F475885
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 697 | 216 | 1394 | 161 |
Family's Representative Sequence
| Representative Sequence | 3300006844|Ga0075428_100037932|Ga0075428_1000379324 |
| Length | 164 |
| Sequence | MKTHTIRGLMVAAPLALLAVLFETPVSTHHSFAMYDQTKTVVLTGIVKQFVAQANHAELHFYLIAPDRKGLAKAADGKTNVEWGVEMAGAAAVAQQGITASSFGAGTVFSVKLNPLRDGSNFGSRTGAIAKCPVDPATNKQKLPAADKHCDSVEGSTLIGGSAF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 2 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 3 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 4 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 5 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 6 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 7 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 9 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 17 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 21 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 40 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 47 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 54 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 56 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 57 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 58 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 60 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 61 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 62 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 63 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 64 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 65 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 66 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 67 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 68 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 69 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 70 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 72 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 73 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 74 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 75 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 76 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 77 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 78 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 80 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 161 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 165 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 166 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 167 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 168 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 169 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 170 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 171 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 172 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 173 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 174 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 175 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 176 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 177 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 178 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 179 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 180 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 181 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 182 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 183 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 184 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 185 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 207 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 208 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 209 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 210 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 211 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 212 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 213 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 214 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 215 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 216 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.86 |
| Metatranscriptomes | 0.14 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 0.29 |
| Rhizosphere | 99.57 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 42.75 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0075428_100037932 | 3300006844 | Bacteria | 5302 |
| 2 | JGI24746J21847_1001635 | 3300001977 | Unclassified | 3586 |
| 3 | JGI24745J21846_1005124 | 3300002073 | Bacteria | 1423 |
| 4 | JGI24033J26618_1024699 | 3300002155 | Unclassified | 786 |
| 5 | JGI24751J29686_10016979 | 3300002459 | Unclassified | 1502 |
| 6 | Ga0058859_10754822 | 3300004798 | Unclassified | 527 |
| 7 | Ga0065714_10171933 | 3300005288 | Unclassified | 1000 |
| 8 | Ga0065714_10186213 | 3300005288 | Unclassified | 944 |
| 9 | Ga0065712_10011962 | 3300005290 | Unclassified | 3863 |
| 10 | Ga0065712_10115058 | 3300005290 | Unclassified | 1757 |
| 11 | Ga0065715_10245868 | 3300005293 | Bacteria | 1183 |
| 12 | Ga0065715_10419831 | 3300005293 | Unclassified | 859 |
| 13 | Ga0065715_10789993 | 3300005293 | Unclassified | 614 |
| 14 | Ga0065707_10120319 | 3300005295 | Unclassified | 2137 |
| 15 | Ga0070676_10010445 | 3300005328 | Bacteria | 5038 |
| 16 | Ga0070676_10010989 | 3300005328 | Unclassified | 4917 |
| 17 | Ga0070676_10487302 | 3300005328 | Unclassified | 873 |
| 18 | Ga0070676_10517492 | 3300005328 | Unclassified | 849 |
| 19 | Ga0070683_100053435 | 3300005329 | Bacteria | 3743 |
| 20 | Ga0070683_100671067 | 3300005329 | Unclassified | 992 |
| 21 | Ga0070683_101548698 | 3300005329 | Bacteria | 637 |
| 22 | Ga0070690_100031451 | 3300005330 | Unclassified | 3306 |
| 23 | Ga0070690_100049125 | 3300005330 | Unclassified | 2688 |
| 24 | Ga0070690_101298146 | 3300005330 | Unclassified | 583 |
| 25 | Ga0070670_100013016 | 3300005331 | Bacteria | 7126 |
| 26 | Ga0070670_100026040 | 3300005331 | Bacteria | 5034 |
| 27 | Ga0070670_100251364 | 3300005331 | Bacteria | 1540 |
| 28 | Ga0070670_100267631 | 3300005331 | Bacteria | 1491 |
| 29 | Ga0070670_100714652 | 3300005331 | Unclassified | 901 |
| 30 | Ga0070670_101184882 | 3300005331 | Unclassified | 698 |
| 31 | Ga0070677_10024521 | 3300005333 | Unclassified | 2244 |
| 32 | Ga0070677_10050178 | 3300005333 | Unclassified | 1684 |
| 33 | Ga0070677_10084641 | 3300005333 | Unclassified | 1365 |
| 34 | Ga0070677_10153518 | 3300005333 | Unclassified | 1074 |
| 35 | Ga0070677_10693319 | 3300005333 | Bacteria | 573 |
| 36 | Ga0068869_100048051 | 3300005334 | Bacteria | 3084 |
| 37 | Ga0068869_100112521 | 3300005334 | Bacteria | 2072 |
| 38 | Ga0068869_100134919 | 3300005334 | Bacteria | 1901 |
| 39 | Ga0068869_100337489 | 3300005334 | Unclassified | 1226 |
| 40 | Ga0070666_10164670 | 3300005335 | Bacteria | 1551 |
| 41 | Ga0070666_10286284 | 3300005335 | Unclassified | 1172 |
| 42 | Ga0070666_11047398 | 3300005335 | Unclassified | 606 |
| 43 | Ga0070680_100213283 | 3300005336 | Unclassified | 1629 |
| 44 | Ga0070682_100734888 | 3300005337 | Unclassified | 795 |
| 45 | Ga0070682_101376558 | 3300005337 | Unclassified | 602 |
| 46 | Ga0068868_100167407 | 3300005338 | Bacteria | 1818 |
| 47 | Ga0068868_100274658 | 3300005338 | Unclassified | 1425 |
| 48 | Ga0070689_100014345 | 3300005340 | Bacteria | 5754 |
| 49 | Ga0070689_100065945 | 3300005340 | Bacteria | 2820 |
| 50 | Ga0070689_100171189 | 3300005340 | Unclassified | 1760 |
| 51 | Ga0070687_100011589 | 3300005343 | Unclassified | 3863 |
| 52 | Ga0070687_100116766 | 3300005343 | Bacteria | 1519 |
| 53 | Ga0070687_101327118 | 3300005343 | Unclassified | 535 |
| 54 | Ga0070661_100019734 | 3300005344 | Unclassified | 4804 |
| 55 | Ga0070661_100405958 | 3300005344 | Bacteria | 1078 |
| 56 | Ga0070661_100969664 | 3300005344 | Unclassified | 704 |
| 57 | Ga0070661_101528508 | 3300005344 | Unclassified | 563 |
| 58 | Ga0070692_10708612 | 3300005345 | Unclassified | 678 |
| 59 | Ga0070668_100466880 | 3300005347 | Unclassified | 1088 |
| 60 | Ga0070668_100682484 | 3300005347 | Unclassified | 905 |
| 61 | Ga0070668_100905496 | 3300005347 | Unclassified | 789 |
| 62 | Ga0070669_100003613 | 3300005353 | Bacteria | 11161 |
| 63 | Ga0070669_100026466 | 3300005353 | Unclassified | 4173 |
| 64 | Ga0070669_100104399 | 3300005353 | Unclassified | 2142 |
| 65 | Ga0070669_100115965 | 3300005353 | Unclassified | 2038 |
| 66 | Ga0070669_100179350 | 3300005353 | Bacteria | 1656 |
| 67 | Ga0070669_100181715 | 3300005353 | Bacteria | 1646 |
| 68 | Ga0070669_100355920 | 3300005353 | Bacteria | 1189 |
| 69 | Ga0070669_101064378 | 3300005353 | Bacteria | 696 |
| 70 | Ga0070669_101215113 | 3300005353 | Bacteria | 651 |
| 71 | Ga0070675_100000183 | 3300005354 | Bacteria | 38880 |
| 72 | Ga0070675_100000391 | 3300005354 | Bacteria | 29687 |
| 73 | Ga0070675_100000483 | 3300005354 | Bacteria | 27199 |
| 74 | Ga0070675_100005480 | 3300005354 | Bacteria | 9714 |
| 75 | Ga0070675_100017161 | 3300005354 | Bacteria | 5753 |
