| 251 | Ga0157377_10184481 | 3300014745 | Bacteria | 1314 |
| 252 | Ga0157379_10467059 | 3300014968 | Bacteria | 1167 |
| 253 | Ga0157379_11164017 | 3300014968 | Bacteria | 741 |
| 254 | Ga0157376_10087464 | 3300014969 | Bacteria | 2689 |
| 255 | Ga0157376_10541565 | 3300014969 | Bacteria | 1151 |
| 256 | Ga0157376_10569693 | 3300014969 | Bacteria | 1123 |
| 257 | Ga0213873_10001663 | 3300021358 | Bacteria | 3727 |
| 258 | Ga0213874_10001065 | 3300021377 | Bacteria | 5640 |
| 259 | Ga0213874_10091819 | 3300021377 | Bacteria | 998 |
| 260 | Ga0213876_10001556 | 3300021384 | Bacteria | 14102 |
| 261 | Ga0213876_10003867 | 3300021384 | Bacteria | 8462 |
| 262 | Ga0213875_10004174 | 3300021388 | Bacteria | 7998 |
| 263 | Ga0213875_10295883 | 3300021388 | Bacteria | 765 |
| 264 | Ga0213871_10163663 | 3300021441 | Bacteria | 682 |
| 265 | Ga0207427_101221 | 3300025231 | Bacteria | 9946 |
| 266 | Ga0209233_1000293 | 3300025261 | Bacteria | 63470 |
| 267 | Ga0207697_10015360 | 3300025315 | Bacteria | 3165 |
| 268 | Ga0207653_10284219 | 3300025885 | Bacteria | 639 |
| 269 | Ga0207682_10008798 | 3300025893 | Bacteria | 3992 |
| 270 | Ga0207642_10043600 | 3300025899 | Bacteria | 1980 |
| 271 | Ga0207710_10039456 | 3300025900 | Bacteria | 2090 |
| 272 | Ga0207688_10458048 | 3300025901 | Bacteria | 796 |
| 273 | Ga0207680_10139028 | 3300025903 | Bacteria | 1608 |
| 274 | Ga0207680_10282532 | 3300025903 | Bacteria | 1153 |
| 275 | Ga0207685_10034067 | 3300025905 | Bacteria | 1847 |
| 276 | Ga0207699_11210720 | 3300025906 | Bacteria | 559 |
| 277 | Ga0207645_10057305 | 3300025907 | Bacteria | 2487 |
| 278 | Ga0207645_10551560 | 3300025907 | Bacteria | 782 |
| 279 | Ga0207643_10060863 | 3300025908 | Bacteria | 2156 |
| 280 | Ga0207705_10289316 | 3300025909 | Bacteria | 1255 |
| 281 | Ga0207654_10093465 | 3300025911 | Bacteria | 1839 |
| 282 | Ga0207654_10465931 | 3300025911 | Bacteria | 888 |
| 283 | Ga0207707_11431672 | 3300025912 | Bacteria | 550 |
| 284 | Ga0207695_10798270 | 3300025913 | Bacteria | 824 |
| 285 | Ga0207671_10001074 | 3300025914 | Bacteria | 33173 |
| 286 | Ga0207693_10029468 | 3300025915 | Bacteria | 4335 |
| 287 | Ga0207663_10208642 | 3300025916 | Bacteria | 1414 |
| 288 | Ga0207660_10276744 | 3300025917 | Bacteria | 1331 |
| 289 | Ga0207662_10072813 | 3300025918 | Bacteria | 2083 |
| 290 | Ga0207662_10080323 | 3300025918 | Bacteria | 1989 |
| 291 | Ga0207657_10008060 | 3300025919 | Bacteria | 10742 |
| 292 | Ga0207657_10041042 | 3300025919 | Bacteria | 4094 |
| 293 | Ga0207652_10084553 | 3300025921 | Bacteria | 2780 |
| 294 | Ga0207681_10106382 | 3300025923 | Bacteria | 2033 |
| 295 | Ga0207681_10471418 | 3300025923 | Bacteria | 1024 |
| 296 | Ga0207681_10912793 | 3300025923 | Bacteria | 736 |
| 297 | Ga0207694_10403009 | 3300025924 | Bacteria | 1137 |
| 298 | Ga0207694_10578208 | 3300025924 | Bacteria | 944 |
| 299 | Ga0207650_10268470 | 3300025925 | Bacteria | 1386 |
| 300 | Ga0207650_10848464 | 3300025925 | Bacteria | 775 |
| 301 | Ga0207659_10185582 | 3300025926 | Bacteria | 1651 |
| 302 | Ga0207687_10716317 | 3300025927 | Bacteria | 850 |
| 303 | Ga0207700_10172544 | 3300025928 | Bacteria | 1805 |
| 304 | Ga0207664_10532410 | 3300025929 | Bacteria | 1053 |
| 305 | Ga0207644_10098952 | 3300025931 | Bacteria | 2187 |
| 306 | Ga0207644_10882029 | 3300025931 | Bacteria | 749 |
| 307 | Ga0207690_10027349 | 3300025932 | Bacteria | 3604 |
| 308 | Ga0207690_10591819 | 3300025932 | Bacteria | 905 |
| 309 | Ga0207690_11682718 | 3300025932 | Bacteria | 530 |
| 310 | Ga0207706_10016619 | 3300025933 | Bacteria | 6641 |
| 311 | Ga0207706_10087563 | 3300025933 | Bacteria | 2739 |
| 312 | Ga0207686_10325945 | 3300025934 | Bacteria | 1149 |
| 313 | Ga0207686_10494202 | 3300025934 | Bacteria | 948 |
| 314 | Ga0207670_10255040 | 3300025936 | Bacteria | 1357 |
| 315 | Ga0207669_10006486 | 3300025937 | Bacteria | 5353 |
| 316 | Ga0207669_10029206 | 3300025937 | Bacteria | 3046 |
| 317 | Ga0207669_10087837 | 3300025937 | Bacteria | 2015 |
| 318 | Ga0207704_10099740 | 3300025938 | Bacteria | 1932 |
| 319 | Ga0207691_10002002 | 3300025940 | Bacteria | 19933 |
| 320 | Ga0207691_10709187 | 3300025940 | Bacteria | 848 |
| 321 | Ga0207689_10030049 | 3300025942 | Bacteria | 4530 |
| 322 | Ga0207689_10211473 | 3300025942 | Bacteria | 1602 |
| 323 | Ga0207689_10410290 | 3300025942 | Bacteria | 1130 |
| 324 | Ga0207689_10743840 | 3300025942 | Bacteria | 827 |
| 325 | Ga0207661_10340521 | 3300025944 | Bacteria | 1351 |
| 326 | Ga0207679_10392666 | 3300025945 | Bacteria | 1219 |
| 327 | Ga0207679_11643358 | 3300025945 | Bacteria | 588 |
| 328 | Ga0207679_11712485 | 3300025945 | Bacteria | 575 |
| 329 | Ga0207667_10002756 | 3300025949 | Bacteria | 21724 |
| 330 | Ga0207667_10599337 | 3300025949 | Bacteria | 1111 |
| 331 | Ga0207651_10114925 | 3300025960 | Bacteria | 2028 |
| 332 | Ga0207651_10367600 | 3300025960 | Bacteria | 1216 |
| 333 | Ga0207651_10440773 | 3300025960 | Bacteria | 1116 |
| 334 | Ga0207712_10135791 | 3300025961 | Bacteria | 1881 |
| 335 | Ga0207712_10627168 | 3300025961 | Bacteria | 932 |
| 336 | Ga0207668_10121024 | 3300025972 | Bacteria | 1982 |
| 337 | Ga0207668_10222582 | 3300025972 | Bacteria | 1516 |
| 338 | Ga0207668_10435856 | 3300025972 | Bacteria | 1115 |
| 339 | Ga0207668_11104882 | 3300025972 | Bacteria | 711 |
| 340 | Ga0207668_11857854 | 3300025972 | Bacteria | 543 |
| 341 | Ga0207640_10258938 | 3300025981 | Bacteria | 1354 |
| 342 | Ga0207640_10674701 | 3300025981 | Bacteria | 883 |
| 343 | Ga0207658_10024826 | 3300025986 | Bacteria | 4195 |
| 344 | Ga0207639_10007867 | 3300026041 | Bacteria | 7280 |
| 345 | Ga0207639_10030355 | 3300026041 | Bacteria | 3964 |
| 346 | Ga0207639_11034253 | 3300026041 | Bacteria | 770 |
| 347 | Ga0207678_10050919 | 3300026067 | Bacteria | 3577 |
| 348 | Ga0207678_10061242 | 3300026067 | Bacteria | 3237 |
| 349 | Ga0207678_10109637 | 3300026067 | Bacteria | 2355 |
| 350 | Ga0207678_10174871 | 3300026067 | Bacteria | 1833 |
| 351 | Ga0207678_10639362 | 3300026067 | Bacteria | 934 |
| 352 | Ga0207708_10079350 | 3300026075 | Bacteria | 2521 |
| 353 | Ga0207708_10432885 | 3300026075 | Bacteria | 1093 |
| 354 | Ga0207708_10467344 | 3300026075 | Bacteria | 1053 |
| 355 | Ga0207702_10646157 | 3300026078 | Bacteria | 1040 |
| 356 | Ga0207702_11373941 | 3300026078 | Bacteria | 700 |
| 357 | Ga0207641_11623367 | 3300026088 | Bacteria | 648 |
| 358 | Ga0207648_10065236 | 3300026089 | Bacteria | 3174 |
| 359 | Ga0207648_10474669 | 3300026089 | Bacteria | 1142 |
| 360 | Ga0207648_10678657 | 3300026089 | Bacteria | 954 |
| 361 | Ga0207648_11158715 | 3300026089 | Bacteria | 726 |
| 362 | Ga0207676_10324571 | 3300026095 | Bacteria | 1414 |
| 363 | Ga0207674_10049517 | 3300026116 | Bacteria | 4296 |
| 364 | Ga0207674_10082512 | 3300026116 | Bacteria | 3216 |
| 365 | Ga0207675_100066743 | 3300026118 | Bacteria | 3363 |
| 366 | Ga0207675_100106057 | 3300026118 | Bacteria | 2649 |
| 367 | Ga0207675_100260892 | 3300026118 | Bacteria | 1679 |
| 368 | Ga0207683_10028928 | 3300026121 | Bacteria | 4795 |
| 369 | Ga0207683_10088805 | 3300026121 | Bacteria | 2751 |
| 370 | Ga0207683_10191288 | 3300026121 | Bacteria | 1858 |
| 371 | Ga0207698_10505329 | 3300026142 | Bacteria | 1177 |
| 372 | Ga0207698_11530459 | 3300026142 | Bacteria | 682 |
| 373 | Ga0209813_10001475 | 3300027866 | Bacteria | 5291 |
| 374 | Ga0209813_10012003 | 3300027866 | Bacteria | 2278 |
| 375 | Ga0207428_10340682 | 3300027907 | Bacteria | 1104 |
| 376 | Ga0268266_10000321 | 3300028379 | Bacteria | 75565 |
| 377 | Ga0268266_10202672 | 3300028379 | Bacteria | 1816 |
| 378 | Ga0268266_11539093 | 3300028379 | Bacteria | 641 |
| 379 | Ga0268265_11016917 | 3300028380 | Bacteria | 819 |
| 380 | Ga0268265_11057408 | 3300028380 | Bacteria | 804 |
| 381 | Ga0268264_10291787 | 3300028381 | Bacteria | 1532 |
| 382 | Ga0268264_11752435 | 3300028381 | Bacteria | 631 |
| 383 | Ga0265332_10109621 | 3300031238 | Bacteria | 1163 |
| 384 | Ga0265325_10113444 | 3300031241 | Bacteria | 1314 |
| 385 | Ga0265340_10137776 | 3300031247 | Bacteria | 1117 |
| 386 | Ga0265340_10139947 | 3300031247 | Bacteria | 1107 |
| 387 | Ga0265340_10232471 | 3300031247 | Bacteria | 824 |
| 388 | Ga0265339_10150081 | 3300031249 | Bacteria | 1179 |
| 389 | Ga0265339_10490976 | 3300031249 | Bacteria | 568 |
| 390 | Ga0265331_10014022 | 3300031250 | Bacteria | 4284 |
| 391 | Ga0265331_10030202 | 3300031250 | Bacteria | 2699 |
| 392 | Ga0265327_10073433 | 3300031251 | Bacteria | 1706 |
| 393 | Ga0265313_10126730 | 3300031595 | Bacteria | 1109 |
| 394 | Ga0316579_10104827 | 3300031691 | Bacteria | 1355 |
| 395 | Ga0265314_10170794 | 3300031711 | Bacteria | 1313 |
| 396 | Ga0307405_10123306 | 3300031731 | Bacteria | 1777 |
| 397 | Ga0307405_11454068 | 3300031731 | Bacteria | 601 |
| 398 | Ga0316577_10030400 | 3300031733 | Bacteria | 3016 |
| 399 | Ga0307410_10228305 | 3300031852 | Bacteria | 1436 |
| 400 | Ga0307406_10237184 | 3300031901 | Bacteria | 1366 |
| 401 | Ga0307412_10244933 | 3300031911 | Bacteria | 1389 |
| 402 | Ga0307412_10822154 | 3300031911 | Bacteria | 808 |
| 403 | Ga0307412_10906346 | 3300031911 | Bacteria | 773 |
| 404 | Ga0307409_100307063 | 3300031995 | Bacteria | 1479 |
| 405 | Ga0307409_100575912 | 3300031995 | Bacteria | 1109 |
| 406 | Ga0307416_100293889 | 3300032002 | Bacteria | 1610 |
| 407 | Ga0307416_101707444 | 3300032002 | Bacteria | 734 |
| 408 | Ga0307414_10201119 | 3300032004 | Bacteria | 1620 |
| 409 | Ga0307414_10270591 | 3300032004 | Bacteria | 1422 |
| 410 | Ga0307414_10287108 | 3300032004 | Bacteria | 1385 |
| 411 | Ga0307414_11575382 | 3300032004 | Bacteria | 612 |
| 412 | Ga0307411_11426780 | 3300032005 | Bacteria | 634 |
| 413 | Ga0316593_10001756 | 3300032168 | Bacteria | 4918 |
| 414 | Ga0316593_10405327 | 3300032168 | Bacteria | 527 |
| 415 | Ga0316592_1021521 | 3300033524 | Bacteria | 1374 |
| 416 | Ga0316596_1001896 | 3300033541 | Bacteria | 4374 |
