F475885

General Info

Members Datasets Scaffolds Average Seq Length
697 216 1394 161

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100037932|Ga0075428_1000379324
Length 164
Sequence MKTHTIRGLMVAAPLALLAVLFETPVSTHHSFAMYDQTKTVVLTGIVKQFVAQANHAELHFYLIAPDRKGLAKAADGKTNVEWGVEMAGAAAVAQQGITASSFGAGTVFSVKLNPLRDGSNFGSRTGAIAKCPVDPATNKQKLPAADKHCDSVEGSTLIGGSAF

Samples

Sample ID Description Type Environment
1 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
4 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
7 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
95 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
161 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
165 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
166 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
167 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
168 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
169 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
170 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
171 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
172 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
173 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
174 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
175 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
176 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
177 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
178 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
179 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
180 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
181 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
182 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
183 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
184 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
185 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
186 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
187 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
188 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
189 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
190 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
191 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
192 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
193 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
194 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
195 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
196 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
197 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
198 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
199 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
200 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
201 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
202 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
203 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
204 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
205 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
206 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
207 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
208 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
209 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
210 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
211 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
212 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
213 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
214 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
215 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
216 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.86
Metatranscriptomes 0.14
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.29
Rhizosphere 99.57
Stem 0
Stem Tuber 0
Unclassified 42.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075428_100037932 3300006844 Bacteria 5302
2 JGI24746J21847_1001635 3300001977 Unclassified 3586
3 JGI24745J21846_1005124 3300002073 Bacteria 1423
4 JGI24033J26618_1024699 3300002155 Unclassified 786
5 JGI24751J29686_10016979 3300002459 Unclassified 1502
6 Ga0058859_10754822 3300004798 Unclassified 527
7 Ga0065714_10171933 3300005288 Unclassified 1000
8 Ga0065714_10186213 3300005288 Unclassified 944
9 Ga0065712_10011962 3300005290 Unclassified 3863
10 Ga0065712_10115058 3300005290 Unclassified 1757
11 Ga0065715_10245868 3300005293 Bacteria 1183
12 Ga0065715_10419831 3300005293 Unclassified 859
13 Ga0065715_10789993 3300005293 Unclassified 614
14 Ga0065707_10120319 3300005295 Unclassified 2137
15 Ga0070676_10010445 3300005328 Bacteria 5038
16 Ga0070676_10010989 3300005328 Unclassified 4917
17 Ga0070676_10487302 3300005328 Unclassified 873
18 Ga0070676_10517492 3300005328 Unclassified 849
19 Ga0070683_100053435 3300005329 Bacteria 3743
20 Ga0070683_100671067 3300005329 Unclassified 992
21 Ga0070683_101548698 3300005329 Bacteria 637
22 Ga0070690_100031451 3300005330 Unclassified 3306
23 Ga0070690_100049125 3300005330 Unclassified 2688
24 Ga0070690_101298146 3300005330 Unclassified 583
25 Ga0070670_100013016 3300005331 Bacteria 7126
26 Ga0070670_100026040 3300005331 Bacteria 5034
27 Ga0070670_100251364 3300005331 Bacteria 1540
28 Ga0070670_100267631 3300005331 Bacteria 1491
29 Ga0070670_100714652 3300005331 Unclassified 901
30 Ga0070670_101184882 3300005331 Unclassified 698
31 Ga0070677_10024521 3300005333 Unclassified 2244
32 Ga0070677_10050178 3300005333 Unclassified 1684
33 Ga0070677_10084641 3300005333 Unclassified 1365
34 Ga0070677_10153518 3300005333 Unclassified 1074
35 Ga0070677_10693319 3300005333 Bacteria 573
36 Ga0068869_100048051 3300005334 Bacteria 3084
37 Ga0068869_100112521 3300005334 Bacteria 2072
38 Ga0068869_100134919 3300005334 Bacteria 1901
39 Ga0068869_100337489 3300005334 Unclassified 1226
40 Ga0070666_10164670 3300005335 Bacteria 1551
41 Ga0070666_10286284 3300005335 Unclassified 1172
42 Ga0070666_11047398 3300005335 Unclassified 606
43 Ga0070680_100213283 3300005336 Unclassified 1629
44 Ga0070682_100734888 3300005337 Unclassified 795
45 Ga0070682_101376558 3300005337 Unclassified 602
46 Ga0068868_100167407 3300005338 Bacteria 1818
47 Ga0068868_100274658 3300005338 Unclassified 1425
48 Ga0070689_100014345 3300005340 Bacteria 5754
49 Ga0070689_100065945 3300005340 Bacteria 2820
50 Ga0070689_100171189 3300005340 Unclassified 1760
51 Ga0070687_100011589 3300005343 Unclassified 3863
52 Ga0070687_100116766 3300005343 Bacteria 1519
53 Ga0070687_101327118 3300005343 Unclassified 535
54 Ga0070661_100019734 3300005344 Unclassified 4804
55 Ga0070661_100405958 3300005344 Bacteria 1078
56 Ga0070661_100969664 3300005344 Unclassified 704
57 Ga0070661_101528508 3300005344 Unclassified 563
58 Ga0070692_10708612 3300005345 Unclassified 678
59 Ga0070668_100466880 3300005347 Unclassified 1088
60 Ga0070668_100682484 3300005347 Unclassified 905
61 Ga0070668_100905496 3300005347 Unclassified 789
62 Ga0070669_100003613 3300005353 Bacteria 11161
63 Ga0070669_100026466 3300005353 Unclassified 4173
64 Ga0070669_100104399 3300005353 Unclassified 2142