| 76 | Ga0070675_100078237 | 3300005354 | Bacteria | 2753 |
| 77 | Ga0070675_100091436 | 3300005354 | Unclassified | 2550 |
| 78 | Ga0070675_100118517 | 3300005354 | Bacteria | 2247 |
| 79 | Ga0070675_100276989 | 3300005354 | Bacteria | 1473 |
| 80 | Ga0070675_100770212 | 3300005354 | Bacteria | 879 |
| 81 | Ga0070675_101033805 | 3300005354 | Unclassified | 755 |
| 82 | Ga0070671_100014454 | 3300005355 | Bacteria | 6379 |
| 83 | Ga0070671_100141779 | 3300005355 | Unclassified | 2028 |
| 84 | Ga0070671_101575606 | 3300005355 | Bacteria | 582 |
| 85 | Ga0070674_100000133 | 3300005356 | Bacteria | 34091 |
| 86 | Ga0070674_100009342 | 3300005356 | Bacteria | 5870 |
| 87 | Ga0070674_100283576 | 3300005356 | Bacteria | 1314 |
| 88 | Ga0070674_100321890 | 3300005356 | Unclassified | 1240 |
| 89 | Ga0070674_101026197 | 3300005356 | Unclassified | 725 |
| 90 | Ga0070673_100044780 | 3300005364 | Unclassified | 3428 |
| 91 | Ga0070673_100104240 | 3300005364 | Unclassified | 2341 |
| 92 | Ga0070688_100057751 | 3300005365 | Unclassified | 2440 |
| 93 | Ga0070688_100069225 | 3300005365 | Bacteria | 2252 |
| 94 | Ga0070688_100084567 | 3300005365 | Bacteria | 2061 |
| 95 | Ga0070688_100102144 | 3300005365 | Bacteria | 1892 |
| 96 | Ga0070688_100605464 | 3300005365 | Unclassified | 839 |
| 97 | Ga0070688_100761604 | 3300005365 | Unclassified | 754 |
| 98 | Ga0070688_100956264 | 3300005365 | Unclassified | 678 |
| 99 | Ga0070659_100356441 | 3300005366 | Unclassified | 1228 |
| 100 | Ga0070659_100562481 | 3300005366 | Unclassified | 977 |
| 101 | Ga0070667_100013148 | 3300005367 | Bacteria | 6842 |
| 102 | Ga0070667_100220895 | 3300005367 | Unclassified | 1687 |
| 103 | Ga0070667_100336631 | 3300005367 | Bacteria | 1364 |
| 104 | Ga0070667_102202375 | 3300005367 | Bacteria | 519 |
| 105 | Ga0070701_10445774 | 3300005438 | Bacteria | 830 |
| 106 | Ga0070700_100023336 | 3300005441 | Bacteria | 3616 |
| 107 | Ga0070700_100028632 | 3300005441 | Unclassified | 3316 |
| 108 | Ga0070663_100026742 | 3300005455 | Unclassified | 3911 |
| 109 | Ga0070663_100065402 | 3300005455 | Unclassified | 2632 |
| 110 | Ga0070678_100048747 | 3300005456 | Bacteria | 3053 |
| 111 | Ga0070678_100076268 | 3300005456 | Unclassified | 2525 |
| 112 | Ga0070678_100161818 | 3300005456 | Unclassified | 1814 |
| 113 | Ga0070678_100179934 | 3300005456 | Bacteria | 1730 |
| 114 | Ga0070678_100344413 | 3300005456 | Bacteria | 1280 |
| 115 | Ga0070678_100660378 | 3300005456 | Unclassified | 939 |
| 116 | Ga0070678_100751603 | 3300005456 | Unclassified | 882 |
| 117 | Ga0070678_100759956 | 3300005456 | Bacteria | 877 |
| 118 | Ga0070678_101717211 | 3300005456 | Unclassified | 591 |
| 119 | Ga0070662_100191441 | 3300005457 | Bacteria | 1618 |
| 120 | Ga0070662_100256878 | 3300005457 | Unclassified | 1406 |
| 121 | Ga0070662_100628472 | 3300005457 | Bacteria | 905 |
| 122 | Ga0068867_100071660 | 3300005459 | Bacteria | 2593 |
| 123 | Ga0068867_100269122 | 3300005459 | Bacteria | 1392 |
| 124 | Ga0068867_100526898 | 3300005459 | Bacteria | 1020 |
| 125 | Ga0068867_100962819 | 3300005459 | Bacteria | 772 |
| 126 | Ga0068867_101106098 | 3300005459 | Unclassified | 724 |
| 127 | Ga0068867_101298289 | 3300005459 | Bacteria | 672 |
| 128 | Ga0070685_10005976 | 3300005466 | Bacteria | 6198 |
| 129 | Ga0070685_10087935 | 3300005466 | Unclassified | 1875 |
| 130 | Ga0070685_10324844 | 3300005466 | Bacteria | 1044 |
| 131 | Ga0070685_10514527 | 3300005466 | Unclassified | 849 |
| 132 | Ga0070707_101752735 | 3300005468 | Unclassified | 588 |
| 133 | Ga0070698_100234116 | 3300005471 | Unclassified | 1770 |
| 134 | Ga0070698_100302060 | 3300005471 | Bacteria | 1531 |
| 135 | Ga0070698_100634948 | 3300005471 | Unclassified | 1009 |
| 136 | Ga0070698_100901092 | 3300005471 | Bacteria | 830 |
| 137 | Ga0070699_100574254 | 3300005518 | Unclassified | 1027 |
| 138 | Ga0070679_100689561 | 3300005530 | Unclassified | 964 |
| 139 | Ga0070684_100128269 | 3300005535 | Bacteria | 2287 |
| 140 | Ga0070684_100463418 | 3300005535 | Unclassified | 1172 |
| 141 | Ga0070684_100538418 | 3300005535 | Bacteria | 1083 |
| 142 | Ga0070684_100561806 | 3300005535 | Unclassified | 1059 |
| 143 | Ga0068853_100102969 | 3300005539 | Unclassified | 2527 |
| 144 | Ga0068853_100110745 | 3300005539 | Bacteria | 2439 |
| 145 | Ga0068853_101327612 | 3300005539 | Bacteria | 695 |
| 146 | Ga0070672_100035479 | 3300005543 | Unclassified | 3791 |
| 147 | Ga0070672_100055818 | 3300005543 | Bacteria | 3095 |
| 148 | Ga0070672_100112544 | 3300005543 | Unclassified | 2220 |
| 149 | Ga0070672_100175534 | 3300005543 | Bacteria | 1784 |
| 150 | Ga0070672_100185677 | 3300005543 | Bacteria | 1734 |
| 151 | Ga0070672_100193891 | 3300005543 | Bacteria | 1697 |
| 152 | Ga0070672_100419319 | 3300005543 | Bacteria | 1149 |
| 153 | Ga0070686_100010015 | 3300005544 | Bacteria | 5336 |
| 154 | Ga0070686_100025080 | 3300005544 | Unclassified | 3582 |
| 155 | Ga0070686_100135426 | 3300005544 | Bacteria | 1708 |
| 156 | Ga0070686_100257013 | 3300005544 | Bacteria | 1279 |
| 157 | Ga0070686_100284994 | 3300005544 | Bacteria | 1220 |
| 158 | Ga0070686_100379546 | 3300005544 | Unclassified | 1070 |
| 159 | Ga0070696_100234663 | 3300005546 | Bacteria | 1381 |
| 160 | Ga0070696_100748966 | 3300005546 | Unclassified | 800 |
| 161 | Ga0070696_101002033 | 3300005546 | Unclassified | 698 |
| 162 | Ga0070696_101580981 | 3300005546 | Unclassified | 563 |
| 163 | Ga0070693_100718577 | 3300005547 | Unclassified | 733 |
| 164 | Ga0070665_100093255 | 3300005548 | Unclassified | 3016 |
| 165 | Ga0070665_100732332 | 3300005548 | Bacteria | 1002 |
| 166 | Ga0070704_100251060 | 3300005549 | Unclassified | 1453 |
| 167 | Ga0068855_100913464 | 3300005563 | Unclassified | 927 |
| 168 | Ga0070664_100000702 | 3300005564 | Bacteria | 25579 |
| 169 | Ga0070664_100040486 | 3300005564 | Unclassified | 3928 |
| 170 | Ga0070664_100129376 | 3300005564 | Unclassified | 2217 |
| 171 | Ga0070664_100193102 | 3300005564 | Bacteria | 1814 |
| 172 | Ga0070664_100794170 | 3300005564 | Bacteria | 885 |
| 173 | Ga0070664_101722164 | 3300005564 | Unclassified | 594 |
| 174 | Ga0068857_100006332 | 3300005577 | Bacteria | 10137 |
| 175 | Ga0068857_100238007 | 3300005577 | Bacteria | 1666 |
| 176 | Ga0068857_100961288 | 3300005577 | Unclassified | 821 |
| 177 | Ga0068854_100836512 | 3300005578 | Unclassified | 805 |
| 178 | Ga0068854_101115693 | 3300005578 | Unclassified | 703 |
| 179 | Ga0068856_100112717 | 3300005614 | Bacteria | 2718 |
| 180 | Ga0068856_101298430 | 3300005614 | Unclassified | 743 |
| 181 | Ga0070702_100035530 | 3300005615 | Unclassified | 2754 |
| 182 | Ga0070702_100438939 | 3300005615 | Bacteria | 944 |
| 183 | Ga0070702_100601163 | 3300005615 | Bacteria | 824 |
| 184 | Ga0070702_100868558 | 3300005615 | Unclassified | 703 |
| 185 | Ga0068852_101291374 | 3300005616 | Unclassified | 751 |
| 186 | Ga0068859_100005893 | 3300005617 | Bacteria | 12436 |
| 187 | Ga0068859_100009922 | 3300005617 | Bacteria | 9611 |
| 188 | Ga0068859_100017822 | 3300005617 | Bacteria | 7138 |
| 189 | Ga0068859_100038178 | 3300005617 | Bacteria | 4818 |
| 190 | Ga0068859_100216938 | 3300005617 | Bacteria | 2001 |
| 191 | Ga0068859_100240316 | 3300005617 | Unclassified | 1900 |
| 192 | Ga0068859_100590584 | 3300005617 | Bacteria | 1204 |
| 193 | Ga0068859_101019682 | 3300005617 | Bacteria | 909 |
| 194 | Ga0068859_101091260 | 3300005617 | Unclassified | 878 |
| 195 | Ga0068859_101421811 | 3300005617 | Unclassified | 765 |
| 196 | Ga0068864_100028526 | 3300005618 | Bacteria | 4719 |
| 197 | Ga0068864_100036064 | 3300005618 | Bacteria | 4214 |
| 198 | Ga0068864_100067180 | 3300005618 | Unclassified | 3113 |
| 199 | Ga0068864_100202197 | 3300005618 | Unclassified | 1825 |
| 200 | Ga0068864_100653877 | 3300005618 | Unclassified | 1024 |
| 201 | Ga0068864_101000268 | 3300005618 | Unclassified | 829 |
| 202 | Ga0068864_101505649 | 3300005618 | Unclassified | 676 |
| 203 | Ga0068864_102254678 | 3300005618 | Unclassified | 551 |
| 204 | Ga0068866_10048346 | 3300005718 | Unclassified | 2150 |
| 205 | Ga0068866_10249770 | 3300005718 | Unclassified | 1085 |
| 206 | Ga0068866_10425074 | 3300005718 | Unclassified | 863 |
| 207 | Ga0068866_10725001 | 3300005718 | Unclassified | 684 |
| 208 | Ga0068861_100014097 | 3300005719 | Bacteria | 5604 |
| 209 | Ga0068861_100017564 | 3300005719 | Bacteria | 5083 |
| 210 | Ga0068861_100099368 | 3300005719 | Unclassified | 2311 |
| 211 | Ga0068861_100426872 | 3300005719 | Bacteria | 1182 |
| 212 | Ga0068861_100808796 | 3300005719 | Unclassified | 880 |
| 213 | Ga0068861_100847329 | 3300005719 | Bacteria | 861 |
| 214 | Ga0068861_101094544 | 3300005719 | Bacteria | 766 |
| 215 | Ga0068851_10237880 | 3300005834 | Bacteria | 1029 |
| 216 | Ga0068870_10000968 | 3300005840 | Bacteria | 11294 |
| 217 | Ga0068870_10005293 | 3300005840 | Bacteria | 5621 |
| 218 | Ga0068870_10028367 | 3300005840 | Unclassified | 2810 |
| 219 | Ga0068870_10257547 | 3300005840 | Unclassified | 1084 |
| 220 | Ga0068870_10554896 | 3300005840 | Bacteria | 774 |
| 221 | Ga0068870_10640479 | 3300005840 | Unclassified | 727 |