| 417 | Ga0373948_0029351 | 3300034817 | Bacteria | 1100 |
| 418 | Ga0373958_0011963 | 3300034819 | Bacteria | 1477 |
| 419 | Ga0373938_0116204 | 3300034957 | Bacteria | 685 |
| 420 | Ga0373938_0151715 | 3300034957 | Bacteria | 617 |
| 421 | Ga0373926_0306060 | 3300035083 | Bacteria | 621 |
| 422 | Ga0373928_0070076 | 3300035084 | Bacteria | 865 |
| 423 | Ga0373934_0189680 | 3300035086 | Bacteria | 845 |
| 424 | Ga0373944_0007536 | 3300035089 | Bacteria | 2919 |
| 425 | Ga0373949_0012177 | 3300035090 | Bacteria | 1900 |
| 426 | Ga0373951_0006195 | 3300035091 | Bacteria | 2742 |
| 427 | Ga0373923_0009752 | 3300035111 | Bacteria | 3472 |
| 428 | Ga0373932_0015007 | 3300035112 | Bacteria | 1958 |
| 429 | Ga0373932_0180157 | 3300035112 | Bacteria | 741 |
| 430 | Ga0373936_0007704 | 3300035113 | Bacteria | 4044 |
| 431 | Ga0373939_0057027 | 3300035114 | Bacteria | 1231 |
| 432 | Ga0373939_0190063 | 3300035114 | Bacteria | 771 |
| 433 | Ga0373939_0319300 | 3300035114 | Bacteria | 624 |
| 434 | Ga0373941_0049230 | 3300035115 | Bacteria | 1333 |
| 435 | Ga0373953_0131988 | 3300035117 | Bacteria | 1065 |
| 436 | Ga0373954_0017164 | 3300035118 | Bacteria | 3246 |
| 437 | Ga0373956_0002024 | 3300035119 | Bacteria | 8399 |
| 438 | Ga0373957_0047796 | 3300035120 | Bacteria | 1628 |
| 439 | Ga0373960_0044925 | 3300035121 | Bacteria | 1291 |
| 440 | Ga0373943_0118430 | 3300035170 | Bacteria | 1405 |
| 441 | Ga0373946_0389032 | 3300035171 | Bacteria | 702 |
| 442 | Ga0373942_0037200 | 3300035207 | Bacteria | 1314 |
| 443 | Ga0373942_0045379 | 3300035207 | Bacteria | 1214 |
| 444 | Ga0373961_0008082 | 3300035241 | Bacteria | 2556 |
| 445 | Ga0373962_0004622 | 3300035242 | Bacteria | 3328 |
| 446 | Ga0373962_0055407 | 3300035242 | Bacteria | 1152 |
| 447 | Ga0316574_0220696 | 3300035398 | Bacteria | 1215 |
| 448 | Ga0373931_0002939 | 3300035691 | Bacteria | 7603 |
| 449 | Ga0373931_0073097 | 3300035691 | Bacteria | 1876 |
| 450 | Ga0373931_0366445 | 3300035691 | Bacteria | 905 |
| 451 | Ga0373935_1406871 | 3300035692 | Bacteria | 521 |
| 452 | Ga0373927_0062132 | 3300035695 | Bacteria | 2415 |
| 453 | Ga0373927_1017743 | 3300035695 | Bacteria | 546 |
| 454 | Ga0373933_0002755 | 3300035724 | Bacteria | 9806 |
| 455 | Ga0373947_0028367 | 3300035725 | Bacteria | 3281 |
| 456 | Ga0373937_0005145 | 3300036401 | Bacteria | 11151 |
| 457 | Ga0373925_0052266 | 3300037068 | Bacteria | 3052 |
| 458 | Ga0395899_0176446 | 3300037312 | Bacteria | 1502 |
| 459 | Ga0395900_0820320 | 3300037418 | Bacteria | 857 |
| 460 | Ga0436364_0013783 | 3300037853 | Bacteria | 29941 |
| 461 | Ga0436364_0082147 | 3300037853 | Bacteria | 4075 |
| 462 | Ga0436364_1091066 | 3300037853 | Bacteria | 1438 |
| 463 | Ga0395901_0507376 | 3300038443 | Bacteria | 1227 |
| 464 | Ga0395901_1272046 | 3300038443 | Bacteria | 698 |
| 465 | Ga0436365_0675022 | 3300039437 | Bacteria | 1323 |
| 466 | Ga0436365_1082399 | 3300039437 | Bacteria | 1188 |
| 467 | Ga0436365_1136540 | 3300039437 | Bacteria | 40433 |
| 468 | Ga0436365_1253031 | 3300039437 | Bacteria | 47093 |
| 469 | Ga0436360_0200295 | 3300039438 | Bacteria | 1091 |
| 470 | Ga0436363_0121335 | 3300039450 | Bacteria | 5796 |
| 471 | Ga0436363_0746062 | 3300039450 | Bacteria | 9943 |
| 472 | Ga0436362_0941402 | 3300039453 | Bacteria | 4603 |
| 473 | Ga0451800_0588366 | 3300041459 | Bacteria | 539 |
| 474 | Ga0451849_0727082 | 3300041505 | Bacteria | 595 |
| 475 | Ga0439455_0203462 | 3300042012 | Bacteria | 573 |
| 476 | Ga0439446_0159324 | 3300042156 | Bacteria | 746 |
| 477 | Ga0439458_0113097 | 3300042157 | Bacteria | 711 |
| 478 | Ga0439434_0099164 | 3300042435 | Bacteria | 938 |
| 479 | Ga0439434_0306687 | 3300042435 | Bacteria | 549 |
| 480 | Ga0439459_0034184 | 3300042438 | Bacteria | 1050 |
| 481 | Ga0439459_0098213 | 3300042438 | Bacteria | 713 |
| 482 | Ga0439464_0228099 | 3300042439 | Bacteria | 598 |
| 483 | Ga0439464_0257175 | 3300042439 | Bacteria | 565 |
| 484 | Ga0466964_0245847 | 3300044706 | Bacteria | 880 |
| 485 | Ga0453684_0923212 | 3300044712 | Bacteria | 933 |
| 486 | Ga0451576_1467352 | 3300045051 | Bacteria | 709 |
| 487 | Ga0495603_0018592 | 3300046455 | Bacteria | 4204 |
| 488 | Ga0495629_0055859 | 3300046459 | Bacteria | 2761 |
| 489 | Ga0495641_0018852 | 3300046461 | Bacteria | 3548 |
| 490 | Ga0495651_0001390 | 3300046462 | Bacteria | 18780 |
| 491 | Ga0495653_0003820 | 3300046463 | Bacteria | 12184 |
| 492 | Ga0495605_0235909 | 3300046474 | Bacteria | 786 |
| 493 | Ga0495639_0017560 | 3300046475 | Bacteria | 3109 |
| 494 | Ga0495662_0202270 | 3300046476 | Bacteria | 979 |
| 495 | Ga0495664_0003117 | 3300046477 | Bacteria | 9004 |
| 496 | Ga0495664_0598038 | 3300046477 | Bacteria | 655 |
| 497 | Ga0495584_0027432 | 3300046491 | Bacteria | 2886 |
| 498 | Ga0495618_0006824 | 3300046514 | Bacteria | 6914 |
| 499 | Ga0495628_0002285 | 3300046516 | Bacteria | 17341 |
| 500 | Ga0495630_0251052 | 3300046517 | Bacteria | 1351 |
| 501 | Ga0495644_0239872 | 3300046523 | Bacteria | 703 |
| 502 | Ga0495663_0035043 | 3300046525 | Bacteria | 1506 |
| 503 | Ga0495666_0298423 | 3300046526 | Bacteria | 729 |
| 504 | Ga0495652_0030282 | 3300046529 | Bacteria | 4747 |
| 505 | Ga0495665_0370602 | 3300046531 | Bacteria | 728 |
| 506 | Ga0495640_0004112 | 3300046533 | Bacteria | 11640 |
| 507 | Ga0495586_0080681 | 3300046535 | Bacteria | 1787 |
| 508 | Ga0495587_0001073 | 3300046536 | Bacteria | 17964 |
| 509 | Ga0495645_0046486 | 3300046543 | Bacteria | 3163 |
| 510 | Ga0495645_0326268 | 3300046543 | Bacteria | 995 |
| 511 | Ga0495622_0018184 | 3300046557 | Bacteria | 3274 |
| 512 | Ga0495667_0013645 | 3300046559 | Bacteria | 5492 |
| 513 | Ga0495656_0023382 | 3300046615 | Bacteria | 2432 |
| 514 | Ga0495668_0128220 | 3300046616 | Bacteria | 1389 |
| 515 | Ga0495668_0205261 | 3300046616 | Bacteria | 1079 |
| 516 | Ga0495625_0116698 | 3300046660 | Bacteria | 1820 |
| 517 | Ga0495625_0540551 | 3300046660 | Bacteria | 707 |
| 518 | Ga0495635_0151203 | 3300046663 | Bacteria | 1580 |
| 519 | Ga0495588_0433890 | 3300046674 | Bacteria | 689 |
| 520 | Ga0495599_0006958 | 3300046678 | Bacteria | 6841 |
| 521 | Ga0495623_0000858 | 3300046679 | Bacteria | 20593 |
| 522 | Ga0495658_0019075 | 3300046683 | Bacteria | 3575 |
| 523 | Ga0495624_0402695 | 3300046690 | Bacteria | 821 |
| 524 | Ga0495589_0394292 | 3300046794 | Bacteria | 636 |
| 525 | Ga0495600_0025274 | 3300046809 | Bacteria | 3827 |
| 526 | Ga0495581_0346976 | 3300047315 | Bacteria | 866 |
| 527 | Ga0495604_0016633 | 3300047317 | Bacteria | 5881 |
| 528 | Ga0495674_0026345 | 3300047319 | Bacteria | 5319 |
| 529 | Ga0495676_0196414 | 3300047321 | Bacteria | 1404 |
| 530 | Ga0495680_0166049 | 3300047322 | Bacteria | 1600 |
| 531 | Ga0495675_0004449 | 3300047444 | Bacteria | 8477 |
| 532 | Ga0495685_151400 | 3300047447 | Bacteria | 753 |
| 533 | Ga0495684_0101459 | 3300047471 | Bacteria | 2175 |
| 534 | Ga0495593_0215573 | 3300047673 | Bacteria | 963 |
| 535 | Ga0495602_0005814 | 3300048088 | Bacteria | 12947 |
| 536 | Ga0495614_0047303 | 3300048089 | Bacteria | 1845 |
| 537 | Ga0495615_0010635 | 3300048090 | Bacteria | 1846 |
| 538 | Ga0496100_0040182 | 3300048903 | Bacteria | 2974 |
| 539 | Ga0496100_0277972 | 3300048903 | Bacteria | 1247 |
| 540 | Ga0496100_0462045 | 3300048903 | Bacteria | 974 |
| 541 | Ga0496101_0039133 | 3300048904 | Bacteria | 3370 |
| 542 | Ga0496101_0044118 | 3300048904 | Bacteria | 3190 |
| 543 | Ga0496102_0174294 | 3300048905 | Bacteria | 2025 |
| 544 | Ga0496102_1662577 | 3300048905 | Bacteria | 556 |
| 545 | Ga0496102_1732784 | 3300048905 | Bacteria | 542 |
| 546 | Ga0496103_0132575 | 3300048906 | Bacteria | 1591 |
| 547 | Ga0496104_0000088 | 3300048907 | Bacteria | 88904 |
| 548 | Ga0496104_0023841 | 3300048907 | Bacteria | 5627 |
| 549 | Ga0496104_0028047 | 3300048907 | Bacteria | 5216 |
| 550 | Ga0496104_0030947 | 3300048907 | Bacteria | 4975 |
| 551 | Ga0496105_0047392 | 3300048908 | Bacteria | 3547 |
| 552 | Ga0496105_0284621 | 3300048908 | Bacteria | 1332 |
| 553 | Ga0496105_0365399 | 3300048908 | Bacteria | 1150 |
| 554 | Ga0496105_0602574 | 3300048908 | Bacteria | 852 |
| 555 | Ga0496105_0978370 | 3300048908 | Bacteria | 634 |
| 556 | Ga0496106_0261457 | 3300048909 | Bacteria | 1385 |
| 557 | Ga0496106_0585041 | 3300048909 | Bacteria | 894 |
| 558 | Ga0496107_0003748 | 3300048910 | Bacteria | 10211 |
| 559 | Ga0496107_0053847 | 3300048910 | Bacteria | 2902 |
| 560 | Ga0496108_0002261 | 3300048911 | Bacteria | 15425 |
| 561 | Ga0496108_0010640 | 3300048911 | Bacteria | 7463 |
| 562 | Ga0496108_0177620 | 3300048911 | Bacteria | 1844 |
| 563 | Ga0496109_0061535 | 3300048912 | Bacteria | 3432 |
| 564 | Ga0496109_0087108 | 3300048912 | Bacteria | 2884 |
| 565 | Ga0496109_0113087 | 3300048912 | Bacteria | 2525 |
| 566 | Ga0496109_0200576 | 3300048912 | Bacteria | 1875 |
| 567 | Ga0496109_0717742 | 3300048912 | Bacteria | 937 |
| 568 | Ga0496110_0000247 | 3300048913 | Bacteria | 35042 |
| 569 | Ga0496110_0234157 | 3300048913 | Bacteria | 1671 |
| 570 | Ga0496110_0246820 | 3300048913 | Bacteria | 1625 |
| 571 | Ga0496111_0010748 | 3300048914 | Bacteria | 6155 |
| 572 | Ga0496111_0278741 | 3300048914 | Bacteria | 1240 |
| 573 | Ga0496111_0792183 | 3300048914 | Bacteria | 686 |
| 574 | Ga0496112_0035456 | 3300048915 | Bacteria | 4860 |
| 575 | Ga0496112_0512116 | 3300048915 | Bacteria | 1135 |
| 576 | Ga0496112_1351931 | 3300048915 | Bacteria | 627 |
| 577 | Ga0496112_1411252 | 3300048915 | Bacteria | 611 |
| 578 | Ga0496112_1478971 | 3300048915 | Bacteria | 593 |
| 579 | Ga0496112_1794876 | 3300048915 | Bacteria | 525 |
| 580 | Ga0496113_0001313 | 3300048916 | Bacteria | 13743 |
| 581 | Ga0496113_0930206 | 3300048916 | Bacteria | 687 |
| 582 | Ga0496113_1426100 | 3300048916 | Bacteria | 536 |
| 583 | Ga0496114_0007247 | 3300048917 | Bacteria | 8760 |
| 584 | Ga0496114_0170118 | 3300048917 | Bacteria | 1898 |
| 585 | Ga0496114_0236348 | 3300048917 | Bacteria | 1606 |