65 Ga0070669_100115965 3300005353 Unclassified 2038
66 Ga0070669_100179350 3300005353 Bacteria 1656
67 Ga0070669_100181715 3300005353 Bacteria 1646
68 Ga0070669_100355920 3300005353 Bacteria 1189
69 Ga0070669_101064378 3300005353 Bacteria 696
70 Ga0070669_101215113 3300005353 Bacteria 651
71 Ga0070675_100000183 3300005354 Bacteria 38880
72 Ga0070675_100000391 3300005354 Bacteria 29687
73 Ga0070675_100000483 3300005354 Bacteria 27199
74 Ga0070675_100005480 3300005354 Bacteria 9714
75 Ga0070675_100017161 3300005354 Bacteria 5753
76 Ga0070675_100078237 3300005354 Bacteria 2753
77 Ga0070675_100091436 3300005354 Unclassified 2550
78 Ga0070675_100118517 3300005354 Bacteria 2247
79 Ga0070675_100276989 3300005354 Bacteria 1473
80 Ga0070675_100770212 3300005354 Bacteria 879
81 Ga0070675_101033805 3300005354 Unclassified 755
82 Ga0070671_100014454 3300005355 Bacteria 6379
83 Ga0070671_100141779 3300005355 Unclassified 2028
84 Ga0070671_101575606 3300005355 Bacteria 582
85 Ga0070674_100000133 3300005356 Bacteria 34091
86 Ga0070674_100009342 3300005356 Bacteria 5870
87 Ga0070674_100283576 3300005356 Bacteria 1314
88 Ga0070674_100321890 3300005356 Unclassified 1240
89 Ga0070674_101026197 3300005356 Unclassified 725
90 Ga0070673_100044780 3300005364 Unclassified 3428
91 Ga0070673_100104240 3300005364 Unclassified 2341
92 Ga0070688_100057751 3300005365 Unclassified 2440
93 Ga0070688_100069225 3300005365 Bacteria 2252
94 Ga0070688_100084567 3300005365 Bacteria 2061
95 Ga0070688_100102144 3300005365 Bacteria 1892
96 Ga0070688_100605464 3300005365 Unclassified 839
97 Ga0070688_100761604 3300005365 Unclassified 754
98 Ga0070688_100956264 3300005365 Unclassified 678
99 Ga0070659_100356441 3300005366 Unclassified 1228
100 Ga0070659_100562481 3300005366 Unclassified 977
101 Ga0070667_100013148 3300005367 Bacteria 6842
102 Ga0070667_100220895 3300005367 Unclassified 1687
103 Ga0070667_100336631 3300005367 Bacteria 1364
104 Ga0070667_102202375 3300005367 Bacteria 519
105 Ga0070701_10445774 3300005438 Bacteria 830
106 Ga0070700_100023336 3300005441 Bacteria 3616
107 Ga0070700_100028632 3300005441 Unclassified 3316
108 Ga0070663_100026742 3300005455 Unclassified 3911
109 Ga0070663_100065402 3300005455 Unclassified 2632
110 Ga0070678_100048747 3300005456 Bacteria 3053
111 Ga0070678_100076268 3300005456 Unclassified 2525
112 Ga0070678_100161818 3300005456 Unclassified 1814
113 Ga0070678_100179934 3300005456 Bacteria 1730
114 Ga0070678_100344413 3300005456 Bacteria 1280
115 Ga0070678_100660378 3300005456 Unclassified 939
116 Ga0070678_100751603 3300005456 Unclassified 882
117 Ga0070678_100759956 3300005456 Bacteria 877
118 Ga0070678_101717211 3300005456 Unclassified 591
119 Ga0070662_100191441 3300005457 Bacteria 1618
120 Ga0070662_100256878 3300005457 Unclassified 1406
121 Ga0070662_100628472 3300005457 Bacteria 905
122 Ga0068867_100071660 3300005459 Bacteria 2593
123 Ga0068867_100269122 3300005459 Bacteria 1392
124 Ga0068867_100526898 3300005459 Bacteria 1020
125 Ga0068867_100962819 3300005459 Bacteria 772
126 Ga0068867_101106098 3300005459 Unclassified 724
127 Ga0068867_101298289 3300005459 Bacteria 672
128 Ga0070685_10005976 3300005466 Bacteria 6198
129 Ga0070685_10087935 3300005466 Unclassified 1875
130 Ga0070685_10324844 3300005466 Bacteria 1044
131 Ga0070685_10514527 3300005466 Unclassified 849
132 Ga0070707_101752735 3300005468 Unclassified 588
133 Ga0070698_100234116 3300005471 Unclassified 1770
134 Ga0070698_100302060 3300005471 Bacteria 1531
135 Ga0070698_100634948 3300005471 Unclassified 1009
136 Ga0070698_100901092 3300005471 Bacteria 830
137 Ga0070699_100574254 3300005518 Unclassified 1027
138 Ga0070679_100689561 3300005530 Unclassified 964
139 Ga0070684_100128269 3300005535 Bacteria 2287
140 Ga0070684_100463418 3300005535 Unclassified 1172
141 Ga0070684_100538418 3300005535 Bacteria 1083
142 Ga0070684_100561806 3300005535 Unclassified 1059
143 Ga0068853_100102969 3300005539 Unclassified 2527
144 Ga0068853_100110745 3300005539 Bacteria 2439
145 Ga0068853_101327612 3300005539 Bacteria 695
146 Ga0070672_100035479 3300005543 Unclassified 3791
147 Ga0070672_100055818 3300005543 Bacteria 3095
148 Ga0070672_100112544 3300005543 Unclassified 2220
149 Ga0070672_100175534 3300005543 Bacteria 1784
150 Ga0070672_100185677 3300005543 Bacteria 1734
151 Ga0070672_100193891 3300005543 Bacteria 1697
152 Ga0070672_100419319 3300005543 Bacteria 1149
153 Ga0070686_100010015 3300005544 Bacteria 5336
154 Ga0070686_100025080 3300005544 Unclassified 3582
155 Ga0070686_100135426 3300005544 Bacteria 1708
156 Ga0070686_100257013 3300005544 Bacteria 1279
157 Ga0070686_100284994 3300005544 Bacteria 1220
158 Ga0070686_100379546 3300005544 Unclassified 1070
159 Ga0070696_100234663 3300005546 Bacteria 1381
160 Ga0070696_100748966 3300005546 Unclassified 800
161 Ga0070696_101002033 3300005546 Unclassified 698
162 Ga0070696_101580981 3300005546 Unclassified 563
163 Ga0070693_100718577 3300005547 Unclassified 733
164 Ga0070665_100093255 3300005548 Unclassified 3016
165 Ga0070665_100732332 3300005548 Bacteria 1002
166 Ga0070704_100251060 3300005549 Unclassified 1453
167 Ga0068855_100913464 3300005563 Unclassified 927
168 Ga0070664_100000702 3300005564 Bacteria 25579
169 Ga0070664_100040486 3300005564 Unclassified 3928
170 Ga0070664_100129376 3300005564 Unclassified 2217
171 Ga0070664_100193102 3300005564 Bacteria 1814
172 Ga0070664_100794170 3300005564 Bacteria 885
173 Ga0070664_101722164 3300005564 Unclassified 594
174 Ga0068857_100006332 3300005577 Bacteria 10137
175 Ga0068857_100238007 3300005577 Bacteria 1666
176 Ga0068857_100961288 3300005577 Unclassified 821
177 Ga0068854_100836512 3300005578 Unclassified 805
178 Ga0068854_101115693 3300005578 Unclassified 703
179 Ga0068856_100112717 3300005614 Bacteria 2718
180 Ga0068856_101298430 3300005614 Unclassified 743
181 Ga0070702_100035530 3300005615 Unclassified 2754
182 Ga0070702_100438939 3300005615 Bacteria 944
183 Ga0070702_100601163 3300005615 Bacteria 824
184 Ga0070702_100868558 3300005615 Unclassified 703
185 Ga0068852_101291374 3300005616 Unclassified 751
186 Ga0068859_100005893 3300005617 Bacteria 12436
187 Ga0068859_100009922 3300005617 Bacteria 9611
188 Ga0068859_100017822 3300005617 Bacteria 7138
189 Ga0068859_100038178 3300005617 Bacteria 4818
190 Ga0068859_100216938 3300005617 Bacteria 2001
191 Ga0068859_100240316 3300005617 Unclassified 1900
192 Ga0068859_100590584 3300005617 Bacteria 1204
193 Ga0068859_101019682 3300005617 Bacteria 909
194 Ga0068859_101091260 3300005617 Unclassified 878
195 Ga0068859_101421811 3300005617 Unclassified 765
196 Ga0068864_100028526 3300005618 Bacteria 4719
197 Ga0068864_100036064 3300005618 Bacteria 4214
198 Ga0068864_100067180 3300005618 Unclassified 3113
199 Ga0068864_100202197 3300005618 Unclassified 1825
200 Ga0068864_100653877 3300005618 Unclassified 1024
201 Ga0068864_101000268 3300005618 Unclassified 829
202 Ga0068864_101505649 3300005618 Unclassified 676
203 Ga0068864_102254678 3300005618 Unclassified 551
204 Ga0068866_10048346 3300005718 Unclassified 2150
205 Ga0068866_10249770 3300005718 Unclassified 1085
206 Ga0068866_10425074 3300005718 Unclassified 863