| 222 | Ga0068863_100000251 | 3300005841 | Bacteria | 56835 |
| 223 | Ga0068863_100006154 | 3300005841 | Bacteria | 11769 |
| 224 | Ga0068863_100494780 | 3300005841 | Bacteria | 1204 |
| 225 | Ga0068863_100659922 | 3300005841 | Bacteria | 1038 |
| 226 | Ga0068863_100672033 | 3300005841 | Bacteria | 1028 |
| 227 | Ga0068863_101679146 | 3300005841 | Unclassified | 645 |
| 228 | Ga0068858_100005357 | 3300005842 | Bacteria | 12585 |
| 229 | Ga0068858_100023733 | 3300005842 | Bacteria | 5713 |
| 230 | Ga0068858_100049284 | 3300005842 | Bacteria | 3900 |
| 231 | Ga0068858_100057099 | 3300005842 | Bacteria | 3607 |
| 232 | Ga0068858_101373802 | 3300005842 | Bacteria | 696 |
| 233 | Ga0068860_100001061 | 3300005843 | Bacteria | 30325 |
| 234 | Ga0068860_100039472 | 3300005843 | Unclassified | 4515 |
| 235 | Ga0068860_100122071 | 3300005843 | Bacteria | 2495 |
| 236 | Ga0068860_100164079 | 3300005843 | Bacteria | 2143 |
| 237 | Ga0068860_100939703 | 3300005843 | Unclassified | 882 |
| 238 | Ga0068862_100001221 | 3300005844 | Bacteria | 24241 |
| 239 | Ga0068862_100267347 | 3300005844 | Bacteria | 1563 |
| 240 | Ga0068862_100291006 | 3300005844 | Bacteria | 1500 |
| 241 | Ga0068862_101048122 | 3300005844 | Bacteria | 808 |
| 242 | Ga0068862_101131199 | 3300005844 | Unclassified | 779 |
| 243 | Ga0068862_101786600 | 3300005844 | Unclassified | 624 |
| 244 | Ga0097621_100109423 | 3300006237 | Unclassified | 2334 |
| 245 | Ga0097621_100430544 | 3300006237 | Unclassified | 1186 |
| 246 | Ga0097621_100574712 | 3300006237 | Bacteria | 1028 |
| 247 | Ga0097621_101094489 | 3300006237 | Unclassified | 748 |
| 248 | Ga0068871_100054871 | 3300006358 | Unclassified | 3234 |
| 249 | Ga0068871_100120263 | 3300006358 | Unclassified | 2218 |
| 250 | Ga0068871_100168466 | 3300006358 | Bacteria | 1876 |
| 251 | Ga0068871_100185286 | 3300006358 | Unclassified | 1790 |
| 252 | Ga0068871_100204987 | 3300006358 | Bacteria | 1704 |
| 253 | Ga0068871_100284931 | 3300006358 | Unclassified | 1446 |
| 254 | Ga0068871_100981770 | 3300006358 | Bacteria | 786 |
| 255 | Ga0068871_101949208 | 3300006358 | Unclassified | 559 |
| 256 | Ga0075428_100113776 | 3300006844 | Bacteria | 2948 |
| 257 | Ga0075428_100279217 | 3300006844 | Bacteria | 1797 |
| 258 | Ga0075430_100020638 | 3300006846 | Bacteria | 5604 |
| 259 | Ga0075430_100260244 | 3300006846 | Unclassified | 1437 |
| 260 | Ga0075430_100342893 | 3300006846 | Unclassified | 1234 |
| 261 | Ga0075431_100008828 | 3300006847 | Bacteria | 10101 |
| 262 | Ga0075431_100097917 | 3300006847 | Bacteria | 3028 |
| 263 | Ga0075433_10003482 | 3300006852 | Bacteria | 12158 |
| 264 | Ga0075434_100077203 | 3300006871 | Unclassified | 3326 |
| 265 | Ga0075434_100724106 | 3300006871 | Unclassified | 1012 |
| 266 | Ga0075429_100058106 | 3300006880 | Bacteria | 3368 |
| 267 | Ga0075429_100258259 | 3300006880 | Bacteria | 1525 |
| 268 | Ga0068865_100004621 | 3300006881 | Bacteria | 8315 |
| 269 | Ga0068865_100020817 | 3300006881 | Unclassified | 4259 |
| 270 | Ga0068865_100239644 | 3300006881 | Bacteria | 1426 |
| 271 | Ga0068865_100313671 | 3300006881 | Bacteria | 1259 |
| 272 | Ga0068865_100335198 | 3300006881 | Unclassified | 1221 |
| 273 | Ga0068865_100339461 | 3300006881 | Bacteria | 1214 |
| 274 | Ga0068865_100761029 | 3300006881 | Bacteria | 833 |
| 275 | Ga0068865_101228185 | 3300006881 | Unclassified | 664 |
| 276 | Ga0097620_100005893 | 3300006931 | Bacteria | 12436 |
| 277 | Ga0097620_100009922 | 3300006931 | Bacteria | 9611 |
| 278 | Ga0097620_100017820 | 3300006931 | Bacteria | 7138 |
| 279 | Ga0097620_100038178 | 3300006931 | Bacteria | 4818 |
| 280 | Ga0097620_100216920 | 3300006931 | Bacteria | 2001 |
| 281 | Ga0097620_100240327 | 3300006931 | Unclassified | 1900 |
| 282 | Ga0097620_100590637 | 3300006931 | Bacteria | 1204 |
| 283 | Ga0097620_101019517 | 3300006931 | Bacteria | 909 |
| 284 | Ga0097620_101091162 | 3300006931 | Unclassified | 878 |
| 285 | Ga0097620_101421770 | 3300006931 | Unclassified | 765 |
| 286 | Ga0075435_100200901 | 3300007076 | Bacteria | 1689 |
| 287 | Ga0075435_100322605 | 3300007076 | Unclassified | 1322 |
| 288 | Ga0105240_10117746 | 3300009093 | Unclassified | 3202 |
| 289 | Ga0105240_10457091 | 3300009093 | Unclassified | 1428 |
| 290 | Ga0111539_10003340 | 3300009094 | Bacteria | 21192 |
| 291 | Ga0111539_10037556 | 3300009094 | Bacteria | 5847 |
| 292 | Ga0111539_10108094 | 3300009094 | Unclassified | 3264 |
| 293 | Ga0111539_10148075 | 3300009094 | Bacteria | 2749 |
| 294 | Ga0111539_10250697 | 3300009094 | Bacteria | 2061 |
| 295 | Ga0111539_10294713 | 3300009094 | Bacteria | 1888 |
| 296 | Ga0111539_10304037 | 3300009094 | Bacteria | 1856 |
| 297 | Ga0111539_10481343 | 3300009094 | Bacteria | 1446 |
| 298 | Ga0111539_11445067 | 3300009094 | Bacteria | 798 |
| 299 | Ga0105245_10073665 | 3300009098 | Unclassified | 3106 |
| 300 | Ga0105245_10177255 | 3300009098 | Bacteria | 2034 |
| 301 | Ga0105245_10621248 | 3300009098 | Bacteria | 1109 |
| 302 | Ga0105245_10869985 | 3300009098 | Bacteria | 942 |
| 303 | Ga0105245_11269527 | 3300009098 | Unclassified | 785 |
| 304 | Ga0105245_11467726 | 3300009098 | Unclassified | 733 |
| 305 | Ga0105247_10097635 | 3300009101 | Bacteria | 1874 |
| 306 | Ga0105247_10198788 | 3300009101 | Bacteria | 1346 |
| 307 | Ga0105247_10251434 | 3300009101 | Bacteria | 1208 |
| 308 | Ga0114129_10205770 | 3300009147 | Unclassified | 2663 |
| 309 | Ga0114129_10363197 | 3300009147 | Bacteria | 1915 |
| 310 | Ga0114129_10451259 | 3300009147 | Bacteria | 1686 |
| 311 | Ga0114129_12317314 | 3300009147 | Unclassified | 644 |
| 312 | Ga0105243_10008460 | 3300009148 | Bacteria | 7899 |
| 313 | Ga0105243_10043442 | 3300009148 | Unclassified | 3523 |
| 314 | Ga0105243_11127456 | 3300009148 | Unclassified | 794 |
| 315 | Ga0105241_10033656 | 3300009174 | Unclassified | 3848 |
| 316 | Ga0105241_10253033 | 3300009174 | Bacteria | 1494 |
| 317 | Ga0105242_10012768 | 3300009176 | Bacteria | 6470 |
| 318 | Ga0105242_10050415 | 3300009176 | Unclassified | 3389 |
| 319 | Ga0105242_10129769 | 3300009176 | Bacteria | 2174 |
| 320 | Ga0105242_10265589 | 3300009176 | Bacteria | 1552 |
| 321 | Ga0105242_10595903 | 3300009176 | Bacteria | 1067 |
| 322 | Ga0105242_10943084 | 3300009176 | Bacteria | 866 |
| 323 | Ga0105242_11230845 | 3300009176 | Bacteria | 769 |
| 324 | Ga0105242_11561275 | 3300009176 | Unclassified | 693 |
| 325 | Ga0105242_11752470 | 3300009176 | Unclassified | 658 |
| 326 | Ga0105242_11777528 | 3300009176 | Unclassified | 654 |
| 327 | Ga0105248_10000729 | 3300009177 | Bacteria | 37080 |
| 328 | Ga0105248_10011617 | 3300009177 | Bacteria | 9701 |
| 329 | Ga0105248_10041500 | 3300009177 | Bacteria | 5158 |
| 330 | Ga0105248_10059342 | 3300009177 | Unclassified | 4297 |
| 331 | Ga0105248_10504098 | 3300009177 | Bacteria | 1365 |
| 332 | Ga0105248_10582510 | 3300009177 | Unclassified | 1262 |
| 333 | Ga0105248_10644080 | 3300009177 | Bacteria | 1196 |
| 334 | Ga0105248_10935412 | 3300009177 | Unclassified | 979 |
| 335 | Ga0105248_11588902 | 3300009177 | Bacteria | 741 |
| 336 | Ga0105237_11295002 | 3300009545 | Bacteria | 735 |
| 337 | Ga0105238_10025760 | 3300009551 | Bacteria | 5997 |
| 338 | Ga0105238_10026823 | 3300009551 | Bacteria | 5872 |
| 339 | Ga0105249_10011034 | 3300009553 | Bacteria | 7937 |
| 340 | Ga0105249_10157680 | 3300009553 | Unclassified | 2190 |
| 341 | Ga0105249_10740282 | 3300009553 | Bacteria | 1045 |
| 342 | Ga0105249_10834691 | 3300009553 | Unclassified | 986 |
| 343 | Ga0105239_10084043 | 3300010375 | Bacteria | 3506 |
| 344 | Ga0105246_10045009 | 3300011119 | Unclassified | 3003 |
| 345 | Ga0105246_10405902 | 3300011119 | Bacteria | 1133 |
| 346 | Ga0105246_10485088 | 3300011119 | Bacteria | 1046 |
| 347 | Ga0105246_10901113 | 3300011119 | Bacteria | 793 |
| 348 | Ga0105246_11531383 | 3300011119 | Unclassified | 627 |
| 349 | Ga0105246_11605145 | 3300011119 | Unclassified | 615 |
| 350 | Ga0105246_11967806 | 3300011119 | Bacteria | 563 |
| 351 | Ga0157373_10280109 | 3300013100 | Unclassified | 1182 |
| 352 | Ga0157371_10183622 | 3300013102 | Bacteria | 1496 |
| 353 | Ga0157374_10044024 | 3300013296 | Unclassified | 4125 |
| 354 | Ga0157374_10169695 | 3300013296 | Unclassified | 2128 |
| 355 | Ga0157374_11362449 | 3300013296 | Bacteria | 732 |
| 356 | Ga0157378_10522188 | 3300013297 | Bacteria | 1189 |
| 357 | Ga0157378_10528239 | 3300013297 | Bacteria | 1182 |
| 358 | Ga0157378_10580924 | 3300013297 | Unclassified | 1129 |
| 359 | Ga0157378_10634673 | 3300013297 | Bacteria | 1082 |
| 360 | Ga0157378_10959924 | 3300013297 | Bacteria | 888 |
| 361 | Ga0157378_11951810 | 3300013297 | Unclassified | 636 |
| 362 | Ga0163162_10095378 | 3300013306 | Unclassified | 3061 |
| 363 | Ga0163162_10273079 | 3300013306 | Unclassified | 1822 |
| 364 | Ga0163162_10850172 | 3300013306 | Bacteria | 1028 |
| 365 | Ga0163162_12132559 | 3300013306 | Bacteria | 643 |
| 366 | Ga0163162_12589691 | 3300013306 | Bacteria | 584 |
| 367 | Ga0157372_10285827 | 3300013307 | Bacteria | 1918 |
| 368 | Ga0157372_10439783 | 3300013307 | Unclassified | 1520 |
| 369 | Ga0157375_10000300 | 3300013308 | Bacteria | 44788 |