| 586 | Ga0496114_0372429 | 3300048917 | Bacteria | 1264 |
| 587 | Ga0496115_0246525 | 3300048918 | Bacteria | 1471 |
| 588 | Ga0496115_0259984 | 3300048918 | Bacteria | 1428 |
| 589 | Ga0496121_0163832 | 3300048924 | Bacteria | 1623 |
| 590 | Ga0496125_0431873 | 3300048928 | Bacteria | 760 |
| 591 | Ga0501312_117548 | 3300049528 | Bacteria | 512 |
| 592 | Ga0501314_047503 | 3300049530 | Bacteria | 513 |
| 593 | Ga0501031_0313306 | 3300049568 | Bacteria | 1017 |
| 594 | Ga0501033_0223246 | 3300049570 | Bacteria | 1340 |
| 595 | Ga0501034_0360779 | 3300049571 | Bacteria | 1380 |
| 596 | Ga0501034_0578963 | 3300049571 | Bacteria | 1030 |
| 597 | Ga0501034_0649337 | 3300049571 | Bacteria | 957 |
| 598 | Ga0501036_0823045 | 3300049572 | Bacteria | 764 |
| 599 | Ga0501037_0158178 | 3300049573 | Bacteria | 1616 |
| 600 | Ga0501038_0084772 | 3300049574 | Bacteria | 2666 |
| 601 | Ga0501038_0252317 | 3300049574 | Bacteria | 1397 |
| 602 | Ga0501038_0890604 | 3300049574 | Bacteria | 657 |
| 603 | Ga0501039_0019036 | 3300049575 | Bacteria | 5268 |
| 604 | Ga0501039_0702342 | 3300049575 | Bacteria | 791 |
| 605 | Ga0501041_0200918 | 3300049577 | Bacteria | 1249 |
| 606 | Ga0501043_0172472 | 3300049579 | Bacteria | 1687 |
| 607 | Ga0501043_0418395 | 3300049579 | Bacteria | 1010 |
| 608 | Ga0501046_0065905 | 3300049580 | Bacteria | 2824 |
| 609 | Ga0501047_0418013 | 3300049581 | Bacteria | 1172 |
| 610 | Ga0501047_0467263 | 3300049581 | Bacteria | 1090 |
| 611 | Ga0501048_0000501 | 3300049582 | Bacteria | 27413 |
| 612 | Ga0501048_0121695 | 3300049582 | Bacteria | 1844 |
| 613 | Ga0501068_0543316 | 3300049584 | Bacteria | 755 |
| 614 | Ga0501068_0860573 | 3300049584 | Bacteria | 596 |
| 615 | Ga0501070_0590375 | 3300049586 | Bacteria | 886 |
| 616 | Ga0501071_0648387 | 3300049587 | Bacteria | 812 |
| 617 | Ga0501071_1590986 | 3300049587 | Bacteria | 504 |
| 618 | Ga0501072_0008237 | 3300049588 | Bacteria | 7920 |
| 619 | Ga0501073_0039915 | 3300049589 | Bacteria | 3324 |
| 620 | Ga0501073_0064968 | 3300049589 | Bacteria | 2545 |
| 621 | Ga0501075_0032918 | 3300049591 | Bacteria | 3855 |
| 622 | Ga0501075_0796527 | 3300049591 | Bacteria | 719 |
| 623 | Ga0501076_0104572 | 3300049592 | Bacteria | 2284 |
| 624 | Ga0501077_0068868 | 3300049593 | Bacteria | 2243 |
| 625 | Ga0501079_0063290 | 3300049741 | Bacteria | 2854 |
| 626 | Ga0501079_0196121 | 3300049741 | Bacteria | 1576 |
| 627 | Ga0501080_0039373 | 3300049742 | Bacteria | 4412 |
| 628 | Ga0501080_0469768 | 3300049742 | Bacteria | 1126 |
| 629 | Ga0501080_0684087 | 3300049742 | Bacteria | 906 |
| 630 | Ga0501081_0097039 | 3300049743 | Bacteria | 2079 |
| 631 | Ga0501081_0693041 | 3300049743 | Bacteria | 765 |
| 632 | Ga0501081_1251931 | 3300049743 | Bacteria | 562 |
| 633 | Ga0501083_0224809 | 3300049744 | Bacteria | 1223 |
| 634 | Ga0501083_0308383 | 3300049744 | Bacteria | 1029 |
| 635 | Ga0501035_0004418 | 3300049822 | Bacteria | 13348 |
| 636 | Ga0501035_0440251 | 3300049822 | Bacteria | 1079 |
| 637 | Ga0501044_0149205 | 3300049823 | Bacteria | 2321 |
| 638 | Ga0501044_0317755 | 3300049823 | Bacteria | 1482 |
| 639 | Ga0501044_1522873 | 3300049823 | Bacteria | 534 |
| 640 | Ga0501045_0004375 | 3300049824 | Bacteria | 9740 |
| 641 | Ga0501045_0169887 | 3300049824 | Bacteria | 1624 |
| 642 | nmdc:mga03683_33689_c1 | 3300050489 | Bacteria | 2069 |
| 643 | nmdc:mga03n38_191549_c1 | 3300050490 | Bacteria | 1054 |
| 644 | nmdc:mga03n38_24560_c1 | 3300050490 | Bacteria | 2465 |
| 645 | nmdc:mga0yw44_1180623_c1 | 3300050492 | Bacteria | 516 |
| 646 | nmdc:mga0yw44_263960_c1 | 3300050492 | Bacteria | 1148 |
| 647 | nmdc:mga0yw44_716274_c1 | 3300050492 | Bacteria | 680 |
| 648 | nmdc:mga06z11_3658_c1 | 3300050494 | Bacteria | 5969 |
| 649 | nmdc:mga06z11_4901_c1 | 3300050494 | Bacteria | 5311 |
| 650 | nmdc:mga04h51_294867_c1 | 3300050495 | Bacteria | 660 |
| 651 | nmdc:mga04h51_4045_c1 | 3300050495 | Bacteria | 3615 |
| 652 | nmdc:mga04h51_8312_c1 | 3300050495 | Bacteria | 2276 |
| 653 | nmdc:mga07m45_410029_c1 | 3300050496 | Bacteria | 786 |
| 654 | nmdc:mga07m45_493059_c1 | 3300050496 | Bacteria | 709 |
| 655 | nmdc:mga07m45_621348_c1 | 3300050496 | Bacteria | 623 |
| 656 | nmdc:mga05p37_1734867_c1 | 3300050507 | Bacteria | 606 |
| 657 | nmdc:mga05p37_469266_c1 | 3300050507 | Bacteria | 1453 |
| 658 | nmdc:mga05p37_494293_c1 | 3300050507 | Bacteria | 1406 |
| 659 | nmdc:mga05p37_520166_c1 | 3300050507 | Bacteria | 1361 |
| 660 | nmdc:mga0qj67_4050_c1 | 3300050509 | Bacteria | 10619 |
| 661 | nmdc:mga0qj67_55208_c1 | 3300050509 | Bacteria | 3146 |
| 662 | nmdc:mga06r32_15718_c1 | 3300050510 | Bacteria | 6877 |
| 663 | nmdc:mga06r32_276680_c1 | 3300050510 | Bacteria | 1666 |
| 664 | nmdc:mga06r32_290482_c1 | 3300050510 | Bacteria | 1622 |
| 665 | nmdc:mga08y16_397612_c1 | 3300050511 | Bacteria | 1411 |
| 666 | nmdc:mga08y16_496760_c1 | 3300050511 | Bacteria | 1240 |
| 667 | nmdc:mga08y16_704644_c1 | 3300050511 | Bacteria | 1009 |
| 668 | nmdc:mga0n895_49974_c1 | 3300050512 | Bacteria | 4099 |
| 669 | nmdc:mga0n895_781857_c1 | 3300050512 | Bacteria | 946 |
| 670 | nmdc:mga0rr50_81104_c1 | 3300050513 | Bacteria | 2503 |
| 671 | Ga0495601_0000869 | 3300053077 | Bacteria | 16487 |
| 672 | Ga0495601_0004843 | 3300053077 | Bacteria | 7807 |
| 673 | Ga0495612_0022193 | 3300053078 | Bacteria | 2544 |
| 674 | Ga0495612_0024354 | 3300053078 | Bacteria | 2429 |
| 675 | Ga0495595_0001114 | 3300053084 | Bacteria | 10394 |
| 676 | Ga0495619_0058599 | 3300053085 | Bacteria | 2557 |
| 677 | Ga0500554_244895 | 3300053102 | Bacteria | 592 |
| 678 | Ga0500555_034637 | 3300053103 | Bacteria | 1421 |
| 679 | Ga0500556_0000636 | 3300053104 | Bacteria | 22036 |
| 680 | Ga0500562_006251 | 3300053108 | Bacteria | 3005 |
| 681 | Ga0500618_012222 | 3300053125 | Bacteria | 2252 |
| 682 | Ga0500604_0000294 | 3300053151 | Bacteria | 13881 |
| 683 | Ga0500634_0000031 | 3300053161 | Bacteria | 75547 |
| 684 | Ga0500645_176473 | 3300053730 | Bacteria | 582 |
| 685 | Ga0501084_0002334 | 3300054114 | Bacteria | 15249 |
| 686 | Ga0587070_092728 | 3300059491 | Bacteria | 682 |
| 687 | Ga0587077_141000 | 3300059493 | Bacteria | 621 |
| 688 | Ga0587083_0162689 | 3300059505 | Bacteria | 612 |
| 689 | Ga0587085_114071 | 3300059506 | Bacteria | 586 |
| 690 | Ga0587090_132170 | 3300059510 | Bacteria | 551 |
| 691 | Ga0587106_024404 | 3300059605 | Bacteria | 925 |
| 692 | Ga0587117_119745 | 3300059627 | Bacteria | 520 |
| 693 | Ga0587068_010137 | 3300059641 | Bacteria | 1400 |
| 694 | Ga0587076_083926 | 3300059645 | Bacteria | 685 |
| 695 | Ga0587114_032785 | 3300059655 | Bacteria | 804 |
| 696 | Ga0587124_030979 | 3300059660 | Bacteria | 591 |
| 697 | Ga0587111_0126619 | 3300060346 | Bacteria | 663 |
| 698 | Ga0501082_0420320 | 3300060353 | Bacteria | 1167 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049571 | Ga0501034_0649337 | Ga0501034_0649337_13_585 | 128 |
| 2 | 3300003791 | Ga0055530_10004418 | Ga0055530_100044189 | 137 |
| 3 | 3300003794 | Ga0055531_10007563 | Ga0055531_100075631 | 137 |
| 4 | 3300004625 | Ga0055543_1006406 | Ga0055543_10064062 | 137 |
| 5 | 3300005262 | Ga0065165_1000506 | Ga0065165_10005069 | 137 |
| 6 | 3300032168 | Ga0316593_10001756 | Ga0316593_100017567 | 137 |
| 7 | 3300041459 | Ga0451800_0588366 | Ga0451800_0588366_16_441 | 138 |
| 8 | 3300005347 | Ga0070668_100719648 | Ga0070668_1007196482 | 139 |
| 9 | 3300005455 | Ga0070663_100361999 | Ga0070663_1003619991 | 139 |
| 10 | 3300005459 | Ga0068867_102111338 | Ga0068867_1021113381 | 139 |
| 11 | 3300005615 | Ga0070702_100611238 | Ga0070702_1006112381 | 139 |
| 12 | 3300005937 | Ga0081455_10001008 | Ga0081455_1000100817 | 139 |
| 13 | 3300005937 | Ga0081455_10845990 | Ga0081455_108459902 | 139 |
| 14 | 3300009551 | Ga0105238_10689867 | Ga0105238_106898672 | 139 |
| 15 | 3300011119 | Ga0105246_10285884 | Ga0105246_102858843 | 139 |
| 16 | 3300013306 | Ga0163162_10159336 | Ga0163162_101593363 | 139 |
| 17 | 3300013307 | Ga0157372_10210380 | Ga0157372_102103802 | 139 |
| 18 | 3300021358 | Ga0213873_10001663 | Ga0213873_100016634 | 139 |
| 19 | 3300021377 | Ga0213874_10001065 | Ga0213874_100010651 | 139 |
| 20 | 3300021377 | Ga0213874_10091819 | Ga0213874_100918191 | 139 |
| 21 | 3300021384 | Ga0213876_10001556 | Ga0213876_100015568 | 139 |
| 22 | 3300021384 | Ga0213876_10003867 | Ga0213876_1000386714 | 139 |
| 23 | 3300021388 | Ga0213875_10004174 | Ga0213875_100041746 | 139 |
| 24 | 3300021388 | Ga0213875_10295883 | Ga0213875_102958832 | 139 |
| 25 | 3300021441 | Ga0213871_10163663 | Ga0213871_101636631 | 139 |
| 26 | 3300037853 | Ga0436364_0013783 | Ga0436364_0013783_5807_6232 | 139 |
| 27 | 3300037853 | Ga0436364_0082147 | Ga0436364_0082147_3026_3451 | 139 |
| 28 | 3300037853 | Ga0436364_1091066 | Ga0436364_1091066_396_821 | 139 |
| 29 | 3300039437 | Ga0436365_0675022 | Ga0436365_0675022_493_918 | 139 |
| 30 | 3300039437 | Ga0436365_1136540 | Ga0436365_1136540_21003_21428 | 139 |
| 31 | 3300039437 | Ga0436365_1253031 | Ga0436365_1253031_29468_29893 | 139 |
| 32 | 3300039438 | Ga0436360_0200295 | Ga0436360_0200295_529_954 | 139 |
| 33 | 3300039450 | Ga0436363_0121335 | Ga0436363_0121335_3190_3615 | 139 |
| 34 | 3300039450 | Ga0436363_0746062 | Ga0436363_0746062_331_756 | 139 |
| 35 | 3300039453 | Ga0436362_0941402 | Ga0436362_0941402_1338_1763 | 139 |
| 36 | 3300049528 | Ga0501312_117548 | Ga0501312_117548_67_495 | 139 |
| 37 | 3300049571 | Ga0501034_0360779 | Ga0501034_0360779_470_895 | 139 |
| 38 | 3300049573 | Ga0501037_0158178 | Ga0501037_0158178_73_498 | 139 |
| 39 | 3300049574 | Ga0501038_0890604 | Ga0501038_0890604_82_507 | 139 |
| 40 | 3300049575 | Ga0501039_0702342 | Ga0501039_0702342_285_710 | 139 |
| 41 | 3300049579 | Ga0501043_0418395 | Ga0501043_0418395_317_742 | 139 |
| 42 | 3300049581 | Ga0501047_0418013 | Ga0501047_0418013_512_937 | 139 |
| 43 | 3300049589 | Ga0501073_0039915 | Ga0501073_0039915_61_486 | 139 |
| 44 | 3300049742 | Ga0501080_0469768 | Ga0501080_0469768_630_1055 | 139 |