207 Ga0068866_10725001 3300005718 Unclassified 684
208 Ga0068861_100014097 3300005719 Bacteria 5604
209 Ga0068861_100017564 3300005719 Bacteria 5083
210 Ga0068861_100099368 3300005719 Unclassified 2311
211 Ga0068861_100426872 3300005719 Bacteria 1182
212 Ga0068861_100808796 3300005719 Unclassified 880
213 Ga0068861_100847329 3300005719 Bacteria 861
214 Ga0068861_101094544 3300005719 Bacteria 766
215 Ga0068851_10237880 3300005834 Bacteria 1029
216 Ga0068870_10000968 3300005840 Bacteria 11294
217 Ga0068870_10005293 3300005840 Bacteria 5621
218 Ga0068870_10028367 3300005840 Unclassified 2810
219 Ga0068870_10257547 3300005840 Unclassified 1084
220 Ga0068870_10554896 3300005840 Bacteria 774
221 Ga0068870_10640479 3300005840 Unclassified 727
222 Ga0068863_100000251 3300005841 Bacteria 56835
223 Ga0068863_100006154 3300005841 Bacteria 11769
224 Ga0068863_100494780 3300005841 Bacteria 1204
225 Ga0068863_100659922 3300005841 Bacteria 1038
226 Ga0068863_100672033 3300005841 Bacteria 1028
227 Ga0068863_101679146 3300005841 Unclassified 645
228 Ga0068858_100005357 3300005842 Bacteria 12585
229 Ga0068858_100023733 3300005842 Bacteria 5713
230 Ga0068858_100049284 3300005842 Bacteria 3900
231 Ga0068858_100057099 3300005842 Bacteria 3607
232 Ga0068858_101373802 3300005842 Bacteria 696
233 Ga0068860_100001061 3300005843 Bacteria 30325
234 Ga0068860_100039472 3300005843 Unclassified 4515
235 Ga0068860_100122071 3300005843 Bacteria 2495
236 Ga0068860_100164079 3300005843 Bacteria 2143
237 Ga0068860_100939703 3300005843 Unclassified 882
238 Ga0068862_100001221 3300005844 Bacteria 24241
239 Ga0068862_100267347 3300005844 Bacteria 1563
240 Ga0068862_100291006 3300005844 Bacteria 1500
241 Ga0068862_101048122 3300005844 Bacteria 808
242 Ga0068862_101131199 3300005844 Unclassified 779
243 Ga0068862_101786600 3300005844 Unclassified 624
244 Ga0097621_100109423 3300006237 Unclassified 2334
245 Ga0097621_100430544 3300006237 Unclassified 1186
246 Ga0097621_100574712 3300006237 Bacteria 1028
247 Ga0097621_101094489 3300006237 Unclassified 748
248 Ga0068871_100054871 3300006358 Unclassified 3234
249 Ga0068871_100120263 3300006358 Unclassified 2218
250 Ga0068871_100168466 3300006358 Bacteria 1876
251 Ga0068871_100185286 3300006358 Unclassified 1790
252 Ga0068871_100204987 3300006358 Bacteria 1704
253 Ga0068871_100284931 3300006358 Unclassified 1446
254 Ga0068871_100981770 3300006358 Bacteria 786
255 Ga0068871_101949208 3300006358 Unclassified 559
256 Ga0075428_100113776 3300006844 Bacteria 2948
257 Ga0075428_100279217 3300006844 Bacteria 1797
258 Ga0075430_100020638 3300006846 Bacteria 5604
259 Ga0075430_100260244 3300006846 Unclassified 1437
260 Ga0075430_100342893 3300006846 Unclassified 1234
261 Ga0075431_100008828 3300006847 Bacteria 10101
262 Ga0075431_100097917 3300006847 Bacteria 3028
263 Ga0075433_10003482 3300006852 Bacteria 12158
264 Ga0075434_100077203 3300006871 Unclassified 3326
265 Ga0075434_100724106 3300006871 Unclassified 1012
266 Ga0075429_100058106 3300006880 Bacteria 3368
267 Ga0075429_100258259 3300006880 Bacteria 1525
268 Ga0068865_100004621 3300006881 Bacteria 8315
269 Ga0068865_100020817 3300006881 Unclassified 4259
270 Ga0068865_100239644 3300006881 Bacteria 1426
271 Ga0068865_100313671 3300006881 Bacteria 1259
272 Ga0068865_100335198 3300006881 Unclassified 1221
273 Ga0068865_100339461 3300006881 Bacteria 1214
274 Ga0068865_100761029 3300006881 Bacteria 833
275 Ga0068865_101228185 3300006881 Unclassified 664
276 Ga0097620_100005893 3300006931 Bacteria 12436
277 Ga0097620_100009922 3300006931 Bacteria 9611
278 Ga0097620_100017820 3300006931 Bacteria 7138
279 Ga0097620_100038178 3300006931 Bacteria 4818
280 Ga0097620_100216920 3300006931 Bacteria 2001
281 Ga0097620_100240327 3300006931 Unclassified 1900
282 Ga0097620_100590637 3300006931 Bacteria 1204
283 Ga0097620_101019517 3300006931 Bacteria 909
284 Ga0097620_101091162 3300006931 Unclassified 878
285 Ga0097620_101421770 3300006931 Unclassified 765
286 Ga0075435_100200901 3300007076 Bacteria 1689
287 Ga0075435_100322605 3300007076 Unclassified 1322
288 Ga0105240_10117746 3300009093 Unclassified 3202
289 Ga0105240_10457091 3300009093 Unclassified 1428
290 Ga0111539_10003340 3300009094 Bacteria 21192
291 Ga0111539_10037556 3300009094 Bacteria 5847
292 Ga0111539_10108094 3300009094 Unclassified 3264
293 Ga0111539_10148075 3300009094 Bacteria 2749
294 Ga0111539_10250697 3300009094 Bacteria 2061
295 Ga0111539_10294713 3300009094 Bacteria 1888
296 Ga0111539_10304037 3300009094 Bacteria 1856
297 Ga0111539_10481343 3300009094 Bacteria 1446
298 Ga0111539_11445067 3300009094 Bacteria 798
299 Ga0105245_10073665 3300009098 Unclassified 3106
300 Ga0105245_10177255 3300009098 Bacteria 2034
301 Ga0105245_10621248 3300009098 Bacteria 1109
302 Ga0105245_10869985 3300009098 Bacteria 942
303 Ga0105245_11269527 3300009098 Unclassified 785
304 Ga0105245_11467726 3300009098 Unclassified 733
305 Ga0105247_10097635 3300009101 Bacteria 1874
306 Ga0105247_10198788 3300009101 Bacteria 1346
307 Ga0105247_10251434 3300009101 Bacteria 1208
308 Ga0114129_10205770 3300009147 Unclassified 2663
309 Ga0114129_10363197 3300009147 Bacteria 1915
310 Ga0114129_10451259 3300009147 Bacteria 1686
311 Ga0114129_12317314 3300009147 Unclassified 644
312 Ga0105243_10008460 3300009148 Bacteria 7899
313 Ga0105243_10043442 3300009148 Unclassified 3523
314 Ga0105243_11127456 3300009148 Unclassified 794
315 Ga0105241_10033656 3300009174 Unclassified 3848
316 Ga0105241_10253033 3300009174 Bacteria 1494
317 Ga0105242_10012768 3300009176 Bacteria 6470
318 Ga0105242_10050415 3300009176 Unclassified 3389
319 Ga0105242_10129769 3300009176 Bacteria 2174
320 Ga0105242_10265589 3300009176 Bacteria 1552
321 Ga0105242_10595903 3300009176 Bacteria 1067
322 Ga0105242_10943084 3300009176 Bacteria 866
323 Ga0105242_11230845 3300009176 Bacteria 769
324 Ga0105242_11561275 3300009176 Unclassified 693
325 Ga0105242_11752470 3300009176 Unclassified 658
326 Ga0105242_11777528 3300009176 Unclassified 654
327 Ga0105248_10000729 3300009177 Bacteria 37080
328 Ga0105248_10011617 3300009177 Bacteria 9701
329 Ga0105248_10041500 3300009177 Bacteria 5158
330 Ga0105248_10059342 3300009177 Unclassified 4297
331 Ga0105248_10504098 3300009177 Bacteria 1365
332 Ga0105248_10582510 3300009177 Unclassified 1262
333 Ga0105248_10644080 3300009177 Bacteria 1196
334 Ga0105248_10935412 3300009177 Unclassified 979
335 Ga0105248_11588902 3300009177 Bacteria 741
336 Ga0105237_11295002 3300009545 Bacteria 735
337 Ga0105238_10025760 3300009551 Bacteria 5997
338 Ga0105238_10026823 3300009551 Bacteria 5872
339 Ga0105249_10011034 3300009553 Bacteria 7937
340 Ga0105249_10157680 3300009553 Unclassified 2190
341 Ga0105249_10740282 3300009553 Bacteria 1045
342 Ga0105249_10834691 3300009553 Unclassified 986
343 Ga0105239_10084043 3300010375 Bacteria 3506
344 Ga0105246_10045009 3300011119 Unclassified 3003
345 Ga0105246_10405902 3300011119 Bacteria 1133
346 Ga0105246_10485088 3300011119 Bacteria 1046
347 Ga0105246_10901113 3300011119 Bacteria 793
348 Ga0105246_11531383 3300011119 Unclassified 627
349 Ga0105246_11605145 3300011119 Unclassified 615