| 370 | Ga0157375_10078515 | 3300013308 | Unclassified | 3334 |
| 371 | Ga0157375_10526865 | 3300013308 | Unclassified | 1344 |
| 372 | Ga0157375_10800746 | 3300013308 | Unclassified | 1091 |
| 373 | Ga0157375_11141035 | 3300013308 | Unclassified | 913 |
| 374 | Ga0157375_11145735 | 3300013308 | Unclassified | 911 |
| 375 | Ga0163163_10051676 | 3300014325 | Unclassified | 4052 |
| 376 | Ga0163163_10067984 | 3300014325 | Bacteria | 3544 |
| 377 | Ga0163163_10421541 | 3300014325 | Unclassified | 1393 |
| 378 | Ga0163163_10653071 | 3300014325 | Bacteria | 1115 |
| 379 | Ga0163163_10909582 | 3300014325 | Bacteria | 943 |
| 380 | Ga0163163_11159897 | 3300014325 | Bacteria | 835 |
| 381 | Ga0163163_11334754 | 3300014325 | Bacteria | 779 |
| 382 | Ga0157380_10012655 | 3300014326 | Bacteria | 6124 |
| 383 | Ga0157380_10064776 | 3300014326 | Bacteria | 2935 |
| 384 | Ga0157380_10322192 | 3300014326 | Bacteria | 1433 |
| 385 | Ga0157380_10544790 | 3300014326 | Bacteria | 1137 |
| 386 | Ga0157380_12227105 | 3300014326 | Bacteria | 612 |
| 387 | Ga0157380_12918189 | 3300014326 | Bacteria | 544 |
| 388 | Ga0157377_10277652 | 3300014745 | Bacteria | 1097 |
| 389 | Ga0157377_10454759 | 3300014745 | Bacteria | 885 |
| 390 | Ga0157377_10517856 | 3300014745 | Unclassified | 837 |
| 391 | Ga0157379_10000645 | 3300014968 | Bacteria | 28149 |
| 392 | Ga0157379_10028324 | 3300014968 | Bacteria | 4984 |
| 393 | Ga0157379_10251089 | 3300014968 | Bacteria | 1606 |
| 394 | Ga0157379_10894593 | 3300014968 | Bacteria | 842 |
| 395 | Ga0157376_10087688 | 3300014969 | Unclassified | 2686 |
| 396 | Ga0157376_10097115 | 3300014969 | Unclassified | 2566 |
| 397 | Ga0157376_10539678 | 3300014969 | Bacteria | 1152 |
| 398 | Ga0157376_10678231 | 3300014969 | Bacteria | 1034 |
| 399 | Ga0157376_10837796 | 3300014969 | Bacteria | 934 |
| 400 | Ga0157376_10931255 | 3300014969 | Bacteria | 888 |
| 401 | Ga0163161_10026739 | 3300017792 | Unclassified | 4089 |
| 402 | Ga0163161_10715754 | 3300017792 | Unclassified | 835 |
| 403 | Ga0207697_10001648 | 3300025315 | Bacteria | 12069 |
| 404 | Ga0207697_10072877 | 3300025315 | Unclassified | 1441 |
| 405 | Ga0207682_10007712 | 3300025893 | Unclassified | 4279 |
| 406 | Ga0207682_10022597 | 3300025893 | Bacteria | 2479 |
| 407 | Ga0207682_10067501 | 3300025893 | Unclassified | 1509 |
| 408 | Ga0207682_10451385 | 3300025893 | Unclassified | 609 |
| 409 | Ga0207642_10055949 | 3300025899 | Unclassified | 1807 |
| 410 | Ga0207642_10294259 | 3300025899 | Unclassified | 939 |
| 411 | Ga0207642_10639676 | 3300025899 | Unclassified | 665 |
| 412 | Ga0207710_10097752 | 3300025900 | Bacteria | 1381 |
| 413 | Ga0207710_10356397 | 3300025900 | Bacteria | 746 |
| 414 | Ga0207710_10513218 | 3300025900 | Unclassified | 622 |
| 415 | Ga0207688_10005062 | 3300025901 | Bacteria | 7171 |
| 416 | Ga0207688_10013358 | 3300025901 | Bacteria | 4461 |
| 417 | Ga0207688_10309719 | 3300025901 | Bacteria | 967 |
| 418 | Ga0207680_10006790 | 3300025903 | Bacteria | 5553 |
| 419 | Ga0207680_10188690 | 3300025903 | Bacteria | 1398 |
| 420 | Ga0207680_10252911 | 3300025903 | Unclassified | 1217 |
| 421 | Ga0207680_10779242 | 3300025903 | Bacteria | 685 |
| 422 | Ga0207645_10003388 | 3300025907 | Bacteria | 12118 |
| 423 | Ga0207645_10006606 | 3300025907 | Bacteria | 8291 |
| 424 | Ga0207645_10191778 | 3300025907 | Bacteria | 1343 |
| 425 | Ga0207645_10383545 | 3300025907 | Unclassified | 944 |
| 426 | Ga0207645_10451348 | 3300025907 | Bacteria | 868 |
| 427 | Ga0207643_10002413 | 3300025908 | Bacteria | 10115 |
| 428 | Ga0207643_10033063 | 3300025908 | Bacteria | 2893 |
| 429 | Ga0207643_10072958 | 3300025908 | Bacteria | 1978 |
| 430 | Ga0207643_10104411 | 3300025908 | Bacteria | 1664 |
| 431 | Ga0207643_10568919 | 3300025908 | Unclassified | 728 |
| 432 | Ga0207654_10443845 | 3300025911 | Unclassified | 909 |
| 433 | Ga0207695_10334715 | 3300025913 | Unclassified | 1402 |
| 434 | Ga0207660_10729454 | 3300025917 | Unclassified | 808 |
| 435 | Ga0207662_10005021 | 3300025918 | Bacteria | 7005 |
| 436 | Ga0207662_10071033 | 3300025918 | Unclassified | 2107 |
| 437 | Ga0207662_11136397 | 3300025918 | Unclassified | 555 |
| 438 | Ga0207657_10316943 | 3300025919 | Bacteria | 1234 |
| 439 | Ga0207657_11382995 | 3300025919 | Bacteria | 529 |
| 440 | Ga0207649_10042309 | 3300025920 | Unclassified | 2778 |
| 441 | Ga0207649_10215481 | 3300025920 | Bacteria | 1365 |
| 442 | Ga0207649_10370641 | 3300025920 | Bacteria | 1065 |
| 443 | Ga0207681_10049948 | 3300025923 | Bacteria | 2829 |
| 444 | Ga0207681_10084897 | 3300025923 | Unclassified | 2246 |
| 445 | Ga0207681_10105635 | 3300025923 | Bacteria | 2039 |
| 446 | Ga0207681_10163765 | 3300025923 | Bacteria | 1679 |
| 447 | Ga0207681_10168913 | 3300025923 | Bacteria | 1656 |
| 448 | Ga0207681_10260069 | 3300025923 | Unclassified | 1358 |
| 449 | Ga0207681_10355355 | 3300025923 | Bacteria | 1174 |
| 450 | Ga0207694_10189954 | 3300025924 | Bacteria | 1668 |
| 451 | Ga0207694_10225540 | 3300025924 | Unclassified | 1529 |
| 452 | Ga0207694_10552952 | 3300025924 | Bacteria | 966 |
| 453 | Ga0207650_10088151 | 3300025925 | Unclassified | 2366 |
| 454 | Ga0207650_10154725 | 3300025925 | Bacteria | 1812 |
| 455 | Ga0207650_10223330 | 3300025925 | Bacteria | 1517 |
| 456 | Ga0207650_10236937 | 3300025925 | Unclassified | 1474 |
| 457 | Ga0207650_10267583 | 3300025925 | Unclassified | 1388 |
| 458 | Ga0207650_10428600 | 3300025925 | Bacteria | 1098 |
| 459 | Ga0207659_10000383 | 3300025926 | Bacteria | 26664 |
| 460 | Ga0207659_10005332 | 3300025926 | Bacteria | 7791 |
| 461 | Ga0207659_10010576 | 3300025926 | Bacteria | 5803 |
| 462 | Ga0207659_10019767 | 3300025926 | Bacteria | 4439 |
| 463 | Ga0207659_10040671 | 3300025926 | Unclassified | 3252 |
| 464 | Ga0207659_10057148 | 3300025926 | Unclassified | 2796 |
| 465 | Ga0207659_10079829 | 3300025926 | Bacteria | 2415 |
| 466 | Ga0207659_10241548 | 3300025926 | Unclassified | 1461 |
| 467 | Ga0207659_10263831 | 3300025926 | Unclassified | 1402 |
| 468 | Ga0207659_10704436 | 3300025926 | Bacteria | 865 |
| 469 | Ga0207659_10780341 | 3300025926 | Bacteria | 820 |
| 470 | Ga0207659_10982565 | 3300025926 | Bacteria | 726 |
| 471 | Ga0207659_11573780 | 3300025926 | Unclassified | 561 |
| 472 | Ga0207687_10550157 | 3300025927 | Bacteria | 968 |
| 473 | Ga0207644_10037390 | 3300025931 | Bacteria | 3415 |
| 474 | Ga0207644_10052317 | 3300025931 | Unclassified | 2934 |
| 475 | Ga0207644_10077928 | 3300025931 | Unclassified | 2442 |
| 476 | Ga0207644_10087366 | 3300025931 | Unclassified | 2317 |
| 477 | Ga0207644_10835181 | 3300025931 | Unclassified | 771 |
| 478 | Ga0207644_11118107 | 3300025931 | Unclassified | 662 |
| 479 | Ga0207644_11501874 | 3300025931 | Unclassified | 565 |
| 480 | Ga0207690_10164439 | 3300025932 | Unclassified | 1657 |
| 481 | Ga0207690_10469723 | 3300025932 | Bacteria | 1014 |
| 482 | Ga0207706_10014665 | 3300025933 | Bacteria | 7097 |
| 483 | Ga0207706_10138670 | 3300025933 | Bacteria | 2139 |
| 484 | Ga0207706_10217973 | 3300025933 | Bacteria | 1671 |
| 485 | Ga0207686_10052488 | 3300025934 | Unclassified | 2545 |
| 486 | Ga0207686_10068579 | 3300025934 | Unclassified | 2272 |
| 487 | Ga0207686_10166173 | 3300025934 | Bacteria | 1552 |
| 488 | Ga0207686_10168480 | 3300025934 | Bacteria | 1542 |
| 489 | Ga0207686_10195567 | 3300025934 | Unclassified | 1445 |
| 490 | Ga0207709_10047973 | 3300025935 | Unclassified | 2600 |
| 491 | Ga0207709_10100785 | 3300025935 | Unclassified | 1909 |
| 492 | Ga0207709_11180146 | 3300025935 | Bacteria | 630 |
| 493 | Ga0207670_10049132 | 3300025936 | Bacteria | 2820 |
| 494 | Ga0207670_10053249 | 3300025936 | Unclassified | 2725 |
| 495 | Ga0207670_10145061 | 3300025936 | Bacteria | 1755 |
| 496 | Ga0207670_10259788 | 3300025936 | Bacteria | 1346 |
| 497 | Ga0207670_10283376 | 3300025936 | Unclassified | 1292 |
| 498 | Ga0207669_10027118 | 3300025937 | Bacteria | 3129 |
| 499 | Ga0207669_10203749 | 3300025937 | Bacteria | 1438 |
| 500 | Ga0207669_10248819 | 3300025937 | Unclassified | 1322 |
| 501 | Ga0207669_10552603 | 3300025937 | Unclassified | 929 |
| 502 | Ga0207704_10004007 | 3300025938 | Bacteria | 6705 |
| 503 | Ga0207704_10006688 | 3300025938 | Bacteria | 5400 |
| 504 | Ga0207704_10342980 | 3300025938 | Bacteria | 1160 |
| 505 | Ga0207704_10590120 | 3300025938 | Unclassified | 908 |
| 506 | Ga0207691_10005619 | 3300025940 | Bacteria | 12118 |
| 507 | Ga0207691_10025920 | 3300025940 | Bacteria | 5502 |
| 508 | Ga0207691_10096230 | 3300025940 | Bacteria | 2647 |
| 509 | Ga0207691_10139230 | 3300025940 | Unclassified | 2139 |
| 510 | Ga0207691_10442991 | 3300025940 | Unclassified | 1106 |
| 511 | Ga0207691_10446558 | 3300025940 | Unclassified | 1101 |
| 512 | Ga0207691_10798475 | 3300025940 | Unclassified | 793 |
| 513 | Ga0207711_10025690 | 3300025941 | Unclassified | 4939 |
| 514 | Ga0207711_10083937 | 3300025941 | Bacteria | 2787 |
| 515 | Ga0207711_10085761 | 3300025941 | Unclassified | 2760 |
| 516 | Ga0207711_10103758 | 3300025941 | Bacteria | 2518 |
| 517 | Ga0207711_10111601 | 3300025941 | Bacteria | 2432 |