| 45 | 3300049822 | Ga0501035_0004418 | Ga0501035_0004418_3054_3479 | 139 |
| 46 | 3300049823 | Ga0501044_0317755 | Ga0501044_0317755_802_1227 | 139 |
| 47 | 3300005330 | Ga0070690_100876114 | Ga0070690_1008761141 | 140 |
| 48 | 3300005347 | Ga0070668_100157394 | Ga0070668_1001573942 | 140 |
| 49 | 3300005347 | Ga0070668_100420854 | Ga0070668_1004208542 | 140 |
| 50 | 3300005354 | Ga0070675_101088783 | Ga0070675_1010887831 | 140 |
| 51 | 3300005356 | Ga0070674_100013740 | Ga0070674_1000137405 | 140 |
| 52 | 3300005356 | Ga0070674_101057155 | Ga0070674_1010571552 | 140 |
| 53 | 3300005364 | Ga0070673_100089902 | Ga0070673_1000899021 | 140 |
| 54 | 3300005441 | Ga0070700_100761180 | Ga0070700_1007611801 | 140 |
| 55 | 3300005444 | Ga0070694_100076528 | Ga0070694_1000765282 | 140 |
| 56 | 3300005543 | Ga0070672_100075101 | Ga0070672_1000751014 | 140 |
| 57 | 3300005545 | Ga0070695_100024268 | Ga0070695_1000242684 | 140 |
| 58 | 3300005617 | Ga0068859_102716734 | Ga0068859_1027167341 | 140 |
| 59 | 3300005719 | Ga0068861_100060641 | Ga0068861_1000606412 | 140 |
| 60 | 3300005719 | Ga0068861_100102933 | Ga0068861_1001029333 | 140 |
| 61 | 3300005841 | Ga0068863_100873163 | Ga0068863_1008731632 | 140 |
| 62 | 3300005843 | Ga0068860_100135090 | Ga0068860_1001350902 | 140 |
| 63 | 3300005844 | Ga0068862_100530458 | Ga0068862_1005304582 | 140 |
| 64 | 3300005983 | Ga0081540_1000645 | Ga0081540_100064528 | 140 |
| 65 | 3300005983 | Ga0081540_1006488 | Ga0081540_100648814 | 140 |
| 66 | 3300006038 | Ga0075365_10013271 | Ga0075365_100132714 | 140 |
| 67 | 3300006038 | Ga0075365_10211809 | Ga0075365_102118092 | 140 |
| 68 | 3300006042 | Ga0075368_10002307 | Ga0075368_100023072 | 140 |
| 69 | 3300006042 | Ga0075368_10072020 | Ga0075368_100720202 | 140 |
| 70 | 3300006048 | Ga0075363_100031808 | Ga0075363_1000318082 | 140 |
| 71 | 3300006048 | Ga0075363_100077507 | Ga0075363_1000775072 | 140 |
| 72 | 3300006048 | Ga0075363_100446614 | Ga0075363_1004466142 | 140 |
| 73 | 3300006051 | Ga0075364_10014487 | Ga0075364_100144876 | 140 |
| 74 | 3300006051 | Ga0075364_10029402 | Ga0075364_100294023 | 140 |
| 75 | 3300006178 | Ga0075367_10005654 | Ga0075367_100056542 | 140 |
| 76 | 3300006178 | Ga0075367_10038071 | Ga0075367_100380713 | 140 |
| 77 | 3300006178 | Ga0075367_10055587 | Ga0075367_100555873 | 140 |
| 78 | 3300006178 | Ga0075367_10117128 | Ga0075367_101171282 | 140 |
| 79 | 3300006195 | Ga0075366_10496428 | Ga0075366_104964282 | 140 |
| 80 | 3300006358 | Ga0068871_100354776 | Ga0068871_1003547762 | 140 |
| 81 | 3300006844 | Ga0075428_100008738 | Ga0075428_10000873812 | 140 |
| 82 | 3300006844 | Ga0075428_100009193 | Ga0075428_1000091932 | 140 |
| 83 | 3300006844 | Ga0075428_100121619 | Ga0075428_1001216192 | 140 |
| 84 | 3300006846 | Ga0075430_100025465 | Ga0075430_1000254655 | 140 |
| 85 | 3300006846 | Ga0075430_100299295 | Ga0075430_1002992951 | 140 |
| 86 | 3300006846 | Ga0075430_100628729 | Ga0075430_1006287291 | 140 |
| 87 | 3300006847 | Ga0075431_100383853 | Ga0075431_1003838532 | 140 |
| 88 | 3300006847 | Ga0075431_100389398 | Ga0075431_1003893981 | 140 |
| 89 | 3300006852 | Ga0075433_10501974 | Ga0075433_105019742 | 140 |
| 90 | 3300006881 | Ga0068865_101779295 | Ga0068865_1017792952 | 140 |
| 91 | 3300006931 | Ga0097620_102717067 | Ga0097620_1027170671 | 140 |
| 92 | 3300007076 | Ga0075435_100862694 | Ga0075435_1008626942 | 140 |
| 93 | 3300009094 | Ga0111539_10209396 | Ga0111539_102093962 | 140 |
| 94 | 3300009094 | Ga0111539_10588635 | Ga0111539_105886352 | 140 |
| 95 | 3300009094 | Ga0111539_11048699 | Ga0111539_110486991 | 140 |
| 96 | 3300009094 | Ga0111539_11386889 | Ga0111539_113868892 | 140 |
| 97 | 3300009101 | Ga0105247_11876775 | Ga0105247_118767751 | 140 |
| 98 | 3300009147 | Ga0114129_10106272 | Ga0114129_101062722 | 140 |
| 99 | 3300009147 | Ga0114129_10115748 | Ga0114129_101157481 | 140 |
| 100 | 3300009147 | Ga0114129_11051375 | Ga0114129_110513751 | 140 |
| 101 | 3300009148 | Ga0105243_12586280 | Ga0105243_125862801 | 140 |
| 102 | 3300009174 | Ga0105241_11854862 | Ga0105241_118548621 | 140 |
| 103 | 3300009553 | Ga0105249_10746546 | Ga0105249_107465461 | 140 |
| 104 | 3300013105 | Ga0157369_10323808 | Ga0157369_103238082 | 140 |
| 105 | 3300013297 | Ga0157378_11260127 | Ga0157378_112601271 | 140 |
| 106 | 3300013306 | Ga0163162_11838847 | Ga0163162_118388471 | 140 |
| 107 | 3300013306 | Ga0163162_12291817 | Ga0163162_122918171 | 140 |
| 108 | 3300014325 | Ga0163163_10591325 | Ga0163163_105913252 | 140 |
| 109 | 3300014968 | Ga0157379_11164017 | Ga0157379_111640172 | 140 |
| 110 | 3300025885 | Ga0207653_10284219 | Ga0207653_102842191 | 140 |
| 111 | 3300025923 | Ga0207681_10912793 | Ga0207681_109127932 | 140 |
| 112 | 3300025942 | Ga0207689_10211473 | Ga0207689_102114731 | 140 |
| 113 | 3300025972 | Ga0207668_10435856 | Ga0207668_104358562 | 140 |
| 114 | 3300025972 | Ga0207668_11104882 | Ga0207668_111048822 | 140 |
| 115 | 3300026067 | Ga0207678_10050919 | Ga0207678_100509193 | 140 |
| 116 | 3300026075 | Ga0207708_10079350 | Ga0207708_100793503 | 140 |
| 117 | 3300026089 | Ga0207648_10474669 | Ga0207648_104746692 | 140 |
| 118 | 3300026118 | Ga0207675_100066743 | Ga0207675_1000667435 | 140 |
| 119 | 3300026142 | Ga0207698_10505329 | Ga0207698_105053292 | 140 |
| 120 | 3300027866 | Ga0209813_10001475 | Ga0209813_100014755 | 140 |
| 121 | 3300027866 | Ga0209813_10012003 | Ga0209813_100120031 | 140 |
| 122 | 3300027907 | Ga0207428_10340682 | Ga0207428_103406821 | 140 |
| 123 | 3300028379 | Ga0268266_11539093 | Ga0268266_115390931 | 140 |
| 124 | 3300028381 | Ga0268264_10291787 | Ga0268264_102917872 | 140 |
| 125 | 3300031691 | Ga0316579_10104827 | Ga0316579_101048272 | 140 |
| 126 | 3300034817 | Ga0373948_0029351 | Ga0373948_0029351_246_671 | 140 |
| 127 | 3300034819 | Ga0373958_0011963 | Ga0373958_0011963_788_1213 | 140 |
| 128 | 3300034957 | Ga0373938_0116204 | Ga0373938_0116204_192_617 | 140 |
| 129 | 3300035084 | Ga0373928_0070076 | Ga0373928_0070076_150_575 | 140 |
| 130 | 3300035090 | Ga0373949_0012177 | Ga0373949_0012177_389_814 | 140 |
| 131 | 3300035091 | Ga0373951_0006195 | Ga0373951_0006195_670_1095 | 140 |
| 132 | 3300035112 | Ga0373932_0015007 | Ga0373932_0015007_630_1055 | 140 |
| 133 | 3300035112 | Ga0373932_0180157 | Ga0373932_0180157_92_517 | 140 |
| 134 | 3300035114 | Ga0373939_0319300 | Ga0373939_0319300_180_605 | 140 |
| 135 | 3300035115 | Ga0373941_0049230 | Ga0373941_0049230_74_499 | 140 |
| 136 | 3300035121 | Ga0373960_0044925 | Ga0373960_0044925_303_728 | 140 |
| 137 | 3300035207 | Ga0373942_0037200 | Ga0373942_0037200_353_778 | 140 |
| 138 | 3300035241 | Ga0373961_0008082 | Ga0373961_0008082_25_450 | 140 |
| 139 | 3300035242 | Ga0373962_0004622 | Ga0373962_0004622_2658_3083 | 140 |
| 140 | 3300035691 | Ga0373931_0002939 | Ga0373931_0002939_3707_4132 | 140 |
| 141 | 3300037312 | Ga0395899_0176446 | Ga0395899_0176446_203_631 | 140 |
| 142 | 3300038443 | Ga0395901_1272046 | Ga0395901_1272046_195_623 | 140 |
| 143 | 3300039437 | Ga0436365_1082399 | Ga0436365_1082399_252_677 | 140 |
| 144 | 3300044706 | Ga0466964_0245847 | Ga0466964_0245847_264_689 | 140 |
| 145 | 3300046491 | Ga0495584_0027432 | Ga0495584_0027432_175_600 | 140 |
| 146 | 3300046616 | Ga0495668_0205261 | Ga0495668_0205261_35_460 | 140 |
| 147 | 3300047447 | Ga0495685_151400 | Ga0495685_151400_207_632 | 140 |
| 148 | 3300048903 | Ga0496100_0462045 | Ga0496100_0462045_464_889 | 140 |
| 149 | 3300048904 | Ga0496101_0039133 | Ga0496101_0039133_2422_2847 | 140 |
| 150 | 3300048904 | Ga0496101_0044118 | Ga0496101_0044118_16_441 | 140 |
| 151 | 3300048905 | Ga0496102_1732784 | Ga0496102_1732784_69_494 | 140 |
| 152 | 3300048907 | Ga0496104_0000088 | Ga0496104_0000088_16547_16972 | 140 |
| 153 | 3300048907 | Ga0496104_0030947 | Ga0496104_0030947_4455_4880 | 140 |
| 154 | 3300048908 | Ga0496105_0284621 | Ga0496105_0284621_644_1069 | 140 |
| 155 | 3300048908 | Ga0496105_0365399 | Ga0496105_0365399_474_899 | 140 |
| 156 | 3300048908 | Ga0496105_0602574 | Ga0496105_0602574_221_646 | 140 |
| 157 | 3300048909 | Ga0496106_0261457 | Ga0496106_0261457_272_697 | 140 |
| 158 | 3300048911 | Ga0496108_0002261 | Ga0496108_0002261_78_503 | 140 |
| 159 | 3300048911 | Ga0496108_0010640 | Ga0496108_0010640_3962_4387 | 140 |
| 160 | 3300048912 | Ga0496109_0113087 | Ga0496109_0113087_442_867 | 140 |
| 161 | 3300048912 | Ga0496109_0200576 | Ga0496109_0200576_917_1342 | 140 |
| 162 | 3300048912 | Ga0496109_0717742 | Ga0496109_0717742_320_745 | 140 |
| 163 | 3300048913 | Ga0496110_0000247 | Ga0496110_0000247_32134_32559 | 140 |
| 164 | 3300048914 | Ga0496111_0010748 | Ga0496111_0010748_1147_1572 | 140 |
| 165 | 3300048914 | Ga0496111_0792183 | Ga0496111_0792183_67_492 | 140 |
| 166 | 3300048915 | Ga0496112_0035456 | Ga0496112_0035456_792_1217 | 140 |
| 167 | 3300048915 | Ga0496112_0512116 | Ga0496112_0512116_278_703 | 140 |
| 168 | 3300048915 | Ga0496112_1351931 | Ga0496112_1351931_155_580 | 140 |
| 169 | 3300048915 | Ga0496112_1794876 | Ga0496112_1794876_65_490 | 140 |
| 170 | 3300048916 | Ga0496113_0001313 | Ga0496113_0001313_6575_7000 | 140 |
| 171 | 3300048916 | Ga0496113_1426100 | Ga0496113_1426100_100_525 | 140 |
| 172 | 3300048917 | Ga0496114_0236348 | Ga0496114_0236348_1113_1538 | 140 |
| 173 | 3300048917 | Ga0496114_0372429 | Ga0496114_0372429_503_928 | 140 |
| 174 | 3300048928 | Ga0496125_0431873 | Ga0496125_0431873_130_555 | 140 |
| 175 | 3300049574 | Ga0501038_0252317 | Ga0501038_0252317_37_495 | 140 |
| 176 | 3300049581 | Ga0501047_0467263 | Ga0501047_0467263_444_902 | 140 |
| 177 | 3300049582 | Ga0501048_0000501 | Ga0501048_0000501_4445_4870 | 140 |
| 178 | 3300049822 | Ga0501035_0440251 | Ga0501035_0440251_405_863 | 140 |
| 179 | 3300049823 | Ga0501044_0149205 | Ga0501044_0149205_1449_1907 | 140 |
| 180 | 3300050490 | nmdc:mga03n38_191549_c1 | nmdc:mga03n38_191549_c1_434_859 | 140 |
| 181 | 3300050492 | nmdc:mga0yw44_263960_c1 | nmdc:mga0yw44_263960_c1_654_1079 | 140 |