350 Ga0105246_11967806 3300011119 Bacteria 563
351 Ga0157373_10280109 3300013100 Unclassified 1182
352 Ga0157371_10183622 3300013102 Bacteria 1496
353 Ga0157374_10044024 3300013296 Unclassified 4125
354 Ga0157374_10169695 3300013296 Unclassified 2128
355 Ga0157374_11362449 3300013296 Bacteria 732
356 Ga0157378_10522188 3300013297 Bacteria 1189
357 Ga0157378_10528239 3300013297 Bacteria 1182
358 Ga0157378_10580924 3300013297 Unclassified 1129
359 Ga0157378_10634673 3300013297 Bacteria 1082
360 Ga0157378_10959924 3300013297 Bacteria 888
361 Ga0157378_11951810 3300013297 Unclassified 636
362 Ga0163162_10095378 3300013306 Unclassified 3061
363 Ga0163162_10273079 3300013306 Unclassified 1822
364 Ga0163162_10850172 3300013306 Bacteria 1028
365 Ga0163162_12132559 3300013306 Bacteria 643
366 Ga0163162_12589691 3300013306 Bacteria 584
367 Ga0157372_10285827 3300013307 Bacteria 1918
368 Ga0157372_10439783 3300013307 Unclassified 1520
369 Ga0157375_10000300 3300013308 Bacteria 44788
370 Ga0157375_10078515 3300013308 Unclassified 3334
371 Ga0157375_10526865 3300013308 Unclassified 1344
372 Ga0157375_10800746 3300013308 Unclassified 1091
373 Ga0157375_11141035 3300013308 Unclassified 913
374 Ga0157375_11145735 3300013308 Unclassified 911
375 Ga0163163_10051676 3300014325 Unclassified 4052
376 Ga0163163_10067984 3300014325 Bacteria 3544
377 Ga0163163_10421541 3300014325 Unclassified 1393
378 Ga0163163_10653071 3300014325 Bacteria 1115
379 Ga0163163_10909582 3300014325 Bacteria 943
380 Ga0163163_11159897 3300014325 Bacteria 835
381 Ga0163163_11334754 3300014325 Bacteria 779
382 Ga0157380_10012655 3300014326 Bacteria 6124
383 Ga0157380_10064776 3300014326 Bacteria 2935
384 Ga0157380_10322192 3300014326 Bacteria 1433
385 Ga0157380_10544790 3300014326 Bacteria 1137
386 Ga0157380_12227105 3300014326 Bacteria 612
387 Ga0157380_12918189 3300014326 Bacteria 544
388 Ga0157377_10277652 3300014745 Bacteria 1097
389 Ga0157377_10454759 3300014745 Bacteria 885
390 Ga0157377_10517856 3300014745 Unclassified 837
391 Ga0157379_10000645 3300014968 Bacteria 28149
392 Ga0157379_10028324 3300014968 Bacteria 4984
393 Ga0157379_10251089 3300014968 Bacteria 1606
394 Ga0157379_10894593 3300014968 Bacteria 842
395 Ga0157376_10087688 3300014969 Unclassified 2686
396 Ga0157376_10097115 3300014969 Unclassified 2566
397 Ga0157376_10539678 3300014969 Bacteria 1152
398 Ga0157376_10678231 3300014969 Bacteria 1034
399 Ga0157376_10837796 3300014969 Bacteria 934
400 Ga0157376_10931255 3300014969 Bacteria 888
401 Ga0163161_10026739 3300017792 Unclassified 4089
402 Ga0163161_10715754 3300017792 Unclassified 835
403 Ga0207697_10001648 3300025315 Bacteria 12069
404 Ga0207697_10072877 3300025315 Unclassified 1441
405 Ga0207682_10007712 3300025893 Unclassified 4279
406 Ga0207682_10022597 3300025893 Bacteria 2479
407 Ga0207682_10067501 3300025893 Unclassified 1509
408 Ga0207682_10451385 3300025893 Unclassified 609
409 Ga0207642_10055949 3300025899 Unclassified 1807
410 Ga0207642_10294259 3300025899 Unclassified 939
411 Ga0207642_10639676 3300025899 Unclassified 665
412 Ga0207710_10097752 3300025900 Bacteria 1381
413 Ga0207710_10356397 3300025900 Bacteria 746
414 Ga0207710_10513218 3300025900 Unclassified 622
415 Ga0207688_10005062 3300025901 Bacteria 7171
416 Ga0207688_10013358 3300025901 Bacteria 4461
417 Ga0207688_10309719 3300025901 Bacteria 967
418 Ga0207680_10006790 3300025903 Bacteria 5553
419 Ga0207680_10188690 3300025903 Bacteria 1398
420 Ga0207680_10252911 3300025903 Unclassified 1217
421 Ga0207680_10779242 3300025903 Bacteria 685
422 Ga0207645_10003388 3300025907 Bacteria 12118
423 Ga0207645_10006606 3300025907 Bacteria 8291
424 Ga0207645_10191778 3300025907 Bacteria 1343
425 Ga0207645_10383545 3300025907 Unclassified 944
426 Ga0207645_10451348 3300025907 Bacteria 868
427 Ga0207643_10002413 3300025908 Bacteria 10115
428 Ga0207643_10033063 3300025908 Bacteria 2893
429 Ga0207643_10072958 3300025908 Bacteria 1978
430 Ga0207643_10104411 3300025908 Bacteria 1664
431 Ga0207643_10568919 3300025908 Unclassified 728
432 Ga0207654_10443845 3300025911 Unclassified 909
433 Ga0207695_10334715 3300025913 Unclassified 1402
434 Ga0207660_10729454 3300025917 Unclassified 808
435 Ga0207662_10005021 3300025918 Bacteria 7005
436 Ga0207662_10071033 3300025918 Unclassified 2107
437 Ga0207662_11136397 3300025918 Unclassified 555
438 Ga0207657_10316943 3300025919 Bacteria 1234
439 Ga0207657_11382995 3300025919 Bacteria 529
440 Ga0207649_10042309 3300025920 Unclassified 2778
441 Ga0207649_10215481 3300025920 Bacteria 1365
442 Ga0207649_10370641 3300025920 Bacteria 1065
443 Ga0207681_10049948 3300025923 Bacteria 2829
444 Ga0207681_10084897 3300025923 Unclassified 2246
445 Ga0207681_10105635 3300025923 Bacteria 2039
446 Ga0207681_10163765 3300025923 Bacteria 1679
447 Ga0207681_10168913 3300025923 Bacteria 1656
448 Ga0207681_10260069 3300025923 Unclassified 1358
449 Ga0207681_10355355 3300025923 Bacteria 1174
450 Ga0207694_10189954 3300025924 Bacteria 1668
451 Ga0207694_10225540 3300025924 Unclassified 1529
452 Ga0207694_10552952 3300025924 Bacteria 966
453 Ga0207650_10088151 3300025925 Unclassified 2366
454 Ga0207650_10154725 3300025925 Bacteria 1812
455 Ga0207650_10223330 3300025925 Bacteria 1517
456 Ga0207650_10236937 3300025925 Unclassified 1474
457 Ga0207650_10267583 3300025925 Unclassified 1388
458 Ga0207650_10428600 3300025925 Bacteria 1098
459 Ga0207659_10000383 3300025926 Bacteria 26664
460 Ga0207659_10005332 3300025926 Bacteria 7791
461 Ga0207659_10010576 3300025926 Bacteria 5803
462 Ga0207659_10019767 3300025926 Bacteria 4439
463 Ga0207659_10040671 3300025926 Unclassified 3252
464 Ga0207659_10057148 3300025926 Unclassified 2796
465 Ga0207659_10079829 3300025926 Bacteria 2415
466 Ga0207659_10241548 3300025926 Unclassified 1461
467 Ga0207659_10263831 3300025926 Unclassified 1402
468 Ga0207659_10704436 3300025926 Bacteria 865
469 Ga0207659_10780341 3300025926 Bacteria 820
470 Ga0207659_10982565 3300025926 Bacteria 726
471 Ga0207659_11573780 3300025926 Unclassified 561
472 Ga0207687_10550157 3300025927 Bacteria 968
473 Ga0207644_10037390 3300025931 Bacteria 3415
474 Ga0207644_10052317 3300025931 Unclassified 2934
475 Ga0207644_10077928 3300025931 Unclassified 2442
476 Ga0207644_10087366 3300025931 Unclassified 2317
477 Ga0207644_10835181 3300025931 Unclassified 771
478 Ga0207644_11118107 3300025931 Unclassified 662
479 Ga0207644_11501874 3300025931 Unclassified 565
480 Ga0207690_10164439 3300025932 Unclassified 1657
481 Ga0207690_10469723 3300025932 Bacteria 1014
482 Ga0207706_10014665 3300025933 Bacteria 7097
483 Ga0207706_10138670 3300025933 Bacteria 2139
484 Ga0207706_10217973 3300025933 Bacteria 1671
485 Ga0207686_10052488 3300025934 Unclassified 2545
486 Ga0207686_10068579 3300025934 Unclassified 2272
487 Ga0207686_10166173 3300025934 Bacteria 1552
488 Ga0207686_10168480 3300025934 Bacteria 1542
489 Ga0207686_10195567 3300025934 Unclassified 1445
490 Ga0207709_10047973 3300025935 Unclassified 2600
491 Ga0207709_10100785 3300025935 Unclassified 1909
492 Ga0207709_11180146 3300025935 Bacteria 630
493 Ga0207670_10049132 3300025936 Bacteria 2820
494 Ga0207670_10053249 3300025936 Unclassified 2725
495 Ga0207670_10145061 3300025936 Bacteria 1755
496 Ga0207670_10259788 3300025936 Bacteria 1346
497 Ga0207670_10283376 3300025936 Unclassified 1292
498 Ga0207669_10027118 3300025937 Bacteria 3129
499 Ga0207669_10203749 3300025937 Bacteria 1438
500 Ga0207669_10248819 3300025937 Unclassified 1322
501 Ga0207669_10552603 3300025937 Unclassified 929
502 Ga0207704_10004007 3300025938 Bacteria 6705
503 Ga0207704_10006688 3300025938 Bacteria 5400
504 Ga0207704_10342980 3300025938 Bacteria 1160
505 Ga0207704_10590120 3300025938 Unclassified 908
506 Ga0207691_10005619 3300025940 Bacteria 12118
507 Ga0207691_10025920 3300025940 Bacteria 5502
508 Ga0207691_10096230 3300025940 Bacteria 2647
509 Ga0207691_10139230 3300025940 Unclassified 2139
510 Ga0207691_10442991 3300025940 Unclassified 1106
511 Ga0207691_10446558 3300025940 Unclassified 1101
512 Ga0207691_10798475 3300025940 Unclassified 793
513 Ga0207711_10025690 3300025941 Unclassified 4939
514 Ga0207711_10083937 3300025941 Bacteria 2787
515 Ga0207711_10085761 3300025941 Unclassified 2760
516 Ga0207711_10103758 3300025941 Bacteria 2518
517 Ga0207711_10111601 3300025941 Bacteria 2432
518 Ga0207711_11062307 3300025941 Bacteria 750
519 Ga0207711_11206690 3300025941 Bacteria 698
520 Ga0207689_10003959 3300025942 Bacteria 13486
521 Ga0207689_10009438 3300025942 Bacteria 8424
522 Ga0207689_10012760 3300025942 Bacteria 7180
523 Ga0207689_10210059 3300025942 Unclassified 1608
524 Ga0207689_10366487 3300025942 Bacteria 1198
525 Ga0207689_11446777 3300025942 Unclassified 575
526 Ga0207661_10190021 3300025944 Bacteria 1800
527 Ga0207661_10287203 3300025944 Bacteria 1471
528 Ga0207679_10011736 3300025945 Bacteria 5689
529 Ga0207679_10033244 3300025945 Bacteria 3628
530 Ga0207679_10115007 3300025945 Unclassified 2131
531 Ga0207679_10212373 3300025945 Bacteria 1623
532 Ga0207679_10388847 3300025945 Bacteria 1224
533 Ga0207667_10262696 3300025949 Unclassified 1765
534 Ga0207651_10193189 3300025960 Unclassified 1625
535 Ga0207651_10212600 3300025960 Bacteria 1558
536 Ga0207651_10256043 3300025960 Bacteria 1434
537 Ga0207651_10318538 3300025960 Bacteria 1299
538 Ga0207651_10392811 3300025960 Unclassified 1178
539 Ga0207712_10096663 3300025961 Bacteria 2186
540 Ga0207712_10167876 3300025961 Bacteria 1712
541 Ga0207712_10356990 3300025961 Unclassified 1217
542 Ga0207668_10050498 3300025972 Bacteria 2867
543 Ga0207668_10146089 3300025972 Bacteria 1825
544 Ga0207668_10153704 3300025972 Unclassified 1785
545 Ga0207668_10237540 3300025972 Bacteria 1473
546 Ga0207640_10287698 3300025981 Unclassified 1294
547 Ga0207640_10359450 3300025981 Unclassified 1173
548 Ga0207640_10624567 3300025981 Unclassified 915
549 Ga0207658_10026093 3300025986 Bacteria 4094
550 Ga0207658_10108142 3300025986 Unclassified 2193
551 Ga0207658_10245863 3300025986 Unclassified 1518
552 Ga0207658_10364690 3300025986 Bacteria 1261
553 Ga0207658_10540482 3300025986 Bacteria 1042
554 Ga0207677_10026579 3300026023 Bacteria 3633
555 Ga0207677_10356690 3300026023 Unclassified 1227
556 Ga0207703_10018629 3300026035 Bacteria 5422
557 Ga0207703_10041326 3300026035 Bacteria 3693
558 Ga0207703_10050178 3300026035 Bacteria 3376
559 Ga0207703_10466734 3300026035 Unclassified 1181
560 Ga0207703_10774804 3300026035 Bacteria 915
561 Ga0207703_10912878 3300026035 Bacteria 841
562 Ga0207703_11184165 3300026035 Unclassified 735
563 Ga0207639_10075833 3300026041 Unclassified 2646
564 Ga0207639_10792040 3300026041 Unclassified 883
565 Ga0207678_10016394 3300026067 Bacteria 6505
566 Ga0207708_10006488 3300026075 Bacteria 8666
567 Ga0207708_10026968 3300026075 Bacteria 4350
568 Ga0207708_10406986 3300026075 Bacteria 1126
569 Ga0207702_10077992 3300026078 Unclassified 2867
570 Ga0207702_11050523 3300026078 Unclassified 808
571 Ga0207641_10000486 3300026088 Bacteria 44787
572 Ga0207641_10017431 3300026088 Bacteria 5879
573 Ga0207641_10205915 3300026088 Bacteria 1817
574 Ga0207641_10271526 3300026088 Bacteria 1591
575 Ga0207641_10630006 3300026088 Bacteria 1052
576 Ga0207641_10727942 3300026088 Bacteria 978
577 Ga0207648_10005401 3300026089 Bacteria 12881
578 Ga0207648_10025569 3300026089 Bacteria 5257
579 Ga0207648_10102275 3300026089 Bacteria 2511
580 Ga0207648_10163480 3300026089 Bacteria 1966
581 Ga0207648_10317261 3300026089 Bacteria 1400
582 Ga0207648_10327055 3300026089 Bacteria 1378
583 Ga0207648_10382401 3300026089 Bacteria 1273
584 Ga0207648_10591234 3300026089 Bacteria 1022
585 Ga0207676_10015022 3300026095 Bacteria 5582
586 Ga0207676_10055770 3300026095 Unclassified 3104
587 Ga0207676_10082003 3300026095 Bacteria 2622
588 Ga0207676_10111225 3300026095 Bacteria 2292
589 Ga0207676_10236186 3300026095 Unclassified 1637
590 Ga0207676_11171657 3300026095 Unclassified 761
591 Ga0207674_10013186 3300026116 Bacteria 9193
592 Ga0207674_10459776 3300026116 Bacteria 1230
593 Ga0207674_10708901 3300026116 Bacteria 971
594 Ga0207675_100029618 3300026118 Bacteria 5098
595 Ga0207675_100043959 3300026118 Unclassified 4172
596 Ga0207675_100086437 3300026118 Bacteria 2945
597 Ga0207675_100186474 3300026118 Bacteria 1988
598 Ga0207675_100352179 3300026118 Bacteria 1443
599 Ga0207675_100511052 3300026118 Unclassified 1197
600 Ga0207683_10006075 3300026121 Bacteria 10341
601 Ga0207683_10025317 3300026121 Bacteria 5118
602 Ga0207683_10090957 3300026121 Unclassified 2718
603 Ga0207683_10100814 3300026121 Bacteria 2578
604 Ga0207683_10143374 3300026121 Unclassified 2153
605 Ga0207683_10195757 3300026121 Bacteria 1836
606 Ga0207683_10582820 3300026121 Unclassified 1035
607 Ga0207683_10717085 3300026121 Unclassified 927
608 Ga0207698_11065936 3300026142 Unclassified 820
609 Ga0209973_1008751 3300027252 Bacteria 1164
610 Ga0209970_1034667 3300027614 Unclassified 885
611 Ga0207428_10017850 3300027907 Bacteria 6082
612 Ga0207428_10023972 3300027907 Bacteria 5125
613 Ga0207428_10035418 3300027907 Unclassified 4080
614 Ga0207428_10517582 3300027907 Bacteria 865
615 Ga0268266_10101997 3300028379 Unclassified 2531
616 Ga0268266_10630244 3300028379 Bacteria 1031
617 Ga0268266_10830570 3300028379 Unclassified 893
618 Ga0268265_10012300 3300028380 Bacteria 5799
619 Ga0268265_10169774 3300028380 Bacteria 1863
620 Ga0268265_10170763 3300028380 Bacteria 1858
621 Ga0268265_10919832 3300028380 Unclassified 860
622 Ga0268264_10015149 3300028381 Bacteria 6325
623 Ga0268264_10042468 3300028381 Bacteria 3764
624 Ga0268264_10149126 3300028381 Bacteria 2095
625 Ga0268264_12083841 3300028381 Bacteria 576
626 Ga0268264_12248945 3300028381 Bacteria 553
627 Ga0265332_10157016 3300031238 Bacteria 951
628 Ga0307408_100249607 3300031548 Bacteria 1463
629 Ga0307405_11096374 3300031731 Bacteria 684
630 Ga0307410_10261541 3300031852 Bacteria 1350
631 Ga0307412_10477647 3300031911 Unclassified 1033
632 Ga0307416_100924240 3300032002 Bacteria 973
633 Ga0307414_10483865 3300032004 Bacteria 1092
634 Ga0307415_100289830 3300032126 Bacteria 1351
635 Ga0373932_0055698 3300035112 Bacteria 1187
636 Ga0373942_0341022 3300035207 Unclassified 528
637 Ga0373961_0186806 3300035241 Bacteria 725
638 Ga0373937_0834228 3300036401 Unclassified 870
639 Ga0436362_0945229 3300039453 Unclassified 618
640 Ga0439453_0010314 3300041408 Unclassified 1538
641 Ga0439451_057116 3300042009 Bacteria 781
642 Ga0450919_026494 3300042121 Bacteria 659
643 Ga0439435_0003672 3300042436 Bacteria 3217
644 Ga0439459_0136976 3300042438 Unclassified 630
645 Ga0439460_0114152 3300042461 Bacteria 879
646 Ga0453683_0476702 3300044673 Unclassified 809
647 Ga0451576_0245048 3300045051 Unclassified 1872
648 Ga0495582_0001891 3300046473 Bacteria 11807
649 Ga0495639_0044567 3300046475 Bacteria 2005
650 Ga0495639_0237885 3300046475 Bacteria 898
651 Ga0495664_0046799 3300046477 Unclassified 2567
652 Ga0495594_0189325 3300046499 Bacteria 1172
653 Ga0495594_0355410 3300046499 Bacteria 834
654 Ga0495607_0277421 3300046501 Unclassified 797
655 Ga0495628_0186366 3300046516 Unclassified 1568
656 Ga0495630_0082495 3300046517 Bacteria 2427
657 Ga0495666_0197775 3300046526 Unclassified 925
658 Ga0495642_0272998 3300046528 Unclassified 740
659 Ga0495652_0840522 3300046529 Bacteria 609
660 Ga0495586_0009620 3300046535 Bacteria 5150
661 Ga0495586_0238497 3300046535 Bacteria 1036
662 Ga0495598_0026363 3300046537 Bacteria 1593
663 Ga0495598_0336025 3300046537 Unclassified 579
664 Ga0495645_0121696 3300046543 Unclassified 1837
665 Ga0495656_0368533 3300046615 Unclassified 747
666 Ga0495634_0049605 3300046642 Bacteria 2822
667 Ga0495634_0277705 3300046642 Bacteria 1018
668 Ga0495658_0010972 3300046683 Bacteria 4543
669 Ga0495658_0079337 3300046683 Bacteria 1923
670 Ga0495581_0063198 3300047315 Bacteria 2139
671 Ga0495674_0286555 3300047319 Bacteria 1348
672 Ga0495675_0377791 3300047444 Unclassified 829
673 Ga0495684_0636176 3300047471 Bacteria 715
674 Ga0495614_0302229 3300048089 Unclassified 740
675 Ga0496114_0147379 3300048917 Unclassified 2041
676 Ga0496114_0386095 3300048917 Bacteria 1240
677 Ga0501225_0195657 3300049705 Unclassified 639
678 nmdc:mga05p37_188855_c1 3300050507 Bacteria 2503
679 nmdc:mga09592_13731_c1 3300050508 Bacteria 6617
680 nmdc:mga09592_59036_c1 3300050508 Bacteria 3243
681 nmdc:mga0qj67_11252_c1 3300050509 Bacteria 6702
682 nmdc:mga0qj67_375999_c1 3300050509 Unclassified 1147
683 nmdc:mga06r32_114082_c1 3300050510 Bacteria 2660
684 nmdc:mga06r32_3004_c1 3300050510 Bacteria 15109
685 nmdc:mga08y16_1019080_c1 3300050511 Unclassified 807
686 nmdc:mga08y16_1755_c1 3300050511 Bacteria 21970
687 nmdc:mga08y16_200614_c1 3300050511 Unclassified 2067
688 nmdc:mga08y16_306168_c1 3300050511 Bacteria 1637
689 nmdc:mga08y16_593339_c1 3300050511 Bacteria 1117
690 nmdc:mga08y16_72657_c1 3300050511 Bacteria 3584
691 nmdc:mga08y16_7619_c1 3300050511 Bacteria 11331
692 nmdc:mga0n895_447616_c1 3300050512 Unclassified 1304
693 nmdc:mga0n895_79582_c1 3300050512 Unclassified 3264
694 nmdc:mga0n895_855833_c1 3300050512 Unclassified 897
695 nmdc:mga0rr50_345661_c1 3300050513 Unclassified 1250
696 nmdc:mga08x19_986476_c1 3300050514 Unclassified 598
697 nmdc:mga0a205_4439_c1 3300050515 Bacteria 12597
698 Ga0075428_100037932
699 JGI24746J21847_1001635
700 JGI24745J21846_1005124
701 JGI24033J26618_1024699
702 JGI24751J29686_10016979
703 Ga0058859_10754822
704 Ga0065714_10171933
705 Ga0065714_10186213
706 Ga0065712_10011962
707 Ga0065712_10115058
708 Ga0065715_10245868
709 Ga0065715_10419831
710 Ga0065715_10789993
711 Ga0065707_10120319
712 Ga0070676_10010445
713 Ga0070676_10010989
714 Ga0070676_10487302
715 Ga0070676_10517492
716 Ga0070683_100053435
717 Ga0070683_100671067
718 Ga0070683_101548698
719 Ga0070690_100031451
720 Ga0070690_100049125
721 Ga0070690_101298146
722 Ga0070670_100013016
723 Ga0070670_100026040
724 Ga0070670_100251364
725 Ga0070670_100267631
726 Ga0070670_100714652
727 Ga0070670_101184882
728 Ga0070677_10024521
729 Ga0070677_10050178
730 Ga0070677_10084641
731 Ga0070677_10153518
732 Ga0070677_10693319
733 Ga0068869_100048051
734 Ga0068869_100112521
735 Ga0068869_100134919
736 Ga0068869_100337489
737 Ga0070666_10164670
738 Ga0070666_10286284
739 Ga0070666_11047398
740 Ga0070680_100213283
741 Ga0070682_100734888
742 Ga0070682_101376558
743 Ga0068868_100167407
744 Ga0068868_100274658
745 Ga0070689_100014345
746 Ga0070689_100065945
747 Ga0070689_100171189
748 Ga0070687_100011589
749 Ga0070687_100116766
750 Ga0070687_101327118
751 Ga0070661_100019734
752 Ga0070661_100405958
753 Ga0070661_100969664
754 Ga0070661_101528508
755 Ga0070692_10708612
756 Ga0070668_100466880
757 Ga0070668_100682484
758 Ga0070668_100905496
759 Ga0070669_100003613
760 Ga0070669_100026466
761 Ga0070669_100104399
762 Ga0070669_100115965
763 Ga0070669_100179350
764 Ga0070669_100181715
765 Ga0070669_100355920
766 Ga0070669_101064378
767 Ga0070669_101215113
768 Ga0070675_100000183
769 Ga0070675_100000391
770 Ga0070675_100000483
771 Ga0070675_100005480
772 Ga0070675_100017161
773 Ga0070675_100078237
774 Ga0070675_100091436
775 Ga0070675_100118517
776 Ga0070675_100276989
777 Ga0070675_100770212
778 Ga0070675_101033805
779 Ga0070671_100014454
780 Ga0070671_100141779
781 Ga0070671_101575606
782 Ga0070674_100000133
783 Ga0070674_100009342
784 Ga0070674_100283576
785 Ga0070674_100321890
786 Ga0070674_101026197
787 Ga0070673_100044780
788 Ga0070673_100104240
789 Ga0070688_100057751
790 Ga0070688_100069225
791 Ga0070688_100084567
792 Ga0070688_100102144
793 Ga0070688_100605464
794 Ga0070688_100761604
795 Ga0070688_100956264
796 Ga0070659_100356441
797 Ga0070659_100562481
798 Ga0070667_100013148
799 Ga0070667_100220895
800 Ga0070667_100336631
801 Ga0070667_102202375
802 Ga0070701_10445774
803 Ga0070700_100023336
804 Ga0070700_100028632
805 Ga0070663_100026742
806 Ga0070663_100065402
807 Ga0070678_100048747
808 Ga0070678_100076268
809 Ga0070678_100161818
810 Ga0070678_100179934
811 Ga0070678_100344413
812 Ga0070678_100660378
813 Ga0070678_100751603
814 Ga0070678_100759956
815 Ga0070678_101717211
816 Ga0070662_100191441
817 Ga0070662_100256878
818 Ga0070662_100628472
819 Ga0068867_100071660
820 Ga0068867_100269122
821 Ga0068867_100526898
822 Ga0068867_100962819
823 Ga0068867_101106098
824 Ga0068867_101298289
825 Ga0070685_10005976
826 Ga0070685_10087935
827 Ga0070685_10324844
828 Ga0070685_10514527
829 Ga0070707_101752735
830 Ga0070698_100234116
831 Ga0070698_100302060
832 Ga0070698_100634948
833 Ga0070698_100901092
834 Ga0070699_100574254
835 Ga0070679_100689561
836 Ga0070684_100128269
837 Ga0070684_100463418
838 Ga0070684_100538418
839 Ga0070684_100561806
840 Ga0068853_100102969
841 Ga0068853_100110745
842 Ga0068853_101327612
843 Ga0070672_100035479
844 Ga0070672_100055818
845 Ga0070672_100112544
846 Ga0070672_100175534
847 Ga0070672_100185677
848 Ga0070672_100193891
849 Ga0070672_100419319
850 Ga0070686_100010015
851 Ga0070686_100025080
852 Ga0070686_100135426
853 Ga0070686_100257013
854 Ga0070686_100284994
855 Ga0070686_100379546
856 Ga0070696_100234663
857 Ga0070696_100748966
858 Ga0070696_101002033
859 Ga0070696_101580981
860 Ga0070693_100718577
861 Ga0070665_100093255
862 Ga0070665_100732332
863 Ga0070704_100251060
864 Ga0068855_100913464
865 Ga0070664_100000702
866 Ga0070664_100040486
867 Ga0070664_100129376
868 Ga0070664_100193102
869 Ga0070664_100794170
870 Ga0070664_101722164
871 Ga0068857_100006332
872 Ga0068857_100238007
873 Ga0068857_100961288
874 Ga0068854_100836512
875 Ga0068854_101115693
876 Ga0068856_100112717
877 Ga0068856_101298430
878 Ga0070702_100035530
879 Ga0070702_100438939
880 Ga0070702_100601163
881 Ga0070702_100868558
882 Ga0068852_101291374
883 Ga0068859_100005893
884 Ga0068859_100009922
885 Ga0068859_100017822
886 Ga0068859_100038178
887 Ga0068859_100216938
888 Ga0068859_100240316
889 Ga0068859_100590584
890 Ga0068859_101019682
891 Ga0068859_101091260
892 Ga0068859_101421811
893 Ga0068864_100028526
894 Ga0068864_100036064
895 Ga0068864_100067180
896 Ga0068864_100202197
897 Ga0068864_100653877
898 Ga0068864_101000268
899 Ga0068864_101505649
900 Ga0068864_102254678
901 Ga0068866_10048346
902 Ga0068866_10249770
903 Ga0068866_10425074
904 Ga0068866_10725001
905 Ga0068861_100014097
906 Ga0068861_100017564
907 Ga0068861_100099368
908 Ga0068861_100426872
909 Ga0068861_100808796
910 Ga0068861_100847329
911 Ga0068861_101094544
912 Ga0068851_10237880
913 Ga0068870_10000968
914 Ga0068870_10005293
915 Ga0068870_10028367
916 Ga0068870_10257547
917 Ga0068870_10554896
918 Ga0068870_10640479
919 Ga0068863_100000251
920 Ga0068863_100006154
921 Ga0068863_100494780
922 Ga0068863_100659922
923 Ga0068863_100672033
924 Ga0068863_101679146
925 Ga0068858_100005357
926 Ga0068858_100023733
927 Ga0068858_100049284
928 Ga0068858_100057099
929 Ga0068858_101373802
930 Ga0068860_100001061
931 Ga0068860_100039472
932 Ga0068860_100122071
933 Ga0068860_100164079
934 Ga0068860_100939703
935 Ga0068862_100001221
936 Ga0068862_100267347
937 Ga0068862_100291006
938 Ga0068862_101048122
939 Ga0068862_101131199
940 Ga0068862_101786600
941 Ga0097621_100109423
942 Ga0097621_100430544
943 Ga0097621_100574712
944 Ga0097621_101094489
945 Ga0068871_100054871
946 Ga0068871_100120263
947 Ga0068871_100168466
948 Ga0068871_100185286
949 Ga0068871_100204987
950 Ga0068871_100284931
951 Ga0068871_100981770
952 Ga0068871_101949208
953 Ga0075428_100113776
954 Ga0075428_100279217
955 Ga0075430_100020638
956 Ga0075430_100260244
957 Ga0075430_100342893
958 Ga0075431_100008828
959 Ga0075431_100097917
960 Ga0075433_10003482
961 Ga0075434_100077203
962 Ga0075434_100724106
963 Ga0075429_100058106
964 Ga0075429_100258259
965 Ga0068865_100004621
966 Ga0068865_100020817
967 Ga0068865_100239644
968 Ga0068865_100313671
969 Ga0068865_100335198
970 Ga0068865_100339461
971 Ga0068865_100761029
972 Ga0068865_101228185
973 Ga0097620_100005893
974 Ga0097620_100009922
975 Ga0097620_100017820
976 Ga0097620_100038178
977 Ga0097620_100216920
978 Ga0097620_100240327
979 Ga0097620_100590637
980 Ga0097620_101019517
981 Ga0097620_101091162
982 Ga0097620_101421770
983 Ga0075435_100200901
984 Ga0075435_100322605
985 Ga0105240_10117746
986 Ga0105240_10457091
987 Ga0111539_10003340
988 Ga0111539_10037556
989 Ga0111539_10108094
990 Ga0111539_10148075
991 Ga0111539_10250697
992 Ga0111539_10294713
993 Ga0111539_10304037
994 Ga0111539_10481343
995 Ga0111539_11445067
996 Ga0105245_10073665
997 Ga0105245_10177255
998 Ga0105245_10621248
999 Ga0105245_10869985
1000 Ga0105245_11269527
1001 Ga0105245_11467726
1002 Ga0105247_10097635
1003 Ga0105247_10198788
1004 Ga0105247_10251434
1005 Ga0114129_10205770
1006 Ga0114129_10363197
1007 Ga0114129_10451259
1008 Ga0114129_12317314
1009 Ga0105243_10008460
1010 Ga0105243_10043442
1011 Ga0105243_11127456
1012 Ga0105241_10033656
1013 Ga0105241_10253033
1014 Ga0105242_10012768
1015 Ga0105242_10050415
1016 Ga0105242_10129769
1017 Ga0105242_10265589
1018 Ga0105242_10595903
1019 Ga0105242_10943084
1020 Ga0105242_11230845
1021 Ga0105242_11561275
1022 Ga0105242_11752470
1023 Ga0105242_11777528
1024 Ga0105248_10000729
1025 Ga0105248_10011617
1026 Ga0105248_10041500
1027 Ga0105248_10059342
1028 Ga0105248_10504098
1029 Ga0105248_10582510
1030 Ga0105248_10644080
1031 Ga0105248_10935412
1032 Ga0105248_11588902
1033 Ga0105237_11295002
1034 Ga0105238_10025760
1035 Ga0105238_10026823
1036 Ga0105249_10011034
1037 Ga0105249_10157680
1038 Ga0105249_10740282
1039 Ga0105249_10834691
1040 Ga0105239_10084043
1041 Ga0105246_10045009
1042 Ga0105246_10405902
1043 Ga0105246_10485088
1044 Ga0105246_10901113
1045 Ga0105246_11531383
1046 Ga0105246_11605145
1047 Ga0105246_11967806
1048 Ga0157373_10280109
1049 Ga0157371_10183622
1050 Ga0157374_10044024
1051 Ga0157374_10169695
1052 Ga0157374_11362449
1053 Ga0157378_10522188
1054 Ga0157378_10528239
1055 Ga0157378_10580924
1056 Ga0157378_10634673
1057 Ga0157378_10959924
1058 Ga0157378_11951810
1059 Ga0163162_10095378
1060 Ga0163162_10273079
1061 Ga0163162_10850172
1062 Ga0163162_12132559
1063 Ga0163162_12589691
1064 Ga0157372_10285827
1065 Ga0157372_10439783
1066 Ga0157375_10000300
1067 Ga0157375_10078515
1068 Ga0157375_10526865
1069 Ga0157375_10800746
1070 Ga0157375_11141035
1071 Ga0157375_11145735
1072 Ga0163163_10051676
1073 Ga0163163_10067984
1074 Ga0163163_10421541
1075 Ga0163163_10653071
1076 Ga0163163_10909582
1077 Ga0163163_11159897
1078 Ga0163163_11334754
1079 Ga0157380_10012655
1080 Ga0157380_10064776
1081 Ga0157380_10322192
1082 Ga0157380_10544790
1083 Ga0157380_12227105
1084 Ga0157380_12918189
1085 Ga0157377_10277652
1086 Ga0157377_10454759
1087 Ga0157377_10517856
1088 Ga0157379_10000645
1089 Ga0157379_10028324
1090 Ga0157379_10251089
1091 Ga0157379_10894593
1092 Ga0157376_10087688
1093 Ga0157376_10097115
1094 Ga0157376_10539678
1095 Ga0157376_10678231
1096 Ga0157376_10837796
1097 Ga0157376_10931255
1098 Ga0163161_10026739
1099 Ga0163161_10715754
1100 Ga0207697_10001648
1101 Ga0207697_10072877
1102 Ga0207682_10007712
1103 Ga0207682_10022597
1104 Ga0207682_10067501
1105 Ga0207682_10451385
1106 Ga0207642_10055949
1107 Ga0207642_10294259
1108 Ga0207642_10639676
1109 Ga0207710_10097752
1110 Ga0207710_10356397
1111 Ga0207710_10513218
1112 Ga0207688_10005062
1113 Ga0207688_10013358
1114 Ga0207688_10309719
1115 Ga0207680_10006790
1116 Ga0207680_10188690
1117 Ga0207680_10252911
1118 Ga0207680_10779242
1119 Ga0207645_10003388
1120 Ga0207645_10006606
1121 Ga0207645_10191778
1122 Ga0207645_10383545
1123 Ga0207645_10451348
1124 Ga0207643_10002413
1125 Ga0207643_10033063
1126 Ga0207643_10072958
1127 Ga0207643_10104411
1128 Ga0207643_10568919
1129 Ga0207654_10443845
1130 Ga0207695_10334715
1131 Ga0207660_10729454
1132 Ga0207662_10005021
1133 Ga0207662_10071033
1134 Ga0207662_11136397
1135 Ga0207657_10316943
1136 Ga0207657_11382995
1137 Ga0207649_10042309
1138 Ga0207649_10215481
1139 Ga0207649_10370641
1140 Ga0207681_10049948
1141 Ga0207681_10084897
1142 Ga0207681_10105635
1143 Ga0207681_10163765
1144 Ga0207681_10168913
1145 Ga0207681_10260069
1146 Ga0207681_10355355
1147 Ga0207694_10189954
1148 Ga0207694_10225540
1149 Ga0207694_10552952
1150 Ga0207650_10088151
1151 Ga0207650_10154725
1152 Ga0207650_10223330
1153 Ga0207650_10236937
1154 Ga0207650_10267583
1155 Ga0207650_10428600
1156 Ga0207659_10000383
1157 Ga0207659_10005332
1158 Ga0207659_10010576
1159 Ga0207659_10019767
1160 Ga0207659_10040671
1161 Ga0207659_10057148
1162 Ga0207659_10079829
1163 Ga0207659_10241548
1164 Ga0207659_10263831
1165 Ga0207659_10704436
1166 Ga0207659_10780341
1167 Ga0207659_10982565
1168 Ga0207659_11573780
1169 Ga0207687_10550157
1170 Ga0207644_10037390
1171 Ga0207644_10052317
1172 Ga0207644_10077928
1173 Ga0207644_10087366
1174 Ga0207644_10835181
1175 Ga0207644_11118107
1176 Ga0207644_11501874
1177 Ga0207690_10164439
1178 Ga0207690_10469723
1179 Ga0207706_10014665
1180 Ga0207706_10138670
1181 Ga0207706_10217973
1182 Ga0207686_10052488
1183 Ga0207686_10068579
1184 Ga0207686_10166173
1185 Ga0207686_10168480
1186 Ga0207686_10195567
1187 Ga0207709_10047973
1188 Ga0207709_10100785
1189 Ga0207709_11180146
1190 Ga0207670_10049132
1191 Ga0207670_10053249
1192 Ga0207670_10145061
1193 Ga0207670_10259788
1194 Ga0207670_10283376
1195 Ga0207669_10027118
1196 Ga0207669_10203749
1197 Ga0207669_10248819
1198 Ga0207669_10552603
1199 Ga0207704_10004007
1200 Ga0207704_10006688
1201 Ga0207704_10342980
1202 Ga0207704_10590120
1203 Ga0207691_10005619
1204 Ga0207691_10025920
1205 Ga0207691_10096230
1206 Ga0207691_10139230
1207 Ga0207691_10442991
1208 Ga0207691_10446558
1209 Ga0207691_10798475
1210 Ga0207711_10025690
1211 Ga0207711_10083937
1212 Ga0207711_10085761
1213 Ga0207711_10103758
1214 Ga0207711_10111601
1215 Ga0207711_11062307
1216 Ga0207711_11206690
1217 Ga0207689_10003959
1218 Ga0207689_10009438
1219 Ga0207689_10012760
1220 Ga0207689_10210059
1221 Ga0207689_10366487
1222 Ga0207689_11446777
1223 Ga0207661_10190021
1224 Ga0207661_10287203
1225 Ga0207679_10011736
1226 Ga0207679_10033244
1227 Ga0207679_10115007
1228 Ga0207679_10212373
1229 Ga0207679_10388847
1230 Ga0207667_10262696
1231 Ga0207651_10193189
1232 Ga0207651_10212600
1233 Ga0207651_10256043
1234 Ga0207651_10318538
1235 Ga0207651_10392811
1236 Ga0207712_10096663
1237 Ga0207712_10167876
1238 Ga0207712_10356990
1239 Ga0207668_10050498
1240 Ga0207668_10146089
1241 Ga0207668_10153704
1242 Ga0207668_10237540
1243 Ga0207640_10287698
1244 Ga0207640_10359450
1245 Ga0207640_10624567
1246 Ga0207658_10026093
1247 Ga0207658_10108142
1248 Ga0207658_10245863
1249 Ga0207658_10364690
1250 Ga0207658_10540482
1251 Ga0207677_10026579
1252 Ga0207677_10356690
1253 Ga0207703_10018629
1254 Ga0207703_10041326
1255 Ga0207703_10050178
1256 Ga0207703_10466734
1257 Ga0207703_10774804
1258 Ga0207703_10912878
1259 Ga0207703_11184165
1260 Ga0207639_10075833
1261 Ga0207639_10792040
1262 Ga0207678_10016394
1263 Ga0207708_10006488
1264 Ga0207708_10026968
1265 Ga0207708_10406986
1266 Ga0207702_10077992
1267 Ga0207702_11050523
1268 Ga0207641_10000486
1269 Ga0207641_10017431
1270 Ga0207641_10205915
1271 Ga0207641_10271526
1272 Ga0207641_10630006
1273 Ga0207641_10727942
1274 Ga0207648_10005401
1275 Ga0207648_10025569
1276 Ga0207648_10102275
1277 Ga0207648_10163480
1278 Ga0207648_10317261
1279 Ga0207648_10327055
1280 Ga0207648_10382401
1281 Ga0207648_10591234
1282 Ga0207676_10015022
1283 Ga0207676_10055770
1284 Ga0207676_10082003
1285 Ga0207676_10111225
1286 Ga0207676_10236186
1287 Ga0207676_11171657
1288 Ga0207674_10013186
1289 Ga0207674_10459776
1290 Ga0207674_10708901
1291 Ga0207675_100029618
1292 Ga0207675_100043959
1293 Ga0207675_100086437
1294 Ga0207675_100186474
1295 Ga0207675_100352179
1296 Ga0207675_100511052
1297 Ga0207683_10006075
1298 Ga0207683_10025317
1299 Ga0207683_10090957
1300 Ga0207683_10100814
1301 Ga0207683_10143374
1302 Ga0207683_10195757
1303 Ga0207683_10582820
1304 Ga0207683_10717085
1305 Ga0207698_11065936
1306 Ga0209973_1008751
1307 Ga0209970_1034667
1308 Ga0207428_10017850
1309 Ga0207428_10023972
1310 Ga0207428_10035418
1311 Ga0207428_10517582
1312 Ga0268266_10101997
1313 Ga0268266_10630244
1314 Ga0268266_10830570
1315 Ga0268265_10012300
1316 Ga0268265_10169774
1317 Ga0268265_10170763
1318 Ga0268265_10919832
1319 Ga0268264_10015149
1320 Ga0268264_10042468
1321 Ga0268264_10149126
1322 Ga0268264_12083841
1323 Ga0268264_12248945
1324 Ga0265332_10157016
1325 Ga0307408_100249607
1326 Ga0307405_11096374
1327 Ga0307410_10261541
1328 Ga0307412_10477647
1329 Ga0307416_100924240
1330 Ga0307414_10483865
1331 Ga0307415_100289830
1332 Ga0373932_0055698
1333 Ga0373942_0341022
1334 Ga0373961_0186806
1335 Ga0373937_0834228
1336 Ga0436362_0945229
1337 Ga0439453_0010314
1338 Ga0439451_057116
1339 Ga0450919_026494
1340 Ga0439435_0003672
1341 Ga0439459_0136976
1342 Ga0439460_0114152
1343 Ga0453683_0476702
1344 Ga0451576_0245048
1345 Ga0495582_0001891
1346 Ga0495639_0044567
1347 Ga0495639_0237885
1348 Ga0495664_0046799
1349 Ga0495594_0189325
1350 Ga0495594_0355410
1351 Ga0495607_0277421
1352 Ga0495628_0186366
1353 Ga0495630_0082495
1354 Ga0495666_0197775
1355 Ga0495642_0272998
1356 Ga0495652_0840522
1357 Ga0495586_0009620
1358 Ga0495586_0238497
1359 Ga0495598_0026363
1360 Ga0495598_0336025
1361 Ga0495645_0121696
1362 Ga0495656_0368533
1363 Ga0495634_0049605
1364 Ga0495634_0277705
1365 Ga0495658_0010972
1366 Ga0495658_0079337
1367 Ga0495581_0063198
1368 Ga0495674_0286555
1369 Ga0495675_0377791
1370 Ga0495684_0636176
1371 Ga0495614_0302229
1372 Ga0496114_0147379
1373 Ga0496114_0386095
1374 Ga0501225_0195657
1375 nmdc:mga05p37_188855_c1
1376 nmdc:mga09592_13731_c1
1377 nmdc:mga09592_59036_c1
1378 nmdc:mga0qj67_11252_c1
1379 nmdc:mga0qj67_375999_c1
1380 nmdc:mga06r32_114082_c1
1381 nmdc:mga06r32_3004_c1
1382 nmdc:mga08y16_1019080_c1
1383 nmdc:mga08y16_1755_c1
1384 nmdc:mga08y16_200614_c1
1385 nmdc:mga08y16_306168_c1
1386 nmdc:mga08y16_593339_c1
1387 nmdc:mga08y16_72657_c1
1388 nmdc:mga08y16_7619_c1
1389 nmdc:mga0n895_447616_c1
1390 nmdc:mga0n895_79582_c1
1391 nmdc:mga0n895_855833_c1
1392 nmdc:mga0rr50_345661_c1
1393 nmdc:mga08x19_986476_c1
1394 nmdc:mga0a205_4439_c1

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19649

DUF6152

Family of unknown function (DUF6152)

17

125

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ywk-assembly3.cif.gz_A pyrococcus furiosus mcm n-terminal domain with zinc-binding subdomain b deleted 0.7768 39 113
6cqm-assembly2.cif.gz_H-3 crystal structure of mitochondrial single-stranded dna binding proteins from s. cerevisiae, rim1 (form2) 0.7391 39 130
4ywk-assembly3.cif.gz_B pyrococcus furiosus mcm n-terminal domain with zinc-binding subdomain b deleted 0.7341 39 113
1h9r-assembly1.cif.gz_A tungstate bound complex dimop domain of mode from e.coli 0.7126 42 113
1o7l-assembly1.cif.gz_B molybdate-activated form of mode from escherichia coli 0.7088 41 113
ID Description Score Start End Superfamily
af_Q9TXQ8_9_134_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7339 40 132 2.40.50.140
af_Q95Y97_40_169_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7219 40 137 2.40.50.140
1h9rA01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.7182 42 110 2.40.50.100
4gopY00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7148 40 143 2.40.50.140
af_Q8II42_53_185_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7033 40 130 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A1G0K6T8-F1-model_v4 Uncharacterized protein 0.9672 34 163
AF-A0A3N5WP07-F1-model_v4 Uncharacterized protein 0.949 34 159
AF-A0A4Q6BWS8-F1-model_v4 DUF5666 domain-containing protein 0.9293 25 162
AF-A0A1G0K6T8-F1-model_v4 Uncharacterized protein 0.9163 34 163
AF-G4RGG4-F1-model_v4 DUF5666 domain-containing protein 0.9092 24 159

Map