| 518 | Ga0207711_11062307 | 3300025941 | Bacteria | 750 |
| 519 | Ga0207711_11206690 | 3300025941 | Bacteria | 698 |
| 520 | Ga0207689_10003959 | 3300025942 | Bacteria | 13486 |
| 521 | Ga0207689_10009438 | 3300025942 | Bacteria | 8424 |
| 522 | Ga0207689_10012760 | 3300025942 | Bacteria | 7180 |
| 523 | Ga0207689_10210059 | 3300025942 | Unclassified | 1608 |
| 524 | Ga0207689_10366487 | 3300025942 | Bacteria | 1198 |
| 525 | Ga0207689_11446777 | 3300025942 | Unclassified | 575 |
| 526 | Ga0207661_10190021 | 3300025944 | Bacteria | 1800 |
| 527 | Ga0207661_10287203 | 3300025944 | Bacteria | 1471 |
| 528 | Ga0207679_10011736 | 3300025945 | Bacteria | 5689 |
| 529 | Ga0207679_10033244 | 3300025945 | Bacteria | 3628 |
| 530 | Ga0207679_10115007 | 3300025945 | Unclassified | 2131 |
| 531 | Ga0207679_10212373 | 3300025945 | Bacteria | 1623 |
| 532 | Ga0207679_10388847 | 3300025945 | Bacteria | 1224 |
| 533 | Ga0207667_10262696 | 3300025949 | Unclassified | 1765 |
| 534 | Ga0207651_10193189 | 3300025960 | Unclassified | 1625 |
| 535 | Ga0207651_10212600 | 3300025960 | Bacteria | 1558 |
| 536 | Ga0207651_10256043 | 3300025960 | Bacteria | 1434 |
| 537 | Ga0207651_10318538 | 3300025960 | Bacteria | 1299 |
| 538 | Ga0207651_10392811 | 3300025960 | Unclassified | 1178 |
| 539 | Ga0207712_10096663 | 3300025961 | Bacteria | 2186 |
| 540 | Ga0207712_10167876 | 3300025961 | Bacteria | 1712 |
| 541 | Ga0207712_10356990 | 3300025961 | Unclassified | 1217 |
| 542 | Ga0207668_10050498 | 3300025972 | Bacteria | 2867 |
| 543 | Ga0207668_10146089 | 3300025972 | Bacteria | 1825 |
| 544 | Ga0207668_10153704 | 3300025972 | Unclassified | 1785 |
| 545 | Ga0207668_10237540 | 3300025972 | Bacteria | 1473 |
| 546 | Ga0207640_10287698 | 3300025981 | Unclassified | 1294 |
| 547 | Ga0207640_10359450 | 3300025981 | Unclassified | 1173 |
| 548 | Ga0207640_10624567 | 3300025981 | Unclassified | 915 |
| 549 | Ga0207658_10026093 | 3300025986 | Bacteria | 4094 |
| 550 | Ga0207658_10108142 | 3300025986 | Unclassified | 2193 |
| 551 | Ga0207658_10245863 | 3300025986 | Unclassified | 1518 |
| 552 | Ga0207658_10364690 | 3300025986 | Bacteria | 1261 |
| 553 | Ga0207658_10540482 | 3300025986 | Bacteria | 1042 |
| 554 | Ga0207677_10026579 | 3300026023 | Bacteria | 3633 |
| 555 | Ga0207677_10356690 | 3300026023 | Unclassified | 1227 |
| 556 | Ga0207703_10018629 | 3300026035 | Bacteria | 5422 |
| 557 | Ga0207703_10041326 | 3300026035 | Bacteria | 3693 |
| 558 | Ga0207703_10050178 | 3300026035 | Bacteria | 3376 |
| 559 | Ga0207703_10466734 | 3300026035 | Unclassified | 1181 |
| 560 | Ga0207703_10774804 | 3300026035 | Bacteria | 915 |
| 561 | Ga0207703_10912878 | 3300026035 | Bacteria | 841 |
| 562 | Ga0207703_11184165 | 3300026035 | Unclassified | 735 |
| 563 | Ga0207639_10075833 | 3300026041 | Unclassified | 2646 |
| 564 | Ga0207639_10792040 | 3300026041 | Unclassified | 883 |
| 565 | Ga0207678_10016394 | 3300026067 | Bacteria | 6505 |
| 566 | Ga0207708_10006488 | 3300026075 | Bacteria | 8666 |
| 567 | Ga0207708_10026968 | 3300026075 | Bacteria | 4350 |
| 568 | Ga0207708_10406986 | 3300026075 | Bacteria | 1126 |
| 569 | Ga0207702_10077992 | 3300026078 | Unclassified | 2867 |
| 570 | Ga0207702_11050523 | 3300026078 | Unclassified | 808 |
| 571 | Ga0207641_10000486 | 3300026088 | Bacteria | 44787 |
| 572 | Ga0207641_10017431 | 3300026088 | Bacteria | 5879 |
| 573 | Ga0207641_10205915 | 3300026088 | Bacteria | 1817 |
| 574 | Ga0207641_10271526 | 3300026088 | Bacteria | 1591 |
| 575 | Ga0207641_10630006 | 3300026088 | Bacteria | 1052 |
| 576 | Ga0207641_10727942 | 3300026088 | Bacteria | 978 |
| 577 | Ga0207648_10005401 | 3300026089 | Bacteria | 12881 |
| 578 | Ga0207648_10025569 | 3300026089 | Bacteria | 5257 |
| 579 | Ga0207648_10102275 | 3300026089 | Bacteria | 2511 |
| 580 | Ga0207648_10163480 | 3300026089 | Bacteria | 1966 |
| 581 | Ga0207648_10317261 | 3300026089 | Bacteria | 1400 |
| 582 | Ga0207648_10327055 | 3300026089 | Bacteria | 1378 |
| 583 | Ga0207648_10382401 | 3300026089 | Bacteria | 1273 |
| 584 | Ga0207648_10591234 | 3300026089 | Bacteria | 1022 |
| 585 | Ga0207676_10015022 | 3300026095 | Bacteria | 5582 |
| 586 | Ga0207676_10055770 | 3300026095 | Unclassified | 3104 |
| 587 | Ga0207676_10082003 | 3300026095 | Bacteria | 2622 |
| 588 | Ga0207676_10111225 | 3300026095 | Bacteria | 2292 |
| 589 | Ga0207676_10236186 | 3300026095 | Unclassified | 1637 |
| 590 | Ga0207676_11171657 | 3300026095 | Unclassified | 761 |
| 591 | Ga0207674_10013186 | 3300026116 | Bacteria | 9193 |
| 592 | Ga0207674_10459776 | 3300026116 | Bacteria | 1230 |
| 593 | Ga0207674_10708901 | 3300026116 | Bacteria | 971 |
| 594 | Ga0207675_100029618 | 3300026118 | Bacteria | 5098 |
| 595 | Ga0207675_100043959 | 3300026118 | Unclassified | 4172 |
| 596 | Ga0207675_100086437 | 3300026118 | Bacteria | 2945 |
| 597 | Ga0207675_100186474 | 3300026118 | Bacteria | 1988 |
| 598 | Ga0207675_100352179 | 3300026118 | Bacteria | 1443 |
| 599 | Ga0207675_100511052 | 3300026118 | Unclassified | 1197 |
| 600 | Ga0207683_10006075 | 3300026121 | Bacteria | 10341 |
| 601 | Ga0207683_10025317 | 3300026121 | Bacteria | 5118 |
| 602 | Ga0207683_10090957 | 3300026121 | Unclassified | 2718 |
| 603 | Ga0207683_10100814 | 3300026121 | Bacteria | 2578 |
| 604 | Ga0207683_10143374 | 3300026121 | Unclassified | 2153 |
| 605 | Ga0207683_10195757 | 3300026121 | Bacteria | 1836 |
| 606 | Ga0207683_10582820 | 3300026121 | Unclassified | 1035 |
| 607 | Ga0207683_10717085 | 3300026121 | Unclassified | 927 |
| 608 | Ga0207698_11065936 | 3300026142 | Unclassified | 820 |
| 609 | Ga0209973_1008751 | 3300027252 | Bacteria | 1164 |
| 610 | Ga0209970_1034667 | 3300027614 | Unclassified | 885 |
| 611 | Ga0207428_10017850 | 3300027907 | Bacteria | 6082 |
| 612 | Ga0207428_10023972 | 3300027907 | Bacteria | 5125 |
| 613 | Ga0207428_10035418 | 3300027907 | Unclassified | 4080 |
| 614 | Ga0207428_10517582 | 3300027907 | Bacteria | 865 |
| 615 | Ga0268266_10101997 | 3300028379 | Unclassified | 2531 |
| 616 | Ga0268266_10630244 | 3300028379 | Bacteria | 1031 |
| 617 | Ga0268266_10830570 | 3300028379 | Unclassified | 893 |
| 618 | Ga0268265_10012300 | 3300028380 | Bacteria | 5799 |
| 619 | Ga0268265_10169774 | 3300028380 | Bacteria | 1863 |
| 620 | Ga0268265_10170763 | 3300028380 | Bacteria | 1858 |
| 621 | Ga0268265_10919832 | 3300028380 | Unclassified | 860 |
| 622 | Ga0268264_10015149 | 3300028381 | Bacteria | 6325 |
| 623 | Ga0268264_10042468 | 3300028381 | Bacteria | 3764 |
| 624 | Ga0268264_10149126 | 3300028381 | Bacteria | 2095 |
| 625 | Ga0268264_12083841 | 3300028381 | Bacteria | 576 |
| 626 | Ga0268264_12248945 | 3300028381 | Bacteria | 553 |
| 627 | Ga0265332_10157016 | 3300031238 | Bacteria | 951 |
| 628 | Ga0307408_100249607 | 3300031548 | Bacteria | 1463 |
| 629 | Ga0307405_11096374 | 3300031731 | Bacteria | 684 |
| 630 | Ga0307410_10261541 | 3300031852 | Bacteria | 1350 |
| 631 | Ga0307412_10477647 | 3300031911 | Unclassified | 1033 |
| 632 | Ga0307416_100924240 | 3300032002 | Bacteria | 973 |
| 633 | Ga0307414_10483865 | 3300032004 | Bacteria | 1092 |
| 634 | Ga0307415_100289830 | 3300032126 | Bacteria | 1351 |
| 635 | Ga0373932_0055698 | 3300035112 | Bacteria | 1187 |
| 636 | Ga0373942_0341022 | 3300035207 | Unclassified | 528 |
| 637 | Ga0373961_0186806 | 3300035241 | Bacteria | 725 |
| 638 | Ga0373937_0834228 | 3300036401 | Unclassified | 870 |
| 639 | Ga0436362_0945229 | 3300039453 | Unclassified | 618 |
| 640 | Ga0439453_0010314 | 3300041408 | Unclassified | 1538 |
| 641 | Ga0439451_057116 | 3300042009 | Bacteria | 781 |
| 642 | Ga0450919_026494 | 3300042121 | Bacteria | 659 |
| 643 | Ga0439435_0003672 | 3300042436 | Bacteria | 3217 |
| 644 | Ga0439459_0136976 | 3300042438 | Unclassified | 630 |
| 645 | Ga0439460_0114152 | 3300042461 | Bacteria | 879 |
| 646 | Ga0453683_0476702 | 3300044673 | Unclassified | 809 |
| 647 | Ga0451576_0245048 | 3300045051 | Unclassified | 1872 |
| 648 | Ga0495582_0001891 | 3300046473 | Bacteria | 11807 |
| 649 | Ga0495639_0044567 | 3300046475 | Bacteria | 2005 |
| 650 | Ga0495639_0237885 | 3300046475 | Bacteria | 898 |
| 651 | Ga0495664_0046799 | 3300046477 | Unclassified | 2567 |
| 652 | Ga0495594_0189325 | 3300046499 | Bacteria | 1172 |
| 653 | Ga0495594_0355410 | 3300046499 | Bacteria | 834 |
| 654 | Ga0495607_0277421 | 3300046501 | Unclassified | 797 |
| 655 | Ga0495628_0186366 | 3300046516 | Unclassified | 1568 |
| 656 | Ga0495630_0082495 | 3300046517 | Bacteria | 2427 |
| 657 | Ga0495666_0197775 | 3300046526 | Unclassified | 925 |
| 658 | Ga0495642_0272998 | 3300046528 | Unclassified | 740 |
| 659 | Ga0495652_0840522 | 3300046529 | Bacteria | 609 |
| 660 | Ga0495586_0009620 | 3300046535 | Bacteria | 5150 |
| 661 | Ga0495586_0238497 | 3300046535 | Bacteria | 1036 |
| 662 | Ga0495598_0026363 | 3300046537 | Bacteria | 1593 |
| 663 | Ga0495598_0336025 | 3300046537 | Unclassified | 579 |
| 664 | Ga0495645_0121696 | 3300046543 | Unclassified | 1837 |
| 665 | Ga0495656_0368533 | 3300046615 | Unclassified | 747 |
| 666 | Ga0495634_0049605 | 3300046642 | Bacteria | 2822 |