| 182 | 3300050492 | nmdc:mga0yw44_716274_c1 | nmdc:mga0yw44_716274_c1_210_635 | 140 |
| 183 | 3300050494 | nmdc:mga06z11_3658_c1 | nmdc:mga06z11_3658_c1_4708_5133 | 140 |
| 184 | 3300050494 | nmdc:mga06z11_4901_c1 | nmdc:mga06z11_4901_c1_2773_3198 | 140 |
| 185 | 3300050495 | nmdc:mga04h51_294867_c1 | nmdc:mga04h51_294867_c1_220_645 | 140 |
| 186 | 3300050495 | nmdc:mga04h51_4045_c1 | nmdc:mga04h51_4045_c1_1618_2043 | 140 |
| 187 | 3300050495 | nmdc:mga04h51_8312_c1 | nmdc:mga04h51_8312_c1_154_579 | 140 |
| 188 | 3300050507 | nmdc:mga05p37_494293_c1 | nmdc:mga05p37_494293_c1_192_617 | 140 |
| 189 | 3300050507 | nmdc:mga05p37_520166_c1 | nmdc:mga05p37_520166_c1_792_1217 | 140 |
| 190 | 3300050509 | nmdc:mga0qj67_4050_c1 | nmdc:mga0qj67_4050_c1_9529_9954 | 140 |
| 191 | 3300050509 | nmdc:mga0qj67_55208_c1 | nmdc:mga0qj67_55208_c1_636_1061 | 140 |
| 192 | 3300050510 | nmdc:mga06r32_276680_c1 | nmdc:mga06r32_276680_c1_284_709 | 140 |
| 193 | 3300050510 | nmdc:mga06r32_290482_c1 | nmdc:mga06r32_290482_c1_901_1326 | 140 |
| 194 | 3300050511 | nmdc:mga08y16_397612_c1 | nmdc:mga08y16_397612_c1_282_707 | 140 |
| 195 | 3300050511 | nmdc:mga08y16_496760_c1 | nmdc:mga08y16_496760_c1_785_1210 | 140 |
| 196 | 3300050511 | nmdc:mga08y16_704644_c1 | nmdc:mga08y16_704644_c1_155_580 | 140 |
| 197 | 3300050512 | nmdc:mga0n895_781857_c1 | nmdc:mga0n895_781857_c1_329_754 | 140 |
| 198 | 3300053104 | Ga0500556_0000636 | Ga0500556_0000636_12804_13229 | 140 |
| 199 | 3300053108 | Ga0500562_006251 | Ga0500562_006251_1154_1579 | 140 |
| 200 | 3300053730 | Ga0500645_176473 | Ga0500645_176473_72_497 | 140 |
| 201 | 3300059510 | Ga0587090_132170 | Ga0587090_132170_106_534 | 140 |
| 202 | 3300059655 | Ga0587114_032785 | Ga0587114_032785_363_791 | 140 |
| 203 | 3300001990 | JGI24737J22298_10227841 | JGI24737J22298_102278411 | 141 |
| 204 | 3300002459 | JGI24751J29686_10060711 | JGI24751J29686_100607111 | 141 |
| 205 | 3300003320 | rootH2_10008940 | rootH2_1000894032 | 141 |
| 206 | 3300005293 | Ga0065715_10016107 | Ga0065715_100161072 | 141 |
| 207 | 3300005327 | Ga0070658_10188377 | Ga0070658_101883772 | 141 |
| 208 | 3300005327 | Ga0070658_10230109 | Ga0070658_102301092 | 141 |
| 209 | 3300005328 | Ga0070676_10399633 | Ga0070676_103996332 | 141 |
| 210 | 3300005329 | Ga0070683_100374447 | Ga0070683_1003744472 | 141 |
| 211 | 3300005331 | Ga0070670_100498310 | Ga0070670_1004983101 | 141 |
| 212 | 3300005331 | Ga0070670_101259609 | Ga0070670_1012596091 | 141 |
| 213 | 3300005334 | Ga0068869_100084029 | Ga0068869_1000840292 | 141 |
| 214 | 3300005335 | Ga0070666_10075059 | Ga0070666_100750592 | 141 |
| 215 | 3300005335 | Ga0070666_10228902 | Ga0070666_102289022 | 141 |
| 216 | 3300005337 | Ga0070682_100651426 | Ga0070682_1006514262 | 141 |
| 217 | 3300005338 | Ga0068868_101311942 | Ga0068868_1013119421 | 141 |
| 218 | 3300005339 | Ga0070660_100022840 | Ga0070660_1000228402 | 141 |
| 219 | 3300005341 | Ga0070691_10370003 | Ga0070691_103700032 | 141 |
| 220 | 3300005343 | Ga0070687_100054855 | Ga0070687_1000548552 | 141 |
| 221 | 3300005343 | Ga0070687_100077380 | Ga0070687_1000773802 | 141 |
| 222 | 3300005347 | Ga0070668_100023248 | Ga0070668_1000232484 | 141 |
| 223 | 3300005347 | Ga0070668_100102262 | Ga0070668_1001022622 | 141 |
| 224 | 3300005347 | Ga0070668_100160948 | Ga0070668_1001609482 | 141 |
| 225 | 3300005353 | Ga0070669_100068818 | Ga0070669_1000688182 | 141 |
| 226 | 3300005353 | Ga0070669_100094668 | Ga0070669_1000946682 | 141 |
| 227 | 3300005353 | Ga0070669_100448503 | Ga0070669_1004485031 | 141 |
| 228 | 3300005354 | Ga0070675_100087027 | Ga0070675_1000870272 | 141 |
| 229 | 3300005355 | Ga0070671_100076706 | Ga0070671_1000767062 | 141 |
| 230 | 3300005355 | Ga0070671_100259862 | Ga0070671_1002598622 | 141 |
| 231 | 3300005355 | Ga0070671_100412268 | Ga0070671_1004122682 | 141 |
| 232 | 3300005356 | Ga0070674_100016168 | Ga0070674_1000161684 | 141 |
| 233 | 3300005356 | Ga0070674_100089577 | Ga0070674_1000895772 | 141 |
| 234 | 3300005356 | Ga0070674_100145116 | Ga0070674_1001451162 | 141 |
| 235 | 3300005364 | Ga0070673_101135854 | Ga0070673_1011358541 | 141 |
| 236 | 3300005364 | Ga0070673_101316792 | Ga0070673_1013167922 | 141 |
| 237 | 3300005365 | Ga0070688_100078874 | Ga0070688_1000788742 | 141 |
| 238 | 3300005365 | Ga0070688_100293376 | Ga0070688_1002933762 | 141 |
| 239 | 3300005365 | Ga0070688_100301413 | Ga0070688_1003014132 | 141 |
| 240 | 3300005366 | Ga0070659_100091198 | Ga0070659_1000911983 | 141 |
| 241 | 3300005366 | Ga0070659_100160715 | Ga0070659_1001607152 | 141 |
| 242 | 3300005367 | Ga0070667_100105642 | Ga0070667_1001056422 | 141 |
| 243 | 3300005434 | Ga0070709_10051037 | Ga0070709_100510371 | 141 |
| 244 | 3300005435 | Ga0070714_100310697 | Ga0070714_1003106972 | 141 |
| 245 | 3300005437 | Ga0070710_10050631 | Ga0070710_100506313 | 141 |
| 246 | 3300005438 | Ga0070701_10645572 | Ga0070701_106455721 | 141 |
| 247 | 3300005439 | Ga0070711_100089797 | Ga0070711_1000897972 | 141 |
| 248 | 3300005440 | Ga0070705_100064360 | Ga0070705_1000643602 | 141 |
| 249 | 3300005445 | Ga0070708_100971503 | Ga0070708_1009715031 | 141 |
| 250 | 3300005455 | Ga0070663_100184639 | Ga0070663_1001846393 | 141 |
| 251 | 3300005456 | Ga0070678_100067859 | Ga0070678_1000678593 | 141 |
| 252 | 3300005456 | Ga0070678_100270022 | Ga0070678_1002700222 | 141 |
| 253 | 3300005457 | Ga0070662_100026862 | Ga0070662_1000268626 | 141 |
| 254 | 3300005457 | Ga0070662_100614966 | Ga0070662_1006149661 | 141 |
| 255 | 3300005458 | Ga0070681_10553155 | Ga0070681_105531552 | 141 |
| 256 | 3300005459 | Ga0068867_100048580 | Ga0068867_1000485804 | 141 |
| 257 | 3300005459 | Ga0068867_100528074 | Ga0068867_1005280742 | 141 |
| 258 | 3300005466 | Ga0070685_10425865 | Ga0070685_104258651 | 141 |
| 259 | 3300005466 | Ga0070685_10480609 | Ga0070685_104806092 | 141 |
| 260 | 3300005530 | Ga0070679_100103587 | Ga0070679_1001035873 | 141 |
| 261 | 3300005530 | Ga0070679_101343734 | Ga0070679_1013437341 | 141 |
| 262 | 3300005539 | Ga0068853_100018646 | Ga0068853_1000186464 | 141 |
| 263 | 3300005543 | Ga0070672_101136370 | Ga0070672_1011363702 | 141 |
| 264 | 3300005544 | Ga0070686_100044273 | Ga0070686_1000442732 | 141 |
| 265 | 3300005545 | Ga0070695_101466947 | Ga0070695_1014669471 | 141 |
| 266 | 3300005546 | Ga0070696_100048487 | Ga0070696_1000484872 | 141 |
| 267 | 3300005548 | Ga0070665_100475885 | Ga0070665_1004758851 | 141 |
| 268 | 3300005549 | Ga0070704_100684710 | Ga0070704_1006847101 | 141 |
| 269 | 3300005549 | Ga0070704_100739386 | Ga0070704_1007393862 | 141 |
| 270 | 3300005563 | Ga0068855_100110325 | Ga0068855_1001103253 | 141 |
| 271 | 3300005563 | Ga0068855_100132525 | Ga0068855_1001325253 | 141 |
| 272 | 3300005564 | Ga0070664_100272853 | Ga0070664_1002728532 | 141 |
| 273 | 3300005564 | Ga0070664_100476143 | Ga0070664_1004761432 | 141 |
| 274 | 3300005577 | Ga0068857_100027092 | Ga0068857_1000270922 | 141 |
| 275 | 3300005577 | Ga0068857_100473947 | Ga0068857_1004739472 | 141 |
| 276 | 3300005578 | Ga0068854_100069033 | Ga0068854_1000690333 | 141 |
| 277 | 3300005578 | Ga0068854_100581583 | Ga0068854_1005815831 | 141 |
| 278 | 3300005578 | Ga0068854_101072348 | Ga0068854_1010723482 | 141 |
| 279 | 3300005614 | Ga0068856_100059597 | Ga0068856_1000595975 | 141 |
| 280 | 3300005614 | Ga0068856_100789010 | Ga0068856_1007890102 | 141 |
| 281 | 3300005614 | Ga0068856_101404428 | Ga0068856_1014044282 | 141 |
| 282 | 3300005615 | Ga0070702_100211194 | Ga0070702_1002111942 | 141 |
| 283 | 3300005615 | Ga0070702_100589321 | Ga0070702_1005893211 | 141 |
| 284 | 3300005616 | Ga0068852_100009389 | Ga0068852_1000093899 | 141 |
| 285 | 3300005617 | Ga0068859_102071481 | Ga0068859_1020714811 | 141 |
| 286 | 3300005618 | Ga0068864_100766843 | Ga0068864_1007668432 | 141 |
| 287 | 3300005718 | Ga0068866_10035180 | Ga0068866_100351802 | 141 |
| 288 | 3300005718 | Ga0068866_10045031 | Ga0068866_100450314 | 141 |
| 289 | 3300005719 | Ga0068861_100131442 | Ga0068861_1001314422 | 141 |
| 290 | 3300005834 | Ga0068851_10030591 | Ga0068851_100305914 | 141 |
| 291 | 3300005840 | Ga0068870_10480352 | Ga0068870_104803522 | 141 |
| 292 | 3300005841 | Ga0068863_100081975 | Ga0068863_1000819752 | 141 |
| 293 | 3300005843 | Ga0068860_100177112 | Ga0068860_1001771122 | 141 |
| 294 | 3300005843 | Ga0068860_101459088 | Ga0068860_1014590881 | 141 |
| 295 | 3300005844 | Ga0068862_100329836 | Ga0068862_1003298362 | 141 |
| 296 | 3300005844 | Ga0068862_100467020 | Ga0068862_1004670201 | 141 |
| 297 | 3300005844 | Ga0068862_102702895 | Ga0068862_1027028951 | 141 |
| 298 | 3300005983 | Ga0081540_1000734 | Ga0081540_10007349 | 141 |
| 299 | 3300006048 | Ga0075363_100798400 | Ga0075363_1007984001 | 141 |
| 300 | 3300006163 | Ga0070715_10159103 | Ga0070715_101591032 | 141 |
| 301 | 3300006175 | Ga0070712_100083706 | Ga0070712_1000837062 | 141 |
| 302 | 3300006177 | Ga0075362_10031283 | Ga0075362_100312834 | 141 |
| 303 | 3300006237 | Ga0097621_100206917 | Ga0097621_1002069172 | 141 |
| 304 | 3300006237 | Ga0097621_100512812 | Ga0097621_1005128122 | 141 |
| 305 | 3300006358 | Ga0068871_100043163 | Ga0068871_1000431634 | 141 |
| 306 | 3300006358 | Ga0068871_100278538 | Ga0068871_1002785382 | 141 |
| 307 | 3300006358 | Ga0068871_100458606 | Ga0068871_1004586062 | 141 |
| 308 | 3300006847 | Ga0075431_100020387 | Ga0075431_1000203872 | 141 |
| 309 | 3300006871 | Ga0075434_100286014 | Ga0075434_1002860143 | 141 |
| 310 | 3300006881 | Ga0068865_100045722 | Ga0068865_1000457224 | 141 |
| 311 | 3300006881 | Ga0068865_100633562 | Ga0068865_1006335622 | 141 |
| 312 | 3300006931 | Ga0097620_102071727 | Ga0097620_1020717271 | 141 |
| 313 | 3300007076 | Ga0075435_100467424 | Ga0075435_1004674242 | 141 |
| 314 | 3300009093 | Ga0105240_10350162 | Ga0105240_103501622 | 141 |
| 315 | 3300009098 | Ga0105245_10623799 | Ga0105245_106237992 | 141 |
| 316 | 3300009098 | Ga0105245_10877289 | Ga0105245_108772892 | 141 |
| 317 | 3300009101 | Ga0105247_10140681 | Ga0105247_101406812 | 141 |
| 318 | 3300009101 | Ga0105247_10291122 | Ga0105247_102911222 | 141 |
| 319 | 3300009147 | Ga0114129_10001848 | Ga0114129_1000184828 | 141 |
| 320 | 3300009147 | Ga0114129_10033141 | Ga0114129_100331418 | 141 |
| 321 | 3300009147 | Ga0114129_11549916 | Ga0114129_115499161 | 141 |
| 322 | 3300009147 | Ga0114129_12588088 | Ga0114129_125880881 | 141 |
| 323 | 3300009148 | Ga0105243_10325230 | Ga0105243_103252302 | 141 |
| 324 | 3300009148 | Ga0105243_10501226 | Ga0105243_105012262 | 141 |
| 325 | 3300009148 | Ga0105243_10820777 | Ga0105243_108207771 | 141 |
| 326 | 3300009148 | Ga0105243_10854576 | Ga0105243_108545762 | 141 |
| 327 | 3300009148 | Ga0105243_11334671 | Ga0105243_113346711 | 141 |
| 328 | 3300009174 | Ga0105241_10041066 | Ga0105241_100410662 | 141 |
| 329 | 3300009174 | Ga0105241_10080308 | Ga0105241_100803082 | 141 |
| 330 | 3300009174 | Ga0105241_10462779 | Ga0105241_104627792 | 141 |
| 331 | 3300009174 | Ga0105241_10550767 | Ga0105241_105507671 | 141 |
| 332 | 3300009174 | Ga0105241_10907020 | Ga0105241_109070202 | 141 |
| 333 | 3300009176 | Ga0105242_11464485 | Ga0105242_114644852 | 141 |
| 334 | 3300009177 | Ga0105248_10394603 | Ga0105248_103946032 | 141 |
| 335 | 3300009177 | Ga0105248_12696804 | Ga0105248_126968041 | 141 |
| 336 | 3300009545 | Ga0105237_10002619 | Ga0105237_1000261910 | 141 |
| 337 | 3300009545 | Ga0105237_10432658 | Ga0105237_104326582 | 141 |
| 338 | 3300009545 | Ga0105237_11367968 | Ga0105237_113679681 | 141 |
| 339 | 3300009545 | Ga0105237_11651062 | Ga0105237_116510621 | 141 |
| 340 | 3300009551 | Ga0105238_10163151 | Ga0105238_101631512 | 141 |
| 341 | 3300009551 | Ga0105238_10214223 | Ga0105238_102142232 | 141 |
| 342 | 3300009551 | Ga0105238_11098052 | Ga0105238_110980521 | 141 |
| 343 | 3300009553 | Ga0105249_10002122 | Ga0105249_100021224 | 141 |
| 344 | 3300009553 | Ga0105249_10365560 | Ga0105249_103655601 | 141 |
| 345 | 3300010375 | Ga0105239_10053471 | Ga0105239_100534711 | 141 |
| 346 | 3300010375 | Ga0105239_10226685 | Ga0105239_102266853 | 141 |
| 347 | 3300010375 | Ga0105239_10440662 | Ga0105239_104406621 | 141 |
| 348 | 3300010375 | Ga0105239_12113769 | Ga0105239_121137691 | 141 |
| 349 | 3300011119 | Ga0105246_10150375 | Ga0105246_101503753 | 141 |
| 350 | 3300011119 | Ga0105246_10294577 | Ga0105246_102945772 | 141 |
| 351 | 3300011119 | Ga0105246_10322992 | Ga0105246_103229922 | 141 |
| 352 | 3300011119 | Ga0105246_10691739 | Ga0105246_106917392 | 141 |
| 353 | 3300012508 | Ga0157315_1027020 | Ga0157315_10270201 | 141 |
| 354 | 3300013100 | Ga0157373_10105576 | Ga0157373_101055762 | 141 |
| 355 | 3300013100 | Ga0157373_10306784 | Ga0157373_103067841 | 141 |
| 356 | 3300013102 | Ga0157371_10237546 | Ga0157371_102375462 | 141 |
| 357 | 3300013104 | Ga0157370_10641788 | Ga0157370_106417882 | 141 |
| 358 | 3300013105 | Ga0157369_10858091 | Ga0157369_108580912 | 141 |
| 359 | 3300013105 | Ga0157369_11391374 | Ga0157369_113913742 | 141 |
| 360 | 3300013296 | Ga0157374_11260930 | Ga0157374_112609302 | 141 |
| 361 | 3300013296 | Ga0157374_11404218 | Ga0157374_114042181 | 141 |
| 362 | 3300013297 | Ga0157378_10130670 | Ga0157378_101306703 | 141 |
| 363 | 3300013297 | Ga0157378_10177698 | Ga0157378_101776983 | 141 |
| 364 | 3300013297 | Ga0157378_10234922 | Ga0157378_102349222 | 141 |
| 365 | 3300013297 | Ga0157378_10272888 | Ga0157378_102728883 | 141 |
| 366 | 3300013306 | Ga0163162_10510690 | Ga0163162_105106902 | 141 |
| 367 | 3300013306 | Ga0163162_11957209 | Ga0163162_119572092 | 141 |
| 368 | 3300013307 | Ga0157372_11236982 | Ga0157372_112369822 | 141 |
| 369 | 3300013308 | Ga0157375_10011899 | Ga0157375_100118994 | 141 |
| 370 | 3300013308 | Ga0157375_10106565 | Ga0157375_101065653 | 141 |
| 371 | 3300013308 | Ga0157375_10120676 | Ga0157375_101206762 | 141 |
| 372 | 3300013308 | Ga0157375_11623752 | Ga0157375_116237522 | 141 |
| 373 | 3300013308 | Ga0157375_11784236 | Ga0157375_117842361 | 141 |
| 374 | 3300014326 | Ga0157380_10349612 | Ga0157380_103496122 | 141 |
| 375 | 3300014326 | Ga0157380_11747375 | Ga0157380_117473751 | 141 |
| 376 | 3300014497 | Ga0182008_10073828 | Ga0182008_100738282 | 141 |
| 377 | 3300014745 | Ga0157377_10184481 | Ga0157377_101844812 | 141 |
| 378 | 3300014968 | Ga0157379_10467059 | Ga0157379_104670592 | 141 |
| 379 | 3300014969 | Ga0157376_10087464 | Ga0157376_100874642 | 141 |
| 380 | 3300014969 | Ga0157376_10541565 | Ga0157376_105415652 | 141 |
| 381 | 3300014969 | Ga0157376_10569693 | Ga0157376_105696932 | 141 |
| 382 | 3300025231 | Ga0207427_101221 | Ga0207427_1012217 | 141 |
| 383 | 3300025261 | Ga0209233_1000293 | Ga0209233_100029311 | 141 |
| 384 | 3300025315 | Ga0207697_10015360 | Ga0207697_100153603 | 141 |
| 385 | 3300025893 | Ga0207682_10008798 | Ga0207682_100087984 | 141 |
| 386 | 3300025899 | Ga0207642_10043600 | Ga0207642_100436002 | 141 |
| 387 | 3300025900 | Ga0207710_10039456 | Ga0207710_100394562 | 141 |
| 388 | 3300025901 | Ga0207688_10458048 | Ga0207688_104580481 | 141 |
| 389 | 3300025903 | Ga0207680_10139028 | Ga0207680_101390283 | 141 |
| 390 | 3300025903 | Ga0207680_10282532 | Ga0207680_102825322 | 141 |
| 391 | 3300025905 | Ga0207685_10034067 | Ga0207685_100340672 | 141 |
| 392 | 3300025906 | Ga0207699_11210720 | Ga0207699_112107201 | 141 |
| 393 | 3300025907 | Ga0207645_10057305 | Ga0207645_100573051 | 141 |
| 394 | 3300025907 | Ga0207645_10551560 | Ga0207645_105515601 | 141 |
| 395 | 3300025908 | Ga0207643_10060863 | Ga0207643_100608632 | 141 |
| 396 | 3300025909 | Ga0207705_10289316 | Ga0207705_102893162 | 141 |
| 397 | 3300025911 | Ga0207654_10093465 | Ga0207654_100934652 | 141 |
| 398 | 3300025911 | Ga0207654_10465931 | Ga0207654_104659311 | 141 |
| 399 | 3300025912 | Ga0207707_11431672 | Ga0207707_114316721 | 141 |
| 400 | 3300025913 | Ga0207695_10798270 | Ga0207695_107982702 | 141 |
| 401 | 3300025914 | Ga0207671_10001074 | Ga0207671_1000107410 | 141 |
| 402 | 3300025915 | Ga0207693_10029468 | Ga0207693_100294682 | 141 |
| 403 | 3300025916 | Ga0207663_10208642 | Ga0207663_102086422 | 141 |
| 404 | 3300025917 | Ga0207660_10276744 | Ga0207660_102767442 | 141 |
| 405 | 3300025918 | Ga0207662_10072813 | Ga0207662_100728133 | 141 |
| 406 | 3300025918 | Ga0207662_10080323 | Ga0207662_100803232 | 141 |
| 407 | 3300025919 | Ga0207657_10008060 | Ga0207657_100080601 | 141 |
| 408 | 3300025919 | Ga0207657_10041042 | Ga0207657_100410425 | 141 |
| 409 | 3300025921 | Ga0207652_10084553 | Ga0207652_100845533 | 141 |
| 410 | 3300025923 | Ga0207681_10106382 | Ga0207681_101063822 | 141 |
| 411 | 3300025923 | Ga0207681_10471418 | Ga0207681_104714182 | 141 |
| 412 | 3300025924 | Ga0207694_10403009 | Ga0207694_104030092 | 141 |
| 413 | 3300025924 | Ga0207694_10578208 | Ga0207694_105782082 | 141 |
| 414 | 3300025925 | Ga0207650_10268470 | Ga0207650_102684701 | 141 |
| 415 | 3300025925 | Ga0207650_10848464 | Ga0207650_108484642 | 141 |
| 416 | 3300025926 | Ga0207659_10185582 | Ga0207659_101855821 | 141 |
| 417 | 3300025927 | Ga0207687_10716317 | Ga0207687_107163172 | 141 |
| 418 | 3300025928 | Ga0207700_10172544 | Ga0207700_101725442 | 141 |
| 419 | 3300025929 | Ga0207664_10532410 | Ga0207664_105324101 | 141 |
| 420 | 3300025931 | Ga0207644_10098952 | Ga0207644_100989522 | 141 |
| 421 | 3300025931 | Ga0207644_10882029 | Ga0207644_108820292 | 141 |
| 422 | 3300025932 | Ga0207690_10027349 | Ga0207690_100273493 | 141 |
| 423 | 3300025932 | Ga0207690_10591819 | Ga0207690_105918191 | 141 |
| 424 | 3300025932 | Ga0207690_11682718 | Ga0207690_116827181 | 141 |
| 425 | 3300025933 | Ga0207706_10016619 | Ga0207706_100166197 | 141 |
| 426 | 3300025933 | Ga0207706_10087563 | Ga0207706_100875633 | 141 |
| 427 | 3300025934 | Ga0207686_10325945 | Ga0207686_103259452 | 141 |
| 428 | 3300025934 | Ga0207686_10494202 | Ga0207686_104942022 | 141 |
| 429 | 3300025936 | Ga0207670_10255040 | Ga0207670_102550402 | 141 |
| 430 | 3300025937 | Ga0207669_10006486 | Ga0207669_100064863 | 141 |
| 431 | 3300025937 | Ga0207669_10029206 | Ga0207669_100292062 | 141 |
| 432 | 3300025937 | Ga0207669_10087837 | Ga0207669_100878372 | 141 |
| 433 | 3300025938 | Ga0207704_10099740 | Ga0207704_100997402 | 141 |
| 434 | 3300025940 | Ga0207691_10002002 | Ga0207691_1000200224 | 141 |
| 435 | 3300025940 | Ga0207691_10709187 | Ga0207691_107091872 | 141 |
| 436 | 3300025942 | Ga0207689_10030049 | Ga0207689_100300494 | 141 |
| 437 | 3300025942 | Ga0207689_10410290 | Ga0207689_104102901 | 141 |
| 438 | 3300025942 | Ga0207689_10743840 | Ga0207689_107438402 | 141 |
| 439 | 3300025944 | Ga0207661_10340521 | Ga0207661_103405212 | 141 |
| 440 | 3300025945 | Ga0207679_10392666 | Ga0207679_103926662 | 141 |
| 441 | 3300025945 | Ga0207679_11643358 | Ga0207679_116433581 | 141 |
| 442 | 3300025945 | Ga0207679_11712485 | Ga0207679_117124851 | 141 |
| 443 | 3300025949 | Ga0207667_10002756 | Ga0207667_100027567 | 141 |
| 444 | 3300025949 | Ga0207667_10599337 | Ga0207667_105993372 | 141 |
| 445 | 3300025960 | Ga0207651_10114925 | Ga0207651_101149252 | 141 |
| 446 | 3300025960 | Ga0207651_10367600 | Ga0207651_103676002 | 141 |
| 447 | 3300025960 | Ga0207651_10440773 | Ga0207651_104407732 | 141 |
| 448 | 3300025961 | Ga0207712_10135791 | Ga0207712_101357913 | 141 |
| 449 | 3300025961 | Ga0207712_10627168 | Ga0207712_106271682 | 141 |
| 450 | 3300025972 | Ga0207668_10121024 | Ga0207668_101210242 | 141 |
| 451 | 3300025972 | Ga0207668_10222582 | Ga0207668_102225822 | 141 |
| 452 | 3300025972 | Ga0207668_11857854 | Ga0207668_118578541 | 141 |
| 453 | 3300025981 | Ga0207640_10258938 | Ga0207640_102589382 | 141 |
| 454 | 3300025981 | Ga0207640_10674701 | Ga0207640_106747012 | 141 |
| 455 | 3300025986 | Ga0207658_10024826 | Ga0207658_100248266 | 141 |
| 456 | 3300026041 | Ga0207639_10007867 | Ga0207639_100078675 | 141 |
| 457 | 3300026041 | Ga0207639_10030355 | Ga0207639_100303551 | 141 |
| 458 | 3300026041 | Ga0207639_11034253 | Ga0207639_110342532 | 141 |