| 667 | Ga0495634_0277705 | 3300046642 | Bacteria | 1018 |
| 668 | Ga0495658_0010972 | 3300046683 | Bacteria | 4543 |
| 669 | Ga0495658_0079337 | 3300046683 | Bacteria | 1923 |
| 670 | Ga0495581_0063198 | 3300047315 | Bacteria | 2139 |
| 671 | Ga0495674_0286555 | 3300047319 | Bacteria | 1348 |
| 672 | Ga0495675_0377791 | 3300047444 | Unclassified | 829 |
| 673 | Ga0495684_0636176 | 3300047471 | Bacteria | 715 |
| 674 | Ga0495614_0302229 | 3300048089 | Unclassified | 740 |
| 675 | Ga0496114_0147379 | 3300048917 | Unclassified | 2041 |
| 676 | Ga0496114_0386095 | 3300048917 | Bacteria | 1240 |
| 677 | Ga0501225_0195657 | 3300049705 | Unclassified | 639 |
| 678 | nmdc:mga05p37_188855_c1 | 3300050507 | Bacteria | 2503 |
| 679 | nmdc:mga09592_13731_c1 | 3300050508 | Bacteria | 6617 |
| 680 | nmdc:mga09592_59036_c1 | 3300050508 | Bacteria | 3243 |
| 681 | nmdc:mga0qj67_11252_c1 | 3300050509 | Bacteria | 6702 |
| 682 | nmdc:mga0qj67_375999_c1 | 3300050509 | Unclassified | 1147 |
| 683 | nmdc:mga06r32_114082_c1 | 3300050510 | Bacteria | 2660 |
| 684 | nmdc:mga06r32_3004_c1 | 3300050510 | Bacteria | 15109 |
| 685 | nmdc:mga08y16_1019080_c1 | 3300050511 | Unclassified | 807 |
| 686 | nmdc:mga08y16_1755_c1 | 3300050511 | Bacteria | 21970 |
| 687 | nmdc:mga08y16_200614_c1 | 3300050511 | Unclassified | 2067 |
| 688 | nmdc:mga08y16_306168_c1 | 3300050511 | Bacteria | 1637 |
| 689 | nmdc:mga08y16_593339_c1 | 3300050511 | Bacteria | 1117 |
| 690 | nmdc:mga08y16_72657_c1 | 3300050511 | Bacteria | 3584 |
| 691 | nmdc:mga08y16_7619_c1 | 3300050511 | Bacteria | 11331 |
| 692 | nmdc:mga0n895_447616_c1 | 3300050512 | Unclassified | 1304 |
| 693 | nmdc:mga0n895_79582_c1 | 3300050512 | Unclassified | 3264 |
| 694 | nmdc:mga0n895_855833_c1 | 3300050512 | Unclassified | 897 |
| 695 | nmdc:mga0rr50_345661_c1 | 3300050513 | Unclassified | 1250 |
| 696 | nmdc:mga08x19_986476_c1 | 3300050514 | Unclassified | 598 |
| 697 | nmdc:mga0a205_4439_c1 | 3300050515 | Bacteria | 12597 |
| 698 | Ga0075428_100037932 | |||
| 699 | JGI24746J21847_1001635 | |||
| 700 | JGI24745J21846_1005124 | |||
| 701 | JGI24033J26618_1024699 | |||
| 702 | JGI24751J29686_10016979 | |||
| 703 | Ga0058859_10754822 | |||
| 704 | Ga0065714_10171933 | |||
| 705 | Ga0065714_10186213 | |||
| 706 | Ga0065712_10011962 | |||
| 707 | Ga0065712_10115058 | |||
| 708 | Ga0065715_10245868 | |||
| 709 | Ga0065715_10419831 | |||
| 710 | Ga0065715_10789993 | |||
| 711 | Ga0065707_10120319 | |||
| 712 | Ga0070676_10010445 | |||
| 713 | Ga0070676_10010989 | |||
| 714 | Ga0070676_10487302 | |||
| 715 | Ga0070676_10517492 | |||
| 716 | Ga0070683_100053435 | |||
| 717 | Ga0070683_100671067 | |||
| 718 | Ga0070683_101548698 | |||
| 719 | Ga0070690_100031451 | |||
| 720 | Ga0070690_100049125 | |||
| 721 | Ga0070690_101298146 | |||
| 722 | Ga0070670_100013016 | |||
| 723 | Ga0070670_100026040 | |||
| 724 | Ga0070670_100251364 | |||
| 725 | Ga0070670_100267631 | |||
| 726 | Ga0070670_100714652 | |||
| 727 | Ga0070670_101184882 | |||
| 728 | Ga0070677_10024521 | |||
| 729 | Ga0070677_10050178 | |||
| 730 | Ga0070677_10084641 | |||
| 731 | Ga0070677_10153518 | |||
| 732 | Ga0070677_10693319 | |||
| 733 | Ga0068869_100048051 | |||
| 734 | Ga0068869_100112521 | |||
| 735 | Ga0068869_100134919 | |||
| 736 | Ga0068869_100337489 | |||
| 737 | Ga0070666_10164670 | |||
| 738 | Ga0070666_10286284 | |||
| 739 | Ga0070666_11047398 | |||
| 740 | Ga0070680_100213283 | |||
| 741 | Ga0070682_100734888 | |||
| 742 | Ga0070682_101376558 | |||
| 743 | Ga0068868_100167407 | |||
| 744 | Ga0068868_100274658 | |||
| 745 | Ga0070689_100014345 | |||
| 746 | Ga0070689_100065945 | |||
| 747 | Ga0070689_100171189 | |||
| 748 | Ga0070687_100011589 | |||
| 749 | Ga0070687_100116766 | |||
| 750 | Ga0070687_101327118 | |||
| 751 | Ga0070661_100019734 | |||
| 752 | Ga0070661_100405958 | |||
| 753 | Ga0070661_100969664 | |||
| 754 | Ga0070661_101528508 | |||
| 755 | Ga0070692_10708612 | |||
| 756 | Ga0070668_100466880 | |||
| 757 | Ga0070668_100682484 | |||
| 758 | Ga0070668_100905496 | |||
| 759 | Ga0070669_100003613 | |||
| 760 | Ga0070669_100026466 | |||
| 761 | Ga0070669_100104399 | |||
| 762 | Ga0070669_100115965 | |||
| 763 | Ga0070669_100179350 | |||
| 764 | Ga0070669_100181715 | |||
| 765 | Ga0070669_100355920 | |||
| 766 | Ga0070669_101064378 | |||
| 767 | Ga0070669_101215113 | |||
| 768 | Ga0070675_100000183 | |||
| 769 | Ga0070675_100000391 | |||
| 770 | Ga0070675_100000483 | |||
| 771 | Ga0070675_100005480 | |||
| 772 | Ga0070675_100017161 | |||
| 773 | Ga0070675_100078237 | |||
| 774 | Ga0070675_100091436 | |||
| 775 | Ga0070675_100118517 | |||
| 776 | Ga0070675_100276989 | |||
| 777 | Ga0070675_100770212 | |||
| 778 | Ga0070675_101033805 | |||
| 779 | Ga0070671_100014454 | |||
| 780 | Ga0070671_100141779 | |||
| 781 | Ga0070671_101575606 | |||
| 782 | Ga0070674_100000133 | |||
| 783 | Ga0070674_100009342 | |||
| 784 | Ga0070674_100283576 | |||
| 785 | Ga0070674_100321890 | |||
| 786 | Ga0070674_101026197 | |||
| 787 | Ga0070673_100044780 | |||
| 788 | Ga0070673_100104240 | |||
| 789 | Ga0070688_100057751 | |||
| 790 | Ga0070688_100069225 | |||
| 791 | Ga0070688_100084567 | |||
| 792 | Ga0070688_100102144 | |||
| 793 | Ga0070688_100605464 | |||
| 794 | Ga0070688_100761604 | |||
| 795 | Ga0070688_100956264 | |||
| 796 | Ga0070659_100356441 | |||
| 797 | Ga0070659_100562481 | |||
| 798 | Ga0070667_100013148 | |||
| 799 | Ga0070667_100220895 | |||
| 800 | Ga0070667_100336631 | |||
| 801 | Ga0070667_102202375 | |||
| 802 | Ga0070701_10445774 | |||
| 803 | Ga0070700_100023336 | |||
| 804 | Ga0070700_100028632 | |||
| 805 | Ga0070663_100026742 | |||
| 806 | Ga0070663_100065402 | |||
| 807 | Ga0070678_100048747 | |||
| 808 | Ga0070678_100076268 | |||
| 809 | Ga0070678_100161818 | |||
| 810 | Ga0070678_100179934 | |||
| 811 | Ga0070678_100344413 | |||
| 812 | Ga0070678_100660378 | |||
| 813 | Ga0070678_100751603 | |||
| 814 | Ga0070678_100759956 | |||
| 815 | Ga0070678_101717211 | |||
| 816 | Ga0070662_100191441 | |||
| 817 | Ga0070662_100256878 | |||
| 818 | Ga0070662_100628472 | |||
| 819 | Ga0068867_100071660 | |||
| 820 | Ga0068867_100269122 | |||
| 821 | Ga0068867_100526898 | |||
| 822 | Ga0068867_100962819 | |||
| 823 | Ga0068867_101106098 | |||
| 824 | Ga0068867_101298289 | |||
| 825 | Ga0070685_10005976 | |||
| 826 | Ga0070685_10087935 | |||
| 827 | Ga0070685_10324844 | |||
| 828 | Ga0070685_10514527 | |||
| 829 | Ga0070707_101752735 | |||
| 830 | Ga0070698_100234116 | |||
| 831 | Ga0070698_100302060 | |||
| 832 | Ga0070698_100634948 | |||
| 833 | Ga0070698_100901092 | |||
| 834 | Ga0070699_100574254 | |||
| 835 | Ga0070679_100689561 | |||
| 836 | Ga0070684_100128269 | |||
| 837 | Ga0070684_100463418 | |||
| 838 | Ga0070684_100538418 | |||
| 839 | Ga0070684_100561806 | |||
| 840 | Ga0068853_100102969 | |||
| 841 | Ga0068853_100110745 | |||
| 842 | Ga0068853_101327612 | |||
| 843 | Ga0070672_100035479 | |||
| 844 | Ga0070672_100055818 | |||
| 845 | Ga0070672_100112544 | |||
| 846 | Ga0070672_100175534 | |||
| 847 | Ga0070672_100185677 | |||
| 848 | Ga0070672_100193891 | |||
| 849 | Ga0070672_100419319 | |||
| 850 | Ga0070686_100010015 | |||
| 851 | Ga0070686_100025080 | |||
| 852 | Ga0070686_100135426 | |||
| 853 | Ga0070686_100257013 | |||
| 854 | Ga0070686_100284994 | |||
| 855 | Ga0070686_100379546 | |||
| 856 | Ga0070696_100234663 | |||
| 857 | Ga0070696_100748966 | |||
| 858 | Ga0070696_101002033 | |||
| 859 | Ga0070696_101580981 | |||
| 860 | Ga0070693_100718577 | |||
| 861 | Ga0070665_100093255 | |||
| 862 | Ga0070665_100732332 | |||
| 863 | Ga0070704_100251060 | |||
| 864 | Ga0068855_100913464 | |||
| 865 | Ga0070664_100000702 | |||
| 866 | Ga0070664_100040486 | |||
| 867 | Ga0070664_100129376 | |||
| 868 | Ga0070664_100193102 | |||
| 869 | Ga0070664_100794170 | |||
| 870 | Ga0070664_101722164 | |||
| 871 | Ga0068857_100006332 | |||
| 872 | Ga0068857_100238007 | |||
| 873 | Ga0068857_100961288 | |||
| 874 | Ga0068854_100836512 | |||
| 875 | Ga0068854_101115693 | |||
| 876 | Ga0068856_100112717 | |||
| 877 | Ga0068856_101298430 | |||
| 878 | Ga0070702_100035530 | |||
| 879 | Ga0070702_100438939 | |||
| 880 | Ga0070702_100601163 | |||
| 881 | Ga0070702_100868558 | |||
| 882 | Ga0068852_101291374 | |||
| 883 | Ga0068859_100005893 | |||
| 884 | Ga0068859_100009922 | |||
| 885 | Ga0068859_100017822 | |||
| 886 | Ga0068859_100038178 | |||
| 887 | Ga0068859_100216938 | |||
| 888 | Ga0068859_100240316 | |||
| 889 | Ga0068859_100590584 | |||
| 890 | Ga0068859_101019682 | |||
| 891 | Ga0068859_101091260 | |||
| 892 | Ga0068859_101421811 | |||
| 893 | Ga0068864_100028526 | |||
| 894 | Ga0068864_100036064 | |||
| 895 | Ga0068864_100067180 | |||
| 896 | Ga0068864_100202197 | |||
| 897 | Ga0068864_100653877 | |||
| 898 | Ga0068864_101000268 | |||
| 899 | Ga0068864_101505649 | |||
| 900 | Ga0068864_102254678 | |||
| 901 | Ga0068866_10048346 | |||
| 902 | Ga0068866_10249770 | |||
| 903 | Ga0068866_10425074 | |||
| 904 | Ga0068866_10725001 | |||
| 905 | Ga0068861_100014097 | |||
| 906 | Ga0068861_100017564 | |||
| 907 | Ga0068861_100099368 | |||
| 908 | Ga0068861_100426872 | |||
| 909 | Ga0068861_100808796 | |||
| 910 | Ga0068861_100847329 | |||
| 911 | Ga0068861_101094544 | |||
| 912 | Ga0068851_10237880 | |||
| 913 | Ga0068870_10000968 | |||
| 914 | Ga0068870_10005293 | |||
| 915 | Ga0068870_10028367 | |||
| 916 | Ga0068870_10257547 | |||
| 917 | Ga0068870_10554896 | |||
| 918 | Ga0068870_10640479 | |||
| 919 | Ga0068863_100000251 | |||
| 920 | Ga0068863_100006154 | |||
| 921 | Ga0068863_100494780 | |||
| 922 | Ga0068863_100659922 | |||
| 923 | Ga0068863_100672033 | |||
| 924 | Ga0068863_101679146 | |||
| 925 | Ga0068858_100005357 | |||
| 926 | Ga0068858_100023733 | |||
| 927 | Ga0068858_100049284 | |||
| 928 | Ga0068858_100057099 | |||
| 929 | Ga0068858_101373802 | |||
| 930 | Ga0068860_100001061 | |||
| 931 | Ga0068860_100039472 | |||
| 932 | Ga0068860_100122071 | |||
| 933 | Ga0068860_100164079 | |||
| 934 | Ga0068860_100939703 | |||
| 935 | Ga0068862_100001221 | |||
| 936 | Ga0068862_100267347 | |||
| 937 | Ga0068862_100291006 | |||
| 938 | Ga0068862_101048122 | |||
| 939 | Ga0068862_101131199 | |||
| 940 | Ga0068862_101786600 | |||
| 941 | Ga0097621_100109423 | |||
| 942 | Ga0097621_100430544 | |||
| 943 | Ga0097621_100574712 | |||
| 944 | Ga0097621_101094489 | |||
| 945 | Ga0068871_100054871 | |||
| 946 | Ga0068871_100120263 | |||
| 947 | Ga0068871_100168466 | |||
| 948 | Ga0068871_100185286 | |||
| 949 | Ga0068871_100204987 | |||
| 950 | Ga0068871_100284931 | |||
| 951 | Ga0068871_100981770 | |||
| 952 | Ga0068871_101949208 | |||
| 953 | Ga0075428_100113776 | |||
| 954 | Ga0075428_100279217 | |||
| 955 | Ga0075430_100020638 | |||
| 956 | Ga0075430_100260244 | |||
| 957 | Ga0075430_100342893 | |||
| 958 | Ga0075431_100008828 | |||
| 959 | Ga0075431_100097917 | |||
| 960 | Ga0075433_10003482 | |||
| 961 | Ga0075434_100077203 | |||
| 962 | Ga0075434_100724106 | |||
| 963 | Ga0075429_100058106 | |||
| 964 | Ga0075429_100258259 | |||
| 965 | Ga0068865_100004621 | |||
| 966 | Ga0068865_100020817 | |||
| 967 | Ga0068865_100239644 | |||
| 968 | Ga0068865_100313671 | |||
| 969 | Ga0068865_100335198 | |||
| 970 | Ga0068865_100339461 | |||
| 971 | Ga0068865_100761029 | |||
| 972 | Ga0068865_101228185 | |||
| 973 | Ga0097620_100005893 | |||
| 974 | Ga0097620_100009922 | |||
| 975 | Ga0097620_100017820 | |||
| 976 | Ga0097620_100038178 | |||
| 977 | Ga0097620_100216920 | |||
| 978 | Ga0097620_100240327 | |||
| 979 | Ga0097620_100590637 | |||
| 980 | Ga0097620_101019517 | |||
| 981 | Ga0097620_101091162 | |||
| 982 | Ga0097620_101421770 | |||
| 983 | Ga0075435_100200901 | |||
| 984 | Ga0075435_100322605 | |||
| 985 | Ga0105240_10117746 | |||
| 986 | Ga0105240_10457091 | |||
| 987 | Ga0111539_10003340 | |||
| 988 | Ga0111539_10037556 | |||
| 989 | Ga0111539_10108094 | |||
| 990 | Ga0111539_10148075 | |||
| 991 | Ga0111539_10250697 | |||
| 992 | Ga0111539_10294713 | |||
| 993 | Ga0111539_10304037 | |||
| 994 | Ga0111539_10481343 | |||
| 995 | Ga0111539_11445067 | |||
| 996 | Ga0105245_10073665 | |||
| 997 | Ga0105245_10177255 | |||
| 998 | Ga0105245_10621248 | |||
| 999 | Ga0105245_10869985 | |||
| 1000 | Ga0105245_11269527 | |||
| 1001 | Ga0105245_11467726 | |||
| 1002 | Ga0105247_10097635 | |||
| 1003 | Ga0105247_10198788 | |||
| 1004 | Ga0105247_10251434 | |||
| 1005 | Ga0114129_10205770 | |||
| 1006 | Ga0114129_10363197 | |||
| 1007 | Ga0114129_10451259 | |||
| 1008 | Ga0114129_12317314 | |||
| 1009 | Ga0105243_10008460 | |||
| 1010 | Ga0105243_10043442 | |||
| 1011 | Ga0105243_11127456 | |||
| 1012 | Ga0105241_10033656 | |||
| 1013 | Ga0105241_10253033 | |||
| 1014 | Ga0105242_10012768 | |||
| 1015 | Ga0105242_10050415 | |||
| 1016 | Ga0105242_10129769 | |||
| 1017 | Ga0105242_10265589 | |||
| 1018 | Ga0105242_10595903 | |||
| 1019 | Ga0105242_10943084 | |||
| 1020 | Ga0105242_11230845 | |||
| 1021 | Ga0105242_11561275 | |||
| 1022 | Ga0105242_11752470 | |||
| 1023 | Ga0105242_11777528 | |||
| 1024 | Ga0105248_10000729 | |||
| 1025 | Ga0105248_10011617 | |||
| 1026 | Ga0105248_10041500 | |||
| 1027 | Ga0105248_10059342 | |||
| 1028 | Ga0105248_10504098 | |||
| 1029 | Ga0105248_10582510 | |||
| 1030 | Ga0105248_10644080 | |||
| 1031 | Ga0105248_10935412 | |||
| 1032 | Ga0105248_11588902 | |||
| 1033 | Ga0105237_11295002 | |||
| 1034 | Ga0105238_10025760 | |||
| 1035 | Ga0105238_10026823 | |||
| 1036 | Ga0105249_10011034 | |||
| 1037 | Ga0105249_10157680 | |||
| 1038 | Ga0105249_10740282 | |||
| 1039 | Ga0105249_10834691 | |||
| 1040 | Ga0105239_10084043 | |||
| 1041 | Ga0105246_10045009 | |||
| 1042 | Ga0105246_10405902 | |||
| 1043 | Ga0105246_10485088 | |||
| 1044 | Ga0105246_10901113 | |||
| 1045 | Ga0105246_11531383 | |||
| 1046 | Ga0105246_11605145 | |||
| 1047 | Ga0105246_11967806 | |||
| 1048 | Ga0157373_10280109 | |||
| 1049 | Ga0157371_10183622 | |||
| 1050 | Ga0157374_10044024 | |||
| 1051 | Ga0157374_10169695 | |||
| 1052 | Ga0157374_11362449 | |||
| 1053 | Ga0157378_10522188 | |||
| 1054 | Ga0157378_10528239 | |||
| 1055 | Ga0157378_10580924 | |||
| 1056 | Ga0157378_10634673 | |||
| 1057 | Ga0157378_10959924 | |||
| 1058 | Ga0157378_11951810 | |||
| 1059 | Ga0163162_10095378 | |||
| 1060 | Ga0163162_10273079 | |||
| 1061 | Ga0163162_10850172 | |||
| 1062 | Ga0163162_12132559 | |||
| 1063 | Ga0163162_12589691 | |||
| 1064 | Ga0157372_10285827 | |||
| 1065 | Ga0157372_10439783 | |||
| 1066 | Ga0157375_10000300 | |||
| 1067 | Ga0157375_10078515 | |||
| 1068 | Ga0157375_10526865 | |||
| 1069 | Ga0157375_10800746 | |||
| 1070 | Ga0157375_11141035 | |||
| 1071 | Ga0157375_11145735 | |||
| 1072 | Ga0163163_10051676 | |||
| 1073 | Ga0163163_10067984 | |||
| 1074 | Ga0163163_10421541 | |||
| 1075 | Ga0163163_10653071 | |||
| 1076 | Ga0163163_10909582 | |||
| 1077 | Ga0163163_11159897 | |||
| 1078 | Ga0163163_11334754 | |||
| 1079 | Ga0157380_10012655 | |||
| 1080 | Ga0157380_10064776 | |||
| 1081 | Ga0157380_10322192 | |||
| 1082 | Ga0157380_10544790 | |||
| 1083 | Ga0157380_12227105 | |||
| 1084 | Ga0157380_12918189 | |||
| 1085 | Ga0157377_10277652 | |||
| 1086 | Ga0157377_10454759 | |||
| 1087 | Ga0157377_10517856 | |||
| 1088 | Ga0157379_10000645 | |||
| 1089 | Ga0157379_10028324 | |||
| 1090 | Ga0157379_10251089 | |||
| 1091 | Ga0157379_10894593 | |||
| 1092 | Ga0157376_10087688 | |||
| 1093 | Ga0157376_10097115 | |||
| 1094 | Ga0157376_10539678 | |||
| 1095 | Ga0157376_10678231 | |||
| 1096 | Ga0157376_10837796 | |||
| 1097 | Ga0157376_10931255 | |||
| 1098 | Ga0163161_10026739 | |||
| 1099 | Ga0163161_10715754 | |||
| 1100 | Ga0207697_10001648 | |||
| 1101 | Ga0207697_10072877 | |||
| 1102 | Ga0207682_10007712 | |||
| 1103 | Ga0207682_10022597 | |||
| 1104 | Ga0207682_10067501 | |||
| 1105 | Ga0207682_10451385 | |||
| 1106 | Ga0207642_10055949 | |||
| 1107 | Ga0207642_10294259 | |||
| 1108 | Ga0207642_10639676 | |||
| 1109 | Ga0207710_10097752 | |||
| 1110 | Ga0207710_10356397 | |||
| 1111 | Ga0207710_10513218 | |||
| 1112 | Ga0207688_10005062 | |||
| 1113 | Ga0207688_10013358 | |||
| 1114 | Ga0207688_10309719 | |||
| 1115 | Ga0207680_10006790 | |||
| 1116 | Ga0207680_10188690 | |||
| 1117 | Ga0207680_10252911 | |||
| 1118 | Ga0207680_10779242 | |||
| 1119 | Ga0207645_10003388 | |||
| 1120 | Ga0207645_10006606 | |||
| 1121 | Ga0207645_10191778 | |||
| 1122 | Ga0207645_10383545 | |||
| 1123 | Ga0207645_10451348 | |||
| 1124 | Ga0207643_10002413 | |||
| 1125 | Ga0207643_10033063 | |||
| 1126 | Ga0207643_10072958 | |||
| 1127 | Ga0207643_10104411 | |||
| 1128 | Ga0207643_10568919 | |||
| 1129 | Ga0207654_10443845 | |||
| 1130 | Ga0207695_10334715 | |||
| 1131 | Ga0207660_10729454 | |||
| 1132 | Ga0207662_10005021 | |||
| 1133 | Ga0207662_10071033 | |||
| 1134 | Ga0207662_11136397 | |||
| 1135 | Ga0207657_10316943 | |||
| 1136 | Ga0207657_11382995 | |||
| 1137 | Ga0207649_10042309 | |||
| 1138 | Ga0207649_10215481 | |||
| 1139 | Ga0207649_10370641 | |||
| 1140 | Ga0207681_10049948 | |||
| 1141 | Ga0207681_10084897 | |||
| 1142 | Ga0207681_10105635 | |||
| 1143 | Ga0207681_10163765 | |||
| 1144 | Ga0207681_10168913 | |||
| 1145 | Ga0207681_10260069 | |||
| 1146 | Ga0207681_10355355 | |||
| 1147 | Ga0207694_10189954 | |||
| 1148 | Ga0207694_10225540 | |||
| 1149 | Ga0207694_10552952 | |||
| 1150 | Ga0207650_10088151 | |||
| 1151 | Ga0207650_10154725 | |||
| 1152 | Ga0207650_10223330 | |||
| 1153 | Ga0207650_10236937 | |||
| 1154 | Ga0207650_10267583 | |||
| 1155 | Ga0207650_10428600 | |||
| 1156 | Ga0207659_10000383 | |||
| 1157 | Ga0207659_10005332 | |||
| 1158 | Ga0207659_10010576 | |||
| 1159 | Ga0207659_10019767 | |||
| 1160 | Ga0207659_10040671 | |||
| 1161 | Ga0207659_10057148 | |||
| 1162 | Ga0207659_10079829 | |||
| 1163 | Ga0207659_10241548 | |||
| 1164 | Ga0207659_10263831 | |||
| 1165 | Ga0207659_10704436 | |||
| 1166 | Ga0207659_10780341 | |||
| 1167 | Ga0207659_10982565 | |||
| 1168 | Ga0207659_11573780 | |||
| 1169 | Ga0207687_10550157 | |||
| 1170 | Ga0207644_10037390 | |||
| 1171 | Ga0207644_10052317 | |||
| 1172 | Ga0207644_10077928 | |||
| 1173 | Ga0207644_10087366 | |||
| 1174 | Ga0207644_10835181 | |||
| 1175 | Ga0207644_11118107 | |||
| 1176 | Ga0207644_11501874 | |||
| 1177 | Ga0207690_10164439 | |||