| 459 | 3300026067 | Ga0207678_10061242 | Ga0207678_100612424 | 141 |
| 460 | 3300026067 | Ga0207678_10109637 | Ga0207678_101096372 | 141 |
| 461 | 3300026067 | Ga0207678_10174871 | Ga0207678_101748712 | 141 |
| 462 | 3300026067 | Ga0207678_10639362 | Ga0207678_106393621 | 141 |
| 463 | 3300026075 | Ga0207708_10432885 | Ga0207708_104328852 | 141 |
| 464 | 3300026075 | Ga0207708_10467344 | Ga0207708_104673442 | 141 |
| 465 | 3300026078 | Ga0207702_10646157 | Ga0207702_106461571 | 141 |
| 466 | 3300026078 | Ga0207702_11373941 | Ga0207702_113739412 | 141 |
| 467 | 3300026088 | Ga0207641_11623367 | Ga0207641_116233671 | 141 |
| 468 | 3300026089 | Ga0207648_10065236 | Ga0207648_100652362 | 141 |
| 469 | 3300026089 | Ga0207648_10678657 | Ga0207648_106786572 | 141 |
| 470 | 3300026089 | Ga0207648_11158715 | Ga0207648_111587152 | 141 |
| 471 | 3300026095 | Ga0207676_10324571 | Ga0207676_103245712 | 141 |
| 472 | 3300026116 | Ga0207674_10049517 | Ga0207674_100495175 | 141 |
| 473 | 3300026116 | Ga0207674_10082512 | Ga0207674_100825122 | 141 |
| 474 | 3300026118 | Ga0207675_100106057 | Ga0207675_1001060573 | 141 |
| 475 | 3300026118 | Ga0207675_100260892 | Ga0207675_1002608922 | 141 |
| 476 | 3300026121 | Ga0207683_10028928 | Ga0207683_100289284 | 141 |
| 477 | 3300026121 | Ga0207683_10088805 | Ga0207683_100888053 | 141 |
| 478 | 3300026121 | Ga0207683_10191288 | Ga0207683_101912882 | 141 |
| 479 | 3300026142 | Ga0207698_11530459 | Ga0207698_115304591 | 141 |
| 480 | 3300028379 | Ga0268266_10000321 | Ga0268266_1000032135 | 141 |
| 481 | 3300028379 | Ga0268266_10202672 | Ga0268266_102026722 | 141 |
| 482 | 3300028380 | Ga0268265_11016917 | Ga0268265_110169172 | 141 |
| 483 | 3300028380 | Ga0268265_11057408 | Ga0268265_110574082 | 141 |
| 484 | 3300028381 | Ga0268264_11752435 | Ga0268264_117524351 | 141 |
| 485 | 3300031238 | Ga0265332_10109621 | Ga0265332_101096212 | 141 |
| 486 | 3300031241 | Ga0265325_10113444 | Ga0265325_101134442 | 141 |
| 487 | 3300031247 | Ga0265340_10137776 | Ga0265340_101377762 | 141 |
| 488 | 3300031247 | Ga0265340_10139947 | Ga0265340_101399472 | 141 |
| 489 | 3300031247 | Ga0265340_10232471 | Ga0265340_102324711 | 141 |
| 490 | 3300031249 | Ga0265339_10150081 | Ga0265339_101500812 | 141 |
| 491 | 3300031249 | Ga0265339_10490976 | Ga0265339_104909761 | 141 |
| 492 | 3300031250 | Ga0265331_10014022 | Ga0265331_100140222 | 141 |
| 493 | 3300031250 | Ga0265331_10030202 | Ga0265331_100302022 | 141 |
| 494 | 3300031251 | Ga0265327_10073433 | Ga0265327_100734332 | 141 |
| 495 | 3300031595 | Ga0265313_10126730 | Ga0265313_101267301 | 141 |
| 496 | 3300031711 | Ga0265314_10170794 | Ga0265314_101707941 | 141 |
| 497 | 3300031731 | Ga0307405_10123306 | Ga0307405_101233062 | 141 |
| 498 | 3300031731 | Ga0307405_11454068 | Ga0307405_114540681 | 141 |
| 499 | 3300031733 | Ga0316577_10030400 | Ga0316577_100304001 | 141 |
| 500 | 3300031852 | Ga0307410_10228305 | Ga0307410_102283052 | 141 |
| 501 | 3300031901 | Ga0307406_10237184 | Ga0307406_102371842 | 141 |
| 502 | 3300031911 | Ga0307412_10244933 | Ga0307412_102449332 | 141 |
| 503 | 3300031911 | Ga0307412_10822154 | Ga0307412_108221541 | 141 |
| 504 | 3300031911 | Ga0307412_10906346 | Ga0307412_109063461 | 141 |
| 505 | 3300031995 | Ga0307409_100307063 | Ga0307409_1003070632 | 141 |
| 506 | 3300031995 | Ga0307409_100575912 | Ga0307409_1005759121 | 141 |
| 507 | 3300032002 | Ga0307416_100293889 | Ga0307416_1002938892 | 141 |
| 508 | 3300032002 | Ga0307416_101707444 | Ga0307416_1017074442 | 141 |
| 509 | 3300032004 | Ga0307414_10201119 | Ga0307414_102011192 | 141 |
| 510 | 3300032004 | Ga0307414_10270591 | Ga0307414_102705912 | 141 |
| 511 | 3300032004 | Ga0307414_10287108 | Ga0307414_102871082 | 141 |
| 512 | 3300032004 | Ga0307414_11575382 | Ga0307414_115753821 | 141 |
| 513 | 3300032005 | Ga0307411_11426780 | Ga0307411_114267801 | 141 |
| 514 | 3300032168 | Ga0316593_10405327 | Ga0316593_104053271 | 141 |
| 515 | 3300033524 | Ga0316592_1021521 | Ga0316592_10215212 | 141 |
| 516 | 3300033541 | Ga0316596_1001896 | Ga0316596_10018966 | 141 |
| 517 | 3300034957 | Ga0373938_0151715 | Ga0373938_0151715_100_531 | 141 |
| 518 | 3300035083 | Ga0373926_0306060 | Ga0373926_0306060_146_577 | 141 |
| 519 | 3300035086 | Ga0373934_0189680 | Ga0373934_0189680_294_725 | 141 |
| 520 | 3300035089 | Ga0373944_0007536 | Ga0373944_0007536_2258_2689 | 141 |
| 521 | 3300035111 | Ga0373923_0009752 | Ga0373923_0009752_527_958 | 141 |
| 522 | 3300035113 | Ga0373936_0007704 | Ga0373936_0007704_2908_3339 | 141 |
| 523 | 3300035114 | Ga0373939_0057027 | Ga0373939_0057027_632_1057 | 141 |
| 524 | 3300035114 | Ga0373939_0190063 | Ga0373939_0190063_29_454 | 141 |
| 525 | 3300035117 | Ga0373953_0131988 | Ga0373953_0131988_370_801 | 141 |
| 526 | 3300035118 | Ga0373954_0017164 | Ga0373954_0017164_152_583 | 141 |
| 527 | 3300035119 | Ga0373956_0002024 | Ga0373956_0002024_7740_8171 | 141 |
| 528 | 3300035120 | Ga0373957_0047796 | Ga0373957_0047796_802_1233 | 141 |
| 529 | 3300035170 | Ga0373943_0118430 | Ga0373943_0118430_693_1124 | 141 |
| 530 | 3300035171 | Ga0373946_0389032 | Ga0373946_0389032_204_635 | 141 |
| 531 | 3300035207 | Ga0373942_0045379 | Ga0373942_0045379_748_1173 | 141 |
| 532 | 3300035242 | Ga0373962_0055407 | Ga0373962_0055407_493_918 | 141 |
| 533 | 3300035398 | Ga0316574_0220696 | Ga0316574_0220696_391_822 | 141 |
| 534 | 3300035691 | Ga0373931_0073097 | Ga0373931_0073097_1309_1734 | 141 |
| 535 | 3300035691 | Ga0373931_0366445 | Ga0373931_0366445_32_466 | 141 |
| 536 | 3300035692 | Ga0373935_1406871 | Ga0373935_1406871_18_449 | 141 |
| 537 | 3300035695 | Ga0373927_0062132 | Ga0373927_0062132_1936_2367 | 141 |
| 538 | 3300035695 | Ga0373927_1017743 | Ga0373927_1017743_81_512 | 141 |
| 539 | 3300035724 | Ga0373933_0002755 | Ga0373933_0002755_6256_6687 | 141 |
| 540 | 3300035725 | Ga0373947_0028367 | Ga0373947_0028367_910_1341 | 141 |
| 541 | 3300036401 | Ga0373937_0005145 | Ga0373937_0005145_5935_6366 | 141 |
| 542 | 3300037068 | Ga0373925_0052266 | Ga0373925_0052266_755_1186 | 141 |
| 543 | 3300037418 | Ga0395900_0820320 | Ga0395900_0820320_359_793 | 141 |
| 544 | 3300038443 | Ga0395901_0507376 | Ga0395901_0507376_289_723 | 141 |
| 545 | 3300041505 | Ga0451849_0727082 | Ga0451849_0727082_49_477 | 141 |
| 546 | 3300042012 | Ga0439455_0203462 | Ga0439455_0203462_115_549 | 141 |
| 547 | 3300042156 | Ga0439446_0159324 | Ga0439446_0159324_30_458 | 141 |
| 548 | 3300042157 | Ga0439458_0113097 | Ga0439458_0113097_200_634 | 141 |
| 549 | 3300042435 | Ga0439434_0099164 | Ga0439434_0099164_298_726 | 141 |
| 550 | 3300042435 | Ga0439434_0306687 | Ga0439434_0306687_25_450 | 141 |
| 551 | 3300042438 | Ga0439459_0034184 | Ga0439459_0034184_338_766 | 141 |
| 552 | 3300042438 | Ga0439459_0098213 | Ga0439459_0098213_73_507 | 141 |
| 553 | 3300042439 | Ga0439464_0228099 | Ga0439464_0228099_117_551 | 141 |
| 554 | 3300042439 | Ga0439464_0257175 | Ga0439464_0257175_84_518 | 141 |
| 555 | 3300044712 | Ga0453684_0923212 | Ga0453684_0923212_180_608 | 141 |
| 556 | 3300045051 | Ga0451576_1467352 | Ga0451576_1467352_233_664 | 141 |
| 557 | 3300046455 | Ga0495603_0018592 | Ga0495603_0018592_167_598 | 141 |
| 558 | 3300046459 | Ga0495629_0055859 | Ga0495629_0055859_75_506 | 141 |
| 559 | 3300046461 | Ga0495641_0018852 | Ga0495641_0018852_2144_2575 | 141 |
| 560 | 3300046462 | Ga0495651_0001390 | Ga0495651_0001390_12924_13355 | 141 |
| 561 | 3300046463 | Ga0495653_0003820 | Ga0495653_0003820_4424_4855 | 141 |
| 562 | 3300046474 | Ga0495605_0235909 | Ga0495605_0235909_164_589 | 141 |
| 563 | 3300046475 | Ga0495639_0017560 | Ga0495639_0017560_2391_2822 | 141 |
| 564 | 3300046476 | Ga0495662_0202270 | Ga0495662_0202270_523_954 | 141 |
| 565 | 3300046477 | Ga0495664_0003117 | Ga0495664_0003117_3646_4077 | 141 |
| 566 | 3300046477 | Ga0495664_0598038 | Ga0495664_0598038_11_442 | 141 |
| 567 | 3300046514 | Ga0495618_0006824 | Ga0495618_0006824_697_1128 | 141 |
| 568 | 3300046516 | Ga0495628_0002285 | Ga0495628_0002285_2825_3256 | 141 |
| 569 | 3300046517 | Ga0495630_0251052 | Ga0495630_0251052_889_1320 | 141 |
| 570 | 3300046523 | Ga0495644_0239872 | Ga0495644_0239872_59_538 | 141 |
| 571 | 3300046525 | Ga0495663_0035043 | Ga0495663_0035043_327_752 | 141 |
| 572 | 3300046526 | Ga0495666_0298423 | Ga0495666_0298423_234_665 | 141 |
| 573 | 3300046529 | Ga0495652_0030282 | Ga0495652_0030282_3514_3945 | 141 |
| 574 | 3300046531 | Ga0495665_0370602 | Ga0495665_0370602_195_626 | 141 |
| 575 | 3300046533 | Ga0495640_0004112 | Ga0495640_0004112_10101_10532 | 141 |
| 576 | 3300046535 | Ga0495586_0080681 | Ga0495586_0080681_642_1073 | 141 |
| 577 | 3300046536 | Ga0495587_0001073 | Ga0495587_0001073_5495_5926 | 141 |
| 578 | 3300046543 | Ga0495645_0046486 | Ga0495645_0046486_215_646 | 141 |
| 579 | 3300046543 | Ga0495645_0326268 | Ga0495645_0326268_54_485 | 141 |
| 580 | 3300046557 | Ga0495622_0018184 | Ga0495622_0018184_841_1272 | 141 |
| 581 | 3300046559 | Ga0495667_0013645 | Ga0495667_0013645_411_842 | 141 |
| 582 | 3300046615 | Ga0495656_0023382 | Ga0495656_0023382_1925_2350 | 141 |
| 583 | 3300046616 | Ga0495668_0128220 | Ga0495668_0128220_420_854 | 141 |
| 584 | 3300046660 | Ga0495625_0116698 | Ga0495625_0116698_455_889 | 141 |
| 585 | 3300046660 | Ga0495625_0540551 | Ga0495625_0540551_54_482 | 141 |
| 586 | 3300046663 | Ga0495635_0151203 | Ga0495635_0151203_54_485 | 141 |
| 587 | 3300046674 | Ga0495588_0433890 | Ga0495588_0433890_88_519 | 141 |
| 588 | 3300046678 | Ga0495599_0006958 | Ga0495599_0006958_88_519 | 141 |
| 589 | 3300046679 | Ga0495623_0000858 | Ga0495623_0000858_16117_16548 | 141 |
| 590 | 3300046683 | Ga0495658_0019075 | Ga0495658_0019075_755_1186 | 141 |
| 591 | 3300046690 | Ga0495624_0402695 | Ga0495624_0402695_64_495 | 141 |
| 592 | 3300046794 | Ga0495589_0394292 | Ga0495589_0394292_135_614 | 141 |
| 593 | 3300046809 | Ga0495600_0025274 | Ga0495600_0025274_16_447 | 141 |
| 594 | 3300047315 | Ga0495581_0346976 | Ga0495581_0346976_26_457 | 141 |