| 1178 | Ga0207690_10469723 | |||
| 1179 | Ga0207706_10014665 | |||
| 1180 | Ga0207706_10138670 | |||
| 1181 | Ga0207706_10217973 | |||
| 1182 | Ga0207686_10052488 | |||
| 1183 | Ga0207686_10068579 | |||
| 1184 | Ga0207686_10166173 | |||
| 1185 | Ga0207686_10168480 | |||
| 1186 | Ga0207686_10195567 | |||
| 1187 | Ga0207709_10047973 | |||
| 1188 | Ga0207709_10100785 | |||
| 1189 | Ga0207709_11180146 | |||
| 1190 | Ga0207670_10049132 | |||
| 1191 | Ga0207670_10053249 | |||
| 1192 | Ga0207670_10145061 | |||
| 1193 | Ga0207670_10259788 | |||
| 1194 | Ga0207670_10283376 | |||
| 1195 | Ga0207669_10027118 | |||
| 1196 | Ga0207669_10203749 | |||
| 1197 | Ga0207669_10248819 | |||
| 1198 | Ga0207669_10552603 | |||
| 1199 | Ga0207704_10004007 | |||
| 1200 | Ga0207704_10006688 | |||
| 1201 | Ga0207704_10342980 | |||
| 1202 | Ga0207704_10590120 | |||
| 1203 | Ga0207691_10005619 | |||
| 1204 | Ga0207691_10025920 | |||
| 1205 | Ga0207691_10096230 | |||
| 1206 | Ga0207691_10139230 | |||
| 1207 | Ga0207691_10442991 | |||
| 1208 | Ga0207691_10446558 | |||
| 1209 | Ga0207691_10798475 | |||
| 1210 | Ga0207711_10025690 | |||
| 1211 | Ga0207711_10083937 | |||
| 1212 | Ga0207711_10085761 | |||
| 1213 | Ga0207711_10103758 | |||
| 1214 | Ga0207711_10111601 | |||
| 1215 | Ga0207711_11062307 | |||
| 1216 | Ga0207711_11206690 | |||
| 1217 | Ga0207689_10003959 | |||
| 1218 | Ga0207689_10009438 | |||
| 1219 | Ga0207689_10012760 | |||
| 1220 | Ga0207689_10210059 | |||
| 1221 | Ga0207689_10366487 | |||
| 1222 | Ga0207689_11446777 | |||
| 1223 | Ga0207661_10190021 | |||
| 1224 | Ga0207661_10287203 | |||
| 1225 | Ga0207679_10011736 | |||
| 1226 | Ga0207679_10033244 | |||
| 1227 | Ga0207679_10115007 | |||
| 1228 | Ga0207679_10212373 | |||
| 1229 | Ga0207679_10388847 | |||
| 1230 | Ga0207667_10262696 | |||
| 1231 | Ga0207651_10193189 | |||
| 1232 | Ga0207651_10212600 | |||
| 1233 | Ga0207651_10256043 | |||
| 1234 | Ga0207651_10318538 | |||
| 1235 | Ga0207651_10392811 | |||
| 1236 | Ga0207712_10096663 | |||
| 1237 | Ga0207712_10167876 | |||
| 1238 | Ga0207712_10356990 | |||
| 1239 | Ga0207668_10050498 | |||
| 1240 | Ga0207668_10146089 | |||
| 1241 | Ga0207668_10153704 | |||
| 1242 | Ga0207668_10237540 | |||
| 1243 | Ga0207640_10287698 | |||
| 1244 | Ga0207640_10359450 | |||
| 1245 | Ga0207640_10624567 | |||
| 1246 | Ga0207658_10026093 | |||
| 1247 | Ga0207658_10108142 | |||
| 1248 | Ga0207658_10245863 | |||
| 1249 | Ga0207658_10364690 | |||
| 1250 | Ga0207658_10540482 | |||
| 1251 | Ga0207677_10026579 | |||
| 1252 | Ga0207677_10356690 | |||
| 1253 | Ga0207703_10018629 | |||
| 1254 | Ga0207703_10041326 | |||
| 1255 | Ga0207703_10050178 | |||
| 1256 | Ga0207703_10466734 | |||
| 1257 | Ga0207703_10774804 | |||
| 1258 | Ga0207703_10912878 | |||
| 1259 | Ga0207703_11184165 | |||
| 1260 | Ga0207639_10075833 | |||
| 1261 | Ga0207639_10792040 | |||
| 1262 | Ga0207678_10016394 | |||
| 1263 | Ga0207708_10006488 | |||
| 1264 | Ga0207708_10026968 | |||
| 1265 | Ga0207708_10406986 | |||
| 1266 | Ga0207702_10077992 | |||
| 1267 | Ga0207702_11050523 | |||
| 1268 | Ga0207641_10000486 | |||
| 1269 | Ga0207641_10017431 | |||
| 1270 | Ga0207641_10205915 | |||
| 1271 | Ga0207641_10271526 | |||
| 1272 | Ga0207641_10630006 | |||
| 1273 | Ga0207641_10727942 | |||
| 1274 | Ga0207648_10005401 | |||
| 1275 | Ga0207648_10025569 | |||
| 1276 | Ga0207648_10102275 | |||
| 1277 | Ga0207648_10163480 | |||
| 1278 | Ga0207648_10317261 | |||
| 1279 | Ga0207648_10327055 | |||
| 1280 | Ga0207648_10382401 | |||
| 1281 | Ga0207648_10591234 | |||
| 1282 | Ga0207676_10015022 | |||
| 1283 | Ga0207676_10055770 | |||
| 1284 | Ga0207676_10082003 | |||
| 1285 | Ga0207676_10111225 | |||
| 1286 | Ga0207676_10236186 | |||
| 1287 | Ga0207676_11171657 | |||
| 1288 | Ga0207674_10013186 | |||
| 1289 | Ga0207674_10459776 | |||
| 1290 | Ga0207674_10708901 | |||
| 1291 | Ga0207675_100029618 | |||
| 1292 | Ga0207675_100043959 | |||
| 1293 | Ga0207675_100086437 | |||
| 1294 | Ga0207675_100186474 | |||
| 1295 | Ga0207675_100352179 | |||
| 1296 | Ga0207675_100511052 | |||
| 1297 | Ga0207683_10006075 | |||
| 1298 | Ga0207683_10025317 | |||
| 1299 | Ga0207683_10090957 | |||
| 1300 | Ga0207683_10100814 | |||
| 1301 | Ga0207683_10143374 | |||
| 1302 | Ga0207683_10195757 | |||
| 1303 | Ga0207683_10582820 | |||
| 1304 | Ga0207683_10717085 | |||
| 1305 | Ga0207698_11065936 | |||
| 1306 | Ga0209973_1008751 | |||
| 1307 | Ga0209970_1034667 | |||
| 1308 | Ga0207428_10017850 | |||
| 1309 | Ga0207428_10023972 | |||
| 1310 | Ga0207428_10035418 | |||
| 1311 | Ga0207428_10517582 | |||
| 1312 | Ga0268266_10101997 | |||
| 1313 | Ga0268266_10630244 | |||
| 1314 | Ga0268266_10830570 | |||
| 1315 | Ga0268265_10012300 | |||
| 1316 | Ga0268265_10169774 | |||
| 1317 | Ga0268265_10170763 | |||
| 1318 | Ga0268265_10919832 | |||
| 1319 | Ga0268264_10015149 | |||
| 1320 | Ga0268264_10042468 | |||
| 1321 | Ga0268264_10149126 | |||
| 1322 | Ga0268264_12083841 | |||
| 1323 | Ga0268264_12248945 | |||
| 1324 | Ga0265332_10157016 | |||
| 1325 | Ga0307408_100249607 | |||
| 1326 | Ga0307405_11096374 | |||
| 1327 | Ga0307410_10261541 | |||
| 1328 | Ga0307412_10477647 | |||
| 1329 | Ga0307416_100924240 | |||
| 1330 | Ga0307414_10483865 | |||
| 1331 | Ga0307415_100289830 | |||
| 1332 | Ga0373932_0055698 | |||
| 1333 | Ga0373942_0341022 | |||
| 1334 | Ga0373961_0186806 | |||
| 1335 | Ga0373937_0834228 | |||
| 1336 | Ga0436362_0945229 | |||
| 1337 | Ga0439453_0010314 | |||
| 1338 | Ga0439451_057116 | |||
| 1339 | Ga0450919_026494 | |||
| 1340 | Ga0439435_0003672 | |||
| 1341 | Ga0439459_0136976 | |||
| 1342 | Ga0439460_0114152 | |||
| 1343 | Ga0453683_0476702 | |||
| 1344 | Ga0451576_0245048 | |||
| 1345 | Ga0495582_0001891 | |||
| 1346 | Ga0495639_0044567 | |||
| 1347 | Ga0495639_0237885 | |||
| 1348 | Ga0495664_0046799 | |||
| 1349 | Ga0495594_0189325 | |||
| 1350 | Ga0495594_0355410 | |||
| 1351 | Ga0495607_0277421 | |||
| 1352 | Ga0495628_0186366 | |||
| 1353 | Ga0495630_0082495 | |||
| 1354 | Ga0495666_0197775 | |||
| 1355 | Ga0495642_0272998 | |||
| 1356 | Ga0495652_0840522 | |||
| 1357 | Ga0495586_0009620 | |||
| 1358 | Ga0495586_0238497 | |||
| 1359 | Ga0495598_0026363 | |||
| 1360 | Ga0495598_0336025 | |||
| 1361 | Ga0495645_0121696 | |||
| 1362 | Ga0495656_0368533 | |||
| 1363 | Ga0495634_0049605 | |||
| 1364 | Ga0495634_0277705 | |||
| 1365 | Ga0495658_0010972 | |||
| 1366 | Ga0495658_0079337 | |||
| 1367 | Ga0495581_0063198 | |||
| 1368 | Ga0495674_0286555 | |||
| 1369 | Ga0495675_0377791 | |||
| 1370 | Ga0495684_0636176 | |||
| 1371 | Ga0495614_0302229 | |||
| 1372 | Ga0496114_0147379 | |||
| 1373 | Ga0496114_0386095 | |||
| 1374 | Ga0501225_0195657 | |||
| 1375 | nmdc:mga05p37_188855_c1 | |||
| 1376 | nmdc:mga09592_13731_c1 | |||
| 1377 | nmdc:mga09592_59036_c1 | |||
| 1378 | nmdc:mga0qj67_11252_c1 | |||
| 1379 | nmdc:mga0qj67_375999_c1 | |||
| 1380 | nmdc:mga06r32_114082_c1 | |||
| 1381 | nmdc:mga06r32_3004_c1 | |||
| 1382 | nmdc:mga08y16_1019080_c1 | |||
| 1383 | nmdc:mga08y16_1755_c1 | |||
| 1384 | nmdc:mga08y16_200614_c1 | |||
| 1385 | nmdc:mga08y16_306168_c1 | |||
| 1386 | nmdc:mga08y16_593339_c1 | |||
| 1387 | nmdc:mga08y16_72657_c1 | |||
| 1388 | nmdc:mga08y16_7619_c1 | |||
| 1389 | nmdc:mga0n895_447616_c1 | |||
| 1390 | nmdc:mga0n895_79582_c1 | |||
| 1391 | nmdc:mga0n895_855833_c1 | |||
| 1392 | nmdc:mga0rr50_345661_c1 | |||
| 1393 | nmdc:mga08x19_986476_c1 | |||
| 1394 | nmdc:mga0a205_4439_c1 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4ywk-assembly3.cif.gz_A | pyrococcus furiosus mcm n-terminal domain with zinc-binding subdomain b deleted | 0.7768 | 39 | 113 |
| 6cqm-assembly2.cif.gz_H-3 | crystal structure of mitochondrial single-stranded dna binding proteins from s. cerevisiae, rim1 (form2) | 0.7391 | 39 | 130 |
| 4ywk-assembly3.cif.gz_B | pyrococcus furiosus mcm n-terminal domain with zinc-binding subdomain b deleted | 0.7341 | 39 | 113 |
| 1h9r-assembly1.cif.gz_A | tungstate bound complex dimop domain of mode from e.coli | 0.7126 | 42 | 113 |
| 1o7l-assembly1.cif.gz_B | molybdate-activated form of mode from escherichia coli | 0.7088 | 41 | 113 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9TXQ8_9_134_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.7339 | 40 | 132 | 2.40.50.140 |
| af_Q95Y97_40_169_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.7219 | 40 | 137 | 2.40.50.140 |
| 1h9rA01 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.7182 | 42 | 110 | 2.40.50.100 |
| 4gopY00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.7148 | 40 | 143 | 2.40.50.140 |
| af_Q8II42_53_185_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.7033 | 40 | 130 | 2.40.50.140 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1G0K6T8-F1-model_v4 | Uncharacterized protein | 0.9672 | 34 | 163 |
|
| AF-A0A3N5WP07-F1-model_v4 | Uncharacterized protein | 0.949 | 34 | 159 |
|
| AF-A0A4Q6BWS8-F1-model_v4 | DUF5666 domain-containing protein | 0.9293 | 25 | 162 |
|
| AF-A0A1G0K6T8-F1-model_v4 | Uncharacterized protein | 0.9163 | 34 | 163 |
|
| AF-G4RGG4-F1-model_v4 | DUF5666 domain-containing protein | 0.9092 | 24 | 159 |
|