| 595 | 3300047317 | Ga0495604_0016633 | Ga0495604_0016633_2330_2761 | 141 |
| 596 | 3300047319 | Ga0495674_0026345 | Ga0495674_0026345_245_676 | 141 |
| 597 | 3300047321 | Ga0495676_0196414 | Ga0495676_0196414_219_650 | 141 |
| 598 | 3300047322 | Ga0495680_0166049 | Ga0495680_0166049_368_799 | 141 |
| 599 | 3300047444 | Ga0495675_0004449 | Ga0495675_0004449_616_1047 | 141 |
| 600 | 3300047471 | Ga0495684_0101459 | Ga0495684_0101459_539_970 | 141 |
| 601 | 3300047673 | Ga0495593_0215573 | Ga0495593_0215573_98_529 | 141 |
| 602 | 3300048088 | Ga0495602_0005814 | Ga0495602_0005814_443_874 | 141 |
| 603 | 3300048089 | Ga0495614_0047303 | Ga0495614_0047303_363_794 | 141 |
| 604 | 3300048090 | Ga0495615_0010635 | Ga0495615_0010635_953_1378 | 141 |
| 605 | 3300048903 | Ga0496100_0040182 | Ga0496100_0040182_251_682 | 141 |
| 606 | 3300048903 | Ga0496100_0277972 | Ga0496100_0277972_610_1089 | 141 |
| 607 | 3300048905 | Ga0496102_0174294 | Ga0496102_0174294_407_886 | 141 |
| 608 | 3300048905 | Ga0496102_1662577 | Ga0496102_1662577_11_451 | 141 |
| 609 | 3300048906 | Ga0496103_0132575 | Ga0496103_0132575_267_698 | 141 |
| 610 | 3300048907 | Ga0496104_0023841 | Ga0496104_0023841_352_783 | 141 |
| 611 | 3300048907 | Ga0496104_0028047 | Ga0496104_0028047_3333_3812 | 141 |
| 612 | 3300048908 | Ga0496105_0047392 | Ga0496105_0047392_295_726 | 141 |
| 613 | 3300048908 | Ga0496105_0978370 | Ga0496105_0978370_16_495 | 141 |
| 614 | 3300048909 | Ga0496106_0585041 | Ga0496106_0585041_363_794 | 141 |
| 615 | 3300048910 | Ga0496107_0003748 | Ga0496107_0003748_9098_9577 | 141 |
| 616 | 3300048910 | Ga0496107_0053847 | Ga0496107_0053847_538_969 | 141 |
| 617 | 3300048911 | Ga0496108_0177620 | Ga0496108_0177620_174_599 | 141 |
| 618 | 3300048912 | Ga0496109_0061535 | Ga0496109_0061535_1908_2339 | 141 |
| 619 | 3300048912 | Ga0496109_0087108 | Ga0496109_0087108_936_1415 | 141 |
| 620 | 3300048913 | Ga0496110_0234157 | Ga0496110_0234157_748_1176 | 141 |
| 621 | 3300048913 | Ga0496110_0246820 | Ga0496110_0246820_418_849 | 141 |
| 622 | 3300048914 | Ga0496111_0278741 | Ga0496111_0278741_673_1104 | 141 |
| 623 | 3300048915 | Ga0496112_1411252 | Ga0496112_1411252_164_598 | 141 |
| 624 | 3300048915 | Ga0496112_1478971 | Ga0496112_1478971_128_556 | 141 |
| 625 | 3300048916 | Ga0496113_0930206 | Ga0496113_0930206_138_569 | 141 |
| 626 | 3300048917 | Ga0496114_0007247 | Ga0496114_0007247_2267_2698 | 141 |
| 627 | 3300048917 | Ga0496114_0170118 | Ga0496114_0170118_316_795 | 141 |
| 628 | 3300048918 | Ga0496115_0246525 | Ga0496115_0246525_109_540 | 141 |
| 629 | 3300048918 | Ga0496115_0259984 | Ga0496115_0259984_542_1021 | 141 |
| 630 | 3300048924 | Ga0496121_0163832 | Ga0496121_0163832_260_700 | 141 |
| 631 | 3300049530 | Ga0501314_047503 | Ga0501314_047503_74_499 | 141 |
| 632 | 3300049568 | Ga0501031_0313306 | Ga0501031_0313306_216_644 | 141 |
| 633 | 3300049570 | Ga0501033_0223246 | Ga0501033_0223246_197_625 | 141 |
| 634 | 3300049571 | Ga0501034_0578963 | Ga0501034_0578963_491_919 | 141 |
| 635 | 3300049572 | Ga0501036_0823045 | Ga0501036_0823045_181_609 | 141 |
| 636 | 3300049574 | Ga0501038_0084772 | Ga0501038_0084772_1503_1931 | 141 |
| 637 | 3300049575 | Ga0501039_0019036 | Ga0501039_0019036_3804_4232 | 141 |
| 638 | 3300049577 | Ga0501041_0200918 | Ga0501041_0200918_807_1235 | 141 |
| 639 | 3300049579 | Ga0501043_0172472 | Ga0501043_0172472_353_781 | 141 |
| 640 | 3300049580 | Ga0501046_0065905 | Ga0501046_0065905_328_756 | 141 |
| 641 | 3300049582 | Ga0501048_0121695 | Ga0501048_0121695_47_475 | 141 |
| 642 | 3300049584 | Ga0501068_0543316 | Ga0501068_0543316_230_658 | 141 |
| 643 | 3300049584 | Ga0501068_0860573 | Ga0501068_0860573_35_469 | 141 |
| 644 | 3300049586 | Ga0501070_0590375 | Ga0501070_0590375_370_798 | 141 |
| 645 | 3300049587 | Ga0501071_0648387 | Ga0501071_0648387_66_494 | 141 |
| 646 | 3300049587 | Ga0501071_1590986 | Ga0501071_1590986_29_463 | 141 |
| 647 | 3300049588 | Ga0501072_0008237 | Ga0501072_0008237_6412_6840 | 141 |
| 648 | 3300049589 | Ga0501073_0064968 | Ga0501073_0064968_334_762 | 141 |
| 649 | 3300049591 | Ga0501075_0032918 | Ga0501075_0032918_1915_2343 | 141 |
| 650 | 3300049591 | Ga0501075_0796527 | Ga0501075_0796527_53_481 | 141 |
| 651 | 3300049592 | Ga0501076_0104572 | Ga0501076_0104572_245_673 | 141 |
| 652 | 3300049593 | Ga0501077_0068868 | Ga0501077_0068868_1716_2144 | 141 |
| 653 | 3300049741 | Ga0501079_0063290 | Ga0501079_0063290_2041_2466 | 141 |
| 654 | 3300049741 | Ga0501079_0196121 | Ga0501079_0196121_1040_1468 | 141 |
| 655 | 3300049742 | Ga0501080_0039373 | Ga0501080_0039373_2393_2821 | 141 |
| 656 | 3300049742 | Ga0501080_0684087 | Ga0501080_0684087_209_640 | 141 |
| 657 | 3300049743 | Ga0501081_0097039 | Ga0501081_0097039_1036_1464 | 141 |
| 658 | 3300049743 | Ga0501081_0693041 | Ga0501081_0693041_288_716 | 141 |
| 659 | 3300049743 | Ga0501081_1251931 | Ga0501081_1251931_77_514 | 141 |
| 660 | 3300049744 | Ga0501083_0224809 | Ga0501083_0224809_222_653 | 141 |
| 661 | 3300049744 | Ga0501083_0308383 | Ga0501083_0308383_231_659 | 141 |
| 662 | 3300049823 | Ga0501044_1522873 | Ga0501044_1522873_25_456 | 141 |
| 663 | 3300049824 | Ga0501045_0004375 | Ga0501045_0004375_4293_4721 | 141 |
| 664 | 3300049824 | Ga0501045_0169887 | Ga0501045_0169887_519_947 | 141 |
| 665 | 3300050489 | nmdc:mga03683_33689_c1 | nmdc:mga03683_33689_c1_715_1143 | 141 |
| 666 | 3300050490 | nmdc:mga03n38_24560_c1 | nmdc:mga03n38_24560_c1_1314_1742 | 141 |
| 667 | 3300050492 | nmdc:mga0yw44_1180623_c1 | nmdc:mga0yw44_1180623_c1_73_501 | 141 |
| 668 | 3300050496 | nmdc:mga07m45_410029_c1 | nmdc:mga07m45_410029_c1_76_510 | 141 |
| 669 | 3300050496 | nmdc:mga07m45_493059_c1 | nmdc:mga07m45_493059_c1_62_499 | 141 |
| 670 | 3300050496 | nmdc:mga07m45_621348_c1 | nmdc:mga07m45_621348_c1_34_459 | 141 |
| 671 | 3300050507 | nmdc:mga05p37_1734867_c1 | nmdc:mga05p37_1734867_c1_93_527 | 141 |
| 672 | 3300050507 | nmdc:mga05p37_469266_c1 | nmdc:mga05p37_469266_c1_89_520 | 141 |
| 673 | 3300050510 | nmdc:mga06r32_15718_c1 | nmdc:mga06r32_15718_c1_3844_4272 | 141 |
| 674 | 3300050512 | nmdc:mga0n895_49974_c1 | nmdc:mga0n895_49974_c1_746_1177 | 141 |
| 675 | 3300050513 | nmdc:mga0rr50_81104_c1 | nmdc:mga0rr50_81104_c1_205_636 | 141 |
| 676 | 3300053077 | Ga0495601_0000869 | Ga0495601_0000869_9216_9647 | 141 |
| 677 | 3300053077 | Ga0495601_0004843 | Ga0495601_0004843_6578_7009 | 141 |
| 678 | 3300053078 | Ga0495612_0022193 | Ga0495612_0022193_2026_2457 | 141 |
| 679 | 3300053078 | Ga0495612_0024354 | Ga0495612_0024354_54_485 | 141 |
| 680 | 3300053084 | Ga0495595_0001114 | Ga0495595_0001114_3641_4072 | 141 |
| 681 | 3300053085 | Ga0495619_0058599 | Ga0495619_0058599_2048_2479 | 141 |
| 682 | 3300053102 | Ga0500554_244895 | Ga0500554_244895_38_466 | 141 |
| 683 | 3300053103 | Ga0500555_034637 | Ga0500555_034637_314_745 | 141 |
| 684 | 3300053125 | Ga0500618_012222 | Ga0500618_012222_1228_1659 | 141 |
| 685 | 3300053151 | Ga0500604_0000294 | Ga0500604_0000294_12759_13184 | 141 |
| 686 | 3300053161 | Ga0500634_0000031 | Ga0500634_0000031_16543_16968 | 141 |
| 687 | 3300054114 | Ga0501084_0002334 | Ga0501084_0002334_7426_7854 | 141 |
| 688 | 3300059491 | Ga0587070_092728 | Ga0587070_092728_95_520 | 141 |
| 689 | 3300059493 | Ga0587077_141000 | Ga0587077_141000_181_606 | 141 |
| 690 | 3300059505 | Ga0587083_0162689 | Ga0587083_0162689_175_600 | 141 |
| 691 | 3300059506 | Ga0587085_114071 | Ga0587085_114071_18_443 | 141 |
| 692 | 3300059605 | Ga0587106_024404 | Ga0587106_024404_180_611 | 141 |
| 693 | 3300059627 | Ga0587117_119745 | Ga0587117_119745_83_508 | 141 |
| 694 | 3300059641 | Ga0587068_010137 | Ga0587068_010137_962_1387 | 141 |
| 695 | 3300059645 | Ga0587076_083926 | Ga0587076_083926_18_443 | 141 |
| 696 | 3300059660 | Ga0587124_030979 | Ga0587124_030979_153_578 | 141 |
| 697 | 3300060346 | Ga0587111_0126619 | Ga0587111_0126619_19_444 | 141 |
| 698 | 3300060353 | Ga0501082_0420320 | Ga0501082_0420320_110_544 | 141 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5xym-assembly1.cif.gz_N | large subunit of mycobacterium smegmatis | 0.9573 | 10 | 116 |
| 7sfr-assembly1.cif.gz_N | unmethylated mtb ribosome 50s with seq-9 | 0.9512 | 9 | 116 |
| 7pkt-assembly1.cif.gz_m | large subunit of the chlamydomonas reinhardtii mitoribosome | 0.9355 | 10 | 120 |
| 8cvm-assembly1.cif.gz_m | cutibacterium acnes 50s ribosomal subunit with p-site trna and sarecycline bound in the local refined map | 0.9351 | 9 | 116 |
| 4v4p-assembly1.cif.gz_A0 | crystal structure of 70s ribosome with thrs operator and trnas. | 0.9305 | 14 | 116 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5v7qN00 | Alpha Beta;Alpha-Beta Complex;50s Ribosomal Protein L17; Chain: A,;Ribosomal protein L17 | 0.9468 | 9 | 116 | 3.90.1030.10 |
| 1vt2N01 | Alpha Beta;Alpha-Beta Complex;50s Ribosomal Protein L17; Chain: A,;Ribosomal protein L17 | 0.9429 | 13 | 115 | 3.90.1030.10 |
| 1vs8N01 | Alpha Beta;Alpha-Beta Complex;50s Ribosomal Protein L17; Chain: A,;Ribosomal protein L17 | 0.9392 | 13 | 115 | 3.90.1030.10 |
| 1vt2N01 | Alpha Beta;Alpha-Beta Complex;50s Ribosomal Protein L17; Chain: A,;Ribosomal protein L17 | 0.9343 | 13 | 115 | 3.90.1030.10 |
| 1vs8N01 | Alpha Beta;Alpha-Beta Complex;50s Ribosomal Protein L17; Chain: A,;Ribosomal protein L17 | 0.9306 | 13 | 115 | 3.90.1030.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7C1Y7X7-F1-model_v4 | 50S ribosomal protein L17 | 0.9717 | 13 | 116 |
GO:0003735
GO:0006412 GO:0022625 |
| AF-A0A2D8ZND3-F1-model_v4 | 50S ribosomal protein L17 | 0.9701 | 20 | 124 |
GO:0003735
GO:0006412 GO:0022625 |
| AF-A0A836VM16-F1-model_v4 | 50S ribosomal protein L17 | 0.9679 | 16 | 127 |
GO:0003735
GO:0006412 GO:0022625 |
| AF-A0A6I2ZF85-F1-model_v4 | deleted | 0.9596 | 9 | 116 |
|
| AF-A0A7K1CVF8-F1-model_v4 | Large ribosomal subunit protein bL17 | 0.9585 | 9 | 116 |
GO:0003735
GO:0006412 GO:0022625 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar