F475811

General Info

Members Datasets Scaffolds Average Seq Length
695 316 1390 151

Family's Representative Sequence

Representative Sequence 3300049569|Ga0501032_0005009|Ga0501032_0005009_4155_4649
Length 164
Sequence VDDVVDAYGDLISDLFSVVGRFRRQLRRSTGGGFDAAGLTQSQAELVRLVGRRPGISVRESAAELSLVPNTASTLVSRLVNDGLLIRTVDDADRRVGRLALTESAQRVADESRAARRAALSAVLTKLEPGQIDALTKGLDVLSELTRLLHEDAELRDTPEAVKA

Samples

Sample ID Description Type Environment
1 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
2 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
6 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
7 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
8 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
9 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
10 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
11 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
69 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
70 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
71 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
72 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
73 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
74 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
75 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
76 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
77 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
78 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
79 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
82 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
83 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
84 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
110 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
111 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
112 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
113 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
114 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
115 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
116 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
117 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
169 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
170 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
174 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
175 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
176 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
177 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
178 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
179 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
180 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
181 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
182 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
183 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
184 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
185 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
186 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
187 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
188 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
189 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
190 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
191 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
192 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
193 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
194 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
195 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
196 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
197 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
198 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
199 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
200 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
201 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
202 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
203 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
204 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
205 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
206 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
207 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
208 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
209 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
210 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
211 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
212 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
213 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
214 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
215 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
216 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
217 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
218 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
219 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
220 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
221 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
222 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
223 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
224 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
225 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
226 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
227 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
228 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
229 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
230 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
231 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
232 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
233 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
234 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
235 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
236 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
237 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
238 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
239 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
240 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
241 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
242 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
243 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
244 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
245 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
246 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
247 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
248 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
249 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
250 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
251 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
252 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
253 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
254 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
255 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
256 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
257 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
258 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
259 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
260 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
261 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
262 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
263 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
264 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
265 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
266 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
267 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
273 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
278 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
279 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
280 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
283 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
284 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
285 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
286 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
287 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
288 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
289 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
290 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
291 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
292 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
293 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
294 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
295 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
296 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
297 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
298 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
299 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
300 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
301 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
302 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
303 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
304 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
305 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
306 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
307 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
308 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
309 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
310 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
311 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
312 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
313 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
314 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
315 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
316 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.99
Metatranscriptomes 0
Isolates 1.01

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.24
Nodule 0
Rhizoplane 11.94
Rhizosphere 68.35
Stem 0
Stem Tuber 0
Unclassified 1.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501032_0005009 3300049569 Bacteria 9906
2 JGI24747J21853_1002267 3300001978 Bacteria 1549
3 JGI24739J22299_10051888 3300001989 Bacteria 1321
4 JGI24739J22299_10070502 3300001989 Bacteria 1088
5 JGI24743J22301_10053223 3300001991 Bacteria 827
6 JGI24745J21846_1002455 3300002073 Bacteria 1895
7 JGI24748J21848_1004566 3300002074 Bacteria 1593
8 JGI24744J21845_10000392 3300002077 Bacteria 7529
9 JGI24744J21845_10002785 3300002077 Bacteria 3574
10 JGI24034J26672_10017063 3300002239 Bacteria 1122
11 JGI24742J22300_10000357 3300002244 Bacteria 6712
12 JGI24742J22300_10013799 3300002244 Bacteria 1354
13 JGI24751J29686_10015904 3300002459 Bacteria 1551
14 Ga0055540_1000038 3300003792 Bacteria 161988
15 Ga0070676_10403413 3300005328 Bacteria 952
16 Ga0070690_100012584 3300005330 Bacteria 4979
17 Ga0070670_100407632 3300005331 Bacteria 1201
18 Ga0068869_100005615 3300005334 Bacteria 7903
19 Ga0070666_10025644 3300005335 Bacteria 3844
20 Ga0070666_10063621 3300005335 Bacteria 2501
21 Ga0068868_100003597 3300005338 Bacteria 10801
22 Ga0068868_100033955 3300005338 Bacteria 3935
23 Ga0068868_100055810 3300005338 Bacteria 3118
24 Ga0068868_101236463 3300005338 Unclassified 692
25 Ga0070660_100522711 3300005339 Bacteria 988
26 Ga0070689_100006443 3300005340 Bacteria 8122
27 Ga0070689_100105271 3300005340 Bacteria 2237
28 Ga0070691_10023298 3300005341 Bacteria 2875
29 Ga0070687_100109073 3300005343 Bacteria 1563
30 Ga0070661_100750378 3300005344 Bacteria 798
31 Ga0070692_10085535 3300005345 Bacteria 1706
32 Ga0070668_100001040 3300005347 Bacteria 19481
33 Ga0070668_100282651 3300005347 Bacteria 1386
34 Ga0070668_100293187 3300005347 Bacteria 1362
35 Ga0070668_100850910 3300005347 Bacteria 813
36 Ga0070669_100027536 3300005353 Bacteria 4091
37 Ga0070669_100087616 3300005353 Bacteria 2328
38 Ga0070675_100048207 3300005354 Bacteria 3492
39 Ga0070671_100152323 3300005355 Bacteria 1953
40 Ga0070671_100208599 3300005355 Bacteria 1657
41 Ga0070671_100342572 3300005355 Bacteria 1275
42 Ga0070674_100001171 3300005356 Bacteria 13801
43 Ga0070674_100120575 3300005356 Bacteria 1941
44 Ga0070674_100502950 3300005356 Bacteria 1009
45 Ga0070688_100044853 3300005365 Bacteria 2729
46 Ga0070688_100161684 3300005365 Bacteria 1539
47 Ga0070659_100006651 3300005366 Bacteria 8355
48 Ga0070659_100155095 3300005366 Bacteria 1869
49 Ga0070667_100000022 3300005367 Bacteria 204861
50 Ga0070667_100007354 3300005367 Bacteria 9147
51 Ga0070667_100007578 3300005367 Bacteria 9006
52 Ga0070667_100041558 3300005367 Bacteria 3857
53 Ga0070667_100413811 3300005367 Bacteria 1228
54 Ga0070667_100416017 3300005367 Bacteria 1225
55 Ga0070709_10284596 3300005434 Bacteria 1203
56 Ga0070709_10684446 3300005434 Bacteria 797
57 Ga0070714_100301650 3300005435 Bacteria 1493
58 Ga0070713_100117910 3300005436 Bacteria 2323
59 Ga0070710_10001538 3300005437 Bacteria 10903
60 Ga0070710_10129160 3300005437 Bacteria 1539
61 Ga0070710_10129873 3300005437 Bacteria 1535
62 Ga0070710_10632362 3300005437 Bacteria 748
63 Ga0070701_10000429 3300005438 Bacteria 14337
64 Ga0070711_100001329 3300005439 Bacteria 13496
65 Ga0070711_100260163 3300005439 Bacteria 1365
66 Ga0070705_100006336 3300005440 Bacteria 5797
67 Ga0070705_100131273 3300005440 Bacteria 1634
68 Ga0070705_100460366 3300005440 Bacteria 956
69 Ga0070700_100577058 3300005441 Bacteria 877
70 Ga0070694_100293803 3300005444 Bacteria 1243
71 Ga0070694_100486815 3300005444 Bacteria 980
72 Ga0070663_100025944 3300005455 Bacteria 3962
73 Ga0070663_100053972 3300005455 Bacteria 2871
74 Ga0070678_100000249 3300005456 Bacteria 24850
75 Ga0070678_100165442 3300005456 Bacteria 1796
76 Ga0070678_100183036 3300005456 Bacteria 1717
77 Ga0070678_102348518 3300005456 Unclassified 506
78 Ga0070662_100003214 3300005457 Bacteria 10160
79 Ga0070662_100176028 3300005457 Bacteria 1684
80 Ga0068867_100001950 3300005459 Bacteria 14383
81 Ga0068867_100348788 3300005459 Bacteria 1234
82 Ga0070685_10545071 3300005466 Bacteria 827
83 Ga0070679_100269207 3300005530 Bacteria 1658
84 Ga0068853_100018838 3300005539 Bacteria 5716
85 Ga0068853_100098154 3300005539 Bacteria 2587
86 Ga0070672_100022541 3300005543 Bacteria 4628
87 Ga0070672_100036295 3300005543 Bacteria 3755
88 Ga0070686_100253400 3300005544 Bacteria 1287
89 Ga0070686_100543034 3300005544 Bacteria 908
90 Ga0070696_100011040 3300005546 Bacteria 6049
91 Ga0070693_100001788 3300005547 Bacteria 9797
92 Ga0070665_100002935 3300005548 Bacteria 18414
93 Ga0070665_100046193 3300005548 Bacteria 4375
94 Ga0070665_100076869 3300005548 Bacteria 3345
95 Ga0070665_100078988 3300005548 Bacteria 3297
96 Ga0070704_100001518 3300005549 Bacteria 12512
97 Ga0070704_100362480 3300005549 Bacteria 1226
98 Ga0068854_100006438 3300005578 Bacteria 7468
99 Ga0068854_100058712 3300005578 Bacteria 2778
100 Ga0068854_100111140 3300005578 Bacteria 2067
101 Ga0068856_100251339 3300005614 Bacteria 1783
102 Ga0070702_100001944 3300005615 Bacteria 8697
103 Ga0068852_100308162 3300005616 Bacteria 1534
104 Ga0068859_100009035 3300005617 Bacteria 10068
105 Ga0068859_100011872 3300005617 Bacteria 8751
106 Ga0068859_100175679 3300005617 Bacteria 2223
107 Ga0068859_100425843 3300005617 Bacteria 1424
108 Ga0068859_101189683 3300005617 Bacteria 839
109 Ga0068864_100115826 3300005618 Bacteria 2391
110 Ga0068864_100230376 3300005618 Bacteria 1713
111 Ga0068864_100507526 3300005618 Bacteria 1161
112 Ga0068864_100525519 3300005618 Bacteria 1141
113 Ga0068866_10006566 3300005718 Bacteria 4850
114 Ga0068866_10207816 3300005718 Bacteria 1173
115 Ga0068861_100002050 3300005719 Bacteria 13055
116 Ga0068861_100748646 3300005719 Bacteria 912
117 Ga0068861_101467069 3300005719 Unclassified 668
118 Ga0068870_10186768 3300005840 Bacteria 1248
119 Ga0068870_10907121 3300005840 Unclassified 623
120 Ga0068863_100000699 3300005841 Bacteria 33727
121 Ga0068863_100739897 3300005841 Bacteria 979
122 Ga0068863_101578928 3300005841 Bacteria 665
123 Ga0068858_100001483 3300005842 Bacteria 24155
124 Ga0068858_100118978 3300005842 Bacteria 2469
125 Ga0068858_100411936 3300005842 Bacteria 1299
126 Ga0068858_100546595 3300005842 Bacteria 1121
127 Ga0068858_100688995 3300005842 Bacteria 994
128 Ga0068860_100000038 3300005843 Bacteria 232936
129 Ga0068860_100660910 3300005843 Bacteria 1053
130 Ga0068862_100000064 3300005844 Bacteria 124473
131 Ga0068862_100002476 3300005844 Bacteria 16354
132 Ga0068862_100380473 3300005844 Bacteria 1316
133 Ga0081455_10156955 3300005937 Bacteria 1748
134 Ga0081538_10076922 3300005981 Bacteria 1800
135 Ga0070717_10609356 3300006028 Bacteria 990
136 Ga0075365_10002956 3300006038 Bacteria 8593
137 Ga0075365_10003210 3300006038 Bacteria 8360
138 Ga0075365_10099509 3300006038 Bacteria 1990
139 Ga0075365_10437339 3300006038 Bacteria 924
140 Ga0075365_10632334 3300006038 Bacteria 757
141 Ga0075368_10008461 3300006042 Bacteria 3667
142 Ga0075363_100000574 3300006048 Bacteria 12051
143 Ga0075363_100001643 3300006048 Bacteria 8632
144 Ga0075363_100002118 3300006048 Bacteria 7962
145 Ga0075363_100009732 3300006048 Bacteria 4528
146 Ga0075363_100029209 3300006048 Bacteria 2844
147 Ga0075364_10003316 3300006051 Bacteria 9133
148 Ga0075364_10007628 3300006051 Bacteria 6433
149 Ga0075364_10021954 3300006051 Bacteria 4027
150 Ga0075364_10025804 3300006051 Bacteria 3744
151 Ga0075364_10121389 3300006051 Bacteria 1749
152 Ga0075364_10121552 3300006051 Bacteria 1748
153 Ga0075364_10163548 3300006051 Bacteria 1503
154 Ga0075364_10364390 3300006051 Bacteria 985
155 Ga0075364_10693575 3300006051 Bacteria 695
156 Ga0070715_10002243 3300006163 Bacteria 5868
157 Ga0070715_10093634 3300006163 Bacteria 1388
158 Ga0070716_100042797 3300006173 Bacteria 2530
159 Ga0070716_100120862 3300006173 Bacteria 1639
160 Ga0070712_100003128 3300006175 Bacteria 10208
161 Ga0070712_100014400 3300006175 Bacteria 5075
162 Ga0075362_10015300 3300006177 Bacteria 3118
163 Ga0075362_10036339 3300006177 Bacteria 2154
164 Ga0075362_10040661 3300006177 Bacteria 2048
165 Ga0075367_10022157 3300006178 Bacteria 3559
166 Ga0075367_10091390 3300006178 Bacteria 1852
167 Ga0075367_10152348 3300006178 Bacteria 1435
168 Ga0075369_10001151 3300006186 Bacteria 8920
169 Ga0075369_10003238 3300006186 Bacteria 5912
170 Ga0075369_10025081 3300006186 Bacteria 2477
171 Ga0075369_10061079 3300006186 Bacteria 1645
172 Ga0075369_10156723 3300006186 Bacteria 1043
173 Ga0075369_10165197 3300006186 Bacteria 1015
174 Ga0097621_100367895 3300006237 Bacteria 1282
175 Ga0097621_100814729 3300006237 Bacteria 866
176 Ga0075370_10001712 3300006353 Bacteria 9748
177 Ga0075370_10155593 3300006353 Bacteria 1340
178 Ga0075370_10266013 3300006353 Bacteria 1017
179 Ga0075370_10664763 3300006353 Bacteria 633
180 Ga0075428_101302098 3300006844 Bacteria 764
181 Ga0075430_100006095 3300006846 Bacteria 10162
182 Ga0075431_100029389 3300006847 Bacteria 5658
183 Ga0068865_100005899 3300006881 Bacteria 7453
184 Ga0068865_100056766 3300006881 Bacteria 2729
185 Ga0097620_100009033 3300006931 Bacteria 10068
186 Ga0097620_100011872 3300006931 Bacteria 8751
187 Ga0097620_100175691 3300006931 Bacteria 2223
188 Ga0097620_100425867 3300006931 Bacteria 1424
189 Ga0097620_101189951 3300006931 Bacteria 839
190 Ga0105240_10995301 3300009093 Bacteria 897
191 Ga0111539_10201976 3300009094 Bacteria 2318
192 Ga0111539_11054623 3300009094 Bacteria 945
193 Ga0105245_10031033 3300009098 Bacteria 4727
194 Ga0105245_10630142 3300009098 Bacteria 1101
195 Ga0105247_10000021 3300009101 Bacteria 229443
196 Ga0105247_10001116 3300009101 Bacteria 20000
197 Ga0105247_10098319 3300009101 Bacteria 1868
198 Ga0105247_10301036 3300009101 Bacteria 1113
199 Ga0105247_10720426 3300009101 Bacteria 753
200 Ga0105247_10748241 3300009101 Bacteria 741
201 Ga0114129_10016340 3300009147 Bacteria 10565
202 Ga0105243_10001479 3300009148 Bacteria 20609
203 Ga0105243_10062498 3300009148 Bacteria 2981
204 Ga0105243_10390569 3300009148 Bacteria 1290
205 Ga0105241_10012136 3300009174 Bacteria 6325
206 Ga0105241_11778726 3300009174 Bacteria 601
207 Ga0105242_10000716 3300009176 Bacteria 25932
208 Ga0105248_10000777 3300009177 Bacteria 35858
209 Ga0105248_10003844 3300009177 Bacteria 16631
210 Ga0105248_10919884 3300009177 Bacteria 988
211 Ga0105237_10007320 3300009545 Bacteria 12101
212 Ga0105237_10493609 3300009545 Bacteria 1231
213 Ga0105237_10634241 3300009545 Bacteria 1075
214 Ga0105237_11366007 3300009545 Bacteria 715
215 Ga0105238_10156014 3300009551 Bacteria 2258
216 Ga0105249_10000334 3300009553 Bacteria 47607
217 Ga0105249_10014869 3300009553 Bacteria 6883
218 Ga0105249_10228251 3300009553 Bacteria 1835
219 Ga0105249_11223406 3300009553 Bacteria 822
220 Ga0099796_10002927 3300010159 Bacteria 3857
221 Ga0105239_10016749 3300010375 Bacteria 8102
222 Ga0105239_10018692 3300010375 Bacteria 7655
223 Ga0105239_10539240 3300010375 Bacteria 1328
224 Ga0105239_11035498 3300010375 Bacteria 944
225 Ga0105239_11178454 3300010375 Bacteria 883
226 Ga0105246_10644493 3300011119 Bacteria 921
227 Ga0157369_10096694 3300013105 Bacteria 3150
228 Ga0157369_10167310 3300013105 Bacteria 2318
229 Ga0157369_10325444 3300013105 Bacteria 1598
230 Ga0157374_10005899 3300013296 Bacteria 10345
231 Ga0157378_10010350 3300013297 Bacteria 8142
232 Ga0163162_10004707 3300013306 Bacteria 13155
233 Ga0157372_10012574 3300013307 Bacteria 9015
234 Ga0157372_11376828 3300013307 Bacteria 813
235 Ga0157372_11554428 3300013307 Bacteria 762
236 Ga0157375_10003155 3300013308 Bacteria 14308
237 Ga0163163_10005889 3300014325 Bacteria 10667
238 Ga0163163_10021699 3300014325 Bacteria 6065
239 Ga0163163_10522582 3300014325 Bacteria 1249
240 Ga0157380_10001845 3300014326 Bacteria 14012
241 Ga0157380_10079223 3300014326 Bacteria 2682
242 Ga0157377_10005606 3300014745 Bacteria 5915
243 Ga0157379_10005502 3300014968 Bacteria 10878
244 Ga0157379_10231887 3300014968 Bacteria 1673
245 Ga0157376_10020999 3300014969 Bacteria 5065
246 Ga0157376_10077318 3300014969 Bacteria 2846
247 Ga0163161_10004243 3300017792 Bacteria 9998
248 Ga0163161_10255533 3300017792 Bacteria 1367
249 Ga0163161_10611001 3300017792 Bacteria 900
250 Ga0213874_10170834 3300021377 Bacteria 769
251 Ga0213876_10032315 3300021384 Bacteria 2761
252 Ga0213875_10024916 3300021388 Bacteria 2852
253 Ga0209051_1000014 3300025303 Bacteria 552732
254 Ga0209051_1000237 3300025303 Bacteria 92688
255 Ga0209051_1005429 3300025303 Bacteria 7453
256 Ga0209051_1007553 3300025303 Bacteria 5923
257 Ga0209051_1065031 3300025303 Bacteria 1127
258 Ga0207692_10000980 3300025898 Bacteria 10401
259 Ga0207692_10444805 3300025898 Bacteria 815
260 Ga0207642_10000477 3300025899 Bacteria 12300
261 Ga0207642_10142258 3300025899 Bacteria 1266
262 Ga0207710_10000027 3300025900 Bacteria 307001
263 Ga0207710_10003368 3300025900 Bacteria 7142
264 Ga0207710_10043591 3300025900 Bacteria 1996
265 Ga0207688_10000806 3300025901 Bacteria 15696
266 Ga0207688_10004448 3300025901 Bacteria 7631
267 Ga0207680_10027051 3300025903 Bacteria 3188
268 Ga0207680_10048543 3300025903 Bacteria 2523
269 Ga0207647_10014156 3300025904 Bacteria 5507
270 Ga0207647_10148309 3300025904 Bacteria 1372
271 Ga0207647_10359112 3300025904 Bacteria 824
272 Ga0207685_10192052 3300025905 Bacteria 954
273 Ga0207699_10134046 3300025906 Bacteria 1620
274 Ga0207699_10384492 3300025906 Bacteria 997
275 Ga0207645_10044796 3300025907 Bacteria 2830
276 Ga0207643_10065460 3300025908 Bacteria 2082
277 Ga0207654_10260681 3300025911 Bacteria 1165
278 Ga0207671_10003326 3300025914 Bacteria 16155
279 Ga0207671_10060073 3300025914 Bacteria 2820
280 Ga0207693_10001596 3300025915 Bacteria 20037
281 Ga0207693_10001850 3300025915 Bacteria 18537
282 Ga0207663_10001880 3300025916 Bacteria 9930
283 Ga0207663_10045099 3300025916 Bacteria 2710
284 Ga0207662_10137699 3300025918 Bacteria 1544
285 Ga0207662_11330446 3300025918 Bacteria 510
286 Ga0207657_10052760 3300025919 Bacteria 3528
287 Ga0207681_10001503 3300025923 Bacteria 15042
288 Ga0207681_10078244 3300025923 Bacteria 2327
289 Ga0207681_10359835 3300025923 Bacteria 1167
290 Ga0207694_10086326 3300025924 Bacteria 2471
291 Ga0207687_10000558 3300025927 Bacteria 25102
292 Ga0207687_10061677 3300025927 Bacteria 2649
293 Ga0207664_10196838 3300025929 Bacteria 1738
294 Ga0207664_10364514 3300025929 Bacteria 1281
295 Ga0207664_10715291 3300025929 Bacteria 901
296 Ga0207644_10028638 3300025931 Bacteria 3859
297 Ga0207644_10062582 3300025931 Bacteria 2699
298 Ga0207644_10079606 3300025931 Bacteria 2418
299 Ga0207690_10054069 3300025932 Bacteria 2697
300 Ga0207690_10089696 3300025932 Bacteria 2168
301 Ga0207706_10007171 3300025933 Bacteria 10311
302 Ga0207706_10018400 3300025933 Bacteria 6287
303 Ga0207686_10011184 3300025934 Bacteria 4907
304 Ga0207686_10318975 3300025934 Bacteria 1160
305 Ga0207709_10224939 3300025935 Bacteria 1356
306 Ga0207670_10005772 3300025936 Bacteria 6832
307 Ga0207670_10437713 3300025936 Bacteria 1052
308 Ga0207670_11176932 3300025936 Bacteria 648
309 Ga0207669_10000804 3300025937 Bacteria 13449
310 Ga0207669_10314839 3300025937 Bacteria 1195
311 Ga0207704_10001518 3300025938 Bacteria 10405
312 Ga0207704_10117590 3300025938 Bacteria 1811
313 Ga0207665_10004003 3300025939 Bacteria 9846
314 Ga0207665_10007144 3300025939 Bacteria 7391
315 Ga0207691_10041718 3300025940 Bacteria 4235
316 Ga0207691_10058165 3300025940 Bacteria 3517
317 Ga0207711_10001437 3300025941 Bacteria 22270
318 Ga0207711_10020901 3300025941 Bacteria 5464
319 Ga0207711_10449202 3300025941 Bacteria 1200
320 Ga0207689_10031701 3300025942 Bacteria 4398
321 Ga0207667_10048360 3300025949 Bacteria 4497
322 Ga0207651_10170737 3300025960 Bacteria 1715
323 Ga0207712_10000282 3300025961 Bacteria 48535
324 Ga0207712_10006857 3300025961 Bacteria 7191
325 Ga0207712_10219552 3300025961 Bacteria 1519
326 Ga0207668_10001037 3300025972 Bacteria 16585
327 Ga0207668_10067268 3300025972 Bacteria 2543
328 Ga0207668_10080077 3300025972 Bacteria 2365
329 Ga0207668_10891743 3300025972 Bacteria 791
330 Ga0207668_11598459 3300025972 Bacteria 588
331 Ga0207640_10002389 3300025981 Bacteria 10042
332 Ga0207658_10002883 3300025986 Bacteria 12326
333 Ga0207658_10004966 3300025986 Bacteria 9168
334 Ga0207658_10006963 3300025986 Bacteria 7698
335 Ga0207658_10025217 3300025986 Bacteria 4162
336 Ga0207658_10260456 3300025986 Bacteria 1478
337 Ga0207677_10029869 3300026023 Bacteria 3471
338 Ga0207677_10337801 3300026023 Bacteria 1257
339 Ga0207677_10792128 3300026023 Unclassified 848
340 Ga0207703_10008778 3300026035 Bacteria 7970
341 Ga0207703_10051498 3300026035 Bacteria 3337
342 Ga0207703_10064786 3300026035 Bacteria 3001
343 Ga0207703_10193670 3300026035 Bacteria 1802
344 Ga0207703_10454272 3300026035 Bacteria 1197
345 Ga0207639_10003450 3300026041 Bacteria 10640
346 Ga0207639_10014266 3300026041 Bacteria 5582
347 Ga0207678_10017557 3300026067 Bacteria 6285
348 Ga0207678_10020872 3300026067 Bacteria 5741
349 Ga0207708_10033650 3300026075 Bacteria 3895
350 Ga0207708_10455651 3300026075 Bacteria 1066
351 Ga0207702_11987940 3300026078 Bacteria 572
352 Ga0207641_10002033 3300026088 Bacteria 19266
353 Ga0207641_10096815 3300026088 Bacteria 2592
354 Ga0207641_10864171 3300026088 Bacteria 897
355 Ga0207648_10003301 3300026089 Bacteria 16944
356 Ga0207648_10020590 3300026089 Bacteria 5938
357 Ga0207648_11502408 3300026089 Unclassified 633
358 Ga0207676_10302481 3300026095 Bacteria 1461
359 Ga0207676_10486783 3300026095 Bacteria 1169
360 Ga0207676_10550443 3300026095 Bacteria 1102
361 Ga0207675_100001865 3300026118 Bacteria 21103
362 Ga0207675_100037018 3300026118 Bacteria 4552
363 Ga0207675_101501195 3300026118 Bacteria 695
364 Ga0207675_102011481 3300026118 Bacteria 595
365 Ga0207683_10001241 3300026121 Bacteria 23130
366 Ga0207683_10045963 3300026121 Bacteria 3819
367 Ga0207683_10383612 3300026121 Bacteria 1292
368 Ga0207698_10084086 3300026142 Bacteria 2578
369 Ga0207698_10164537 3300026142 Bacteria 1945
370 Ga0209813_10116154 3300027866 Bacteria 927
371 Ga0207428_10777165 3300027907 Bacteria 681
372 Ga0268266_10018132 3300028379 Bacteria 6000
373 Ga0268266_10061296 3300028379 Bacteria 3244
374 Ga0268266_10082195 3300028379 Bacteria 2809
375 Ga0268266_10399532 3300028379 Bacteria 1299
376 Ga0268265_10000028 3300028380 Bacteria 236467
377 Ga0268265_10008592 3300028380 Bacteria 6903
378 Ga0268265_10161112 3300028380 Bacteria 1906
379 Ga0268265_10207027 3300028380 Bacteria 1706
380 Ga0268264_10000092 3300028381 Bacteria 232950
381 Ga0268264_10010947 3300028381 Bacteria 7492
382 Ga0268264_10222874 3300028381 Bacteria 1737
383 Ga0265327_10000230 3300031251 Bacteria 113245
384 Ga0307413_10186255 3300031824 Bacteria 1486
385 Ga0307413_10238047 3300031824 Bacteria 1342
386 Ga0307413_10902178 3300031824 Bacteria 751
387 Ga0307406_10425588 3300031901 Bacteria 1059
388 Ga0307407_10317501 3300031903 Bacteria 1092
389 Ga0307416_100248011 3300032002 Bacteria 1731
390 Ga0307416_100474382 3300032002 Bacteria 1310
391 Ga0307416_100535763 3300032002 Bacteria 1242
392 Ga0307416_101248349 3300032002 Bacteria 849
393 Ga0307414_10297407 3300032004 Bacteria 1364
394 Ga0307415_101824932 3300032126 Bacteria 589
395 Ga0373961_0066029 3300035241 Bacteria 1109
396 Ga0373931_0044108 3300035691 Bacteria 2351
397 Ga0373931_0045644 3300035691 Bacteria 2315
398 Ga0316584_0020298 3300036712 Bacteria 4815
399 Ga0436364_0849829 3300037853 Bacteria 6172
400 Ga0436365_0217155 3300039437 Bacteria 41866
401 Ga0436365_0410802 3300039437 Bacteria 48863
402 Ga0436365_1081282 3300039437 Bacteria 3265
403 Ga0436360_1274458 3300039438 Bacteria 743
404 Ga0436363_0784449 3300039450 Bacteria 4282
405 Ga0436362_0550820 3300039453 Bacteria 609
406 Ga0439461_0003839 3300041410 Bacteria 2487
407 Ga0439461_0005637 3300041410 Bacteria 2143
408 Ga0439466_0005104 3300041411 Bacteria 5033
409 Ga0439466_0052240 3300041411 Bacteria 1336
410 Ga0439466_0057297 3300041411 Bacteria 1262
411 Ga0439465_0030190 3300041413 Bacteria 1723
412 Ga0439465_0030858 3300041413 Bacteria 1706
413 Ga0439465_0114405 3300041413 Bacteria 941
414 Ga0451793_0545667 3300041452 Bacteria 1724
415 Ga0451793_1271377 3300041452 Bacteria 1065
416 Ga0451795_0321590 3300041456 Bacteria 622
417 Ga0451802_1381128 3300041460 Bacteria 914
418 Ga0451841_0623550 3300041498 Bacteria 826
419 Ga0439431_0002870 3300041997 Bacteria 3792
420 Ga0439442_024957 3300042002 Bacteria 1244
421 Ga0439445_0004747 3300042004 Bacteria 3080
422 Ga0439445_0024864 3300042004 Bacteria 1525
423 Ga0439448_0011454 3300042005 Bacteria 2644
424 Ga0439448_0136257 3300042005 Bacteria 848
425 Ga0439459_0150913 3300042438 Bacteria 607
426 Ga0466969_0362733 3300044656 Bacteria 656
427 Ga0466972_0006444 3300044658 Bacteria 5896
428 Ga0466972_0032027 3300044658 Bacteria 2583
429 Ga0466972_0061771 3300044658 Bacteria 1796
430 Ga0466972_0357974 3300044658 Bacteria 683
431 Ga0466965_0000314 3300044683 Bacteria 16254
432 Ga0466965_0002169 3300044683 Bacteria 8254
433 Ga0466965_0011702 3300044683 Bacteria 4116
434 Ga0466965_0039291 3300044683 Bacteria 2326
435 Ga0466966_0097709 3300044684 Bacteria 1818
436 Ga0466961_0007122 3300044693 Bacteria 7115
437 Ga0466963_0071037 3300044694 Bacteria 2342
438 Ga0466971_0005516 3300044719 Bacteria 5495
439 Ga0466971_0016838 3300044719 Bacteria 3230
440 Ga0466971_0456743 3300044719 Bacteria 627
441 Ga0466968_0039691 3300044735 Bacteria 1982
442 Ga0466968_0056715 3300044735 Bacteria 1683
443 Ga0466968_0419552 3300044735 Bacteria 658
444 Ga0466970_0044911 3300044765 Bacteria 2352
445 Ga0466970_0147327 3300044765 Bacteria 1299
446 Ga0466970_0228488 3300044765 Bacteria 1039
447 Ga0466957_0017690 3300044842 Bacteria 4179
448 Ga0466957_0019591 3300044842 Bacteria 3980
449 Ga0466957_0022614 3300044842 Bacteria 3711
450 Ga0466960_0000191 3300044901 Bacteria 21132
451 Ga0466960_0008545 3300044901 Bacteria 4195
452 Ga0466960_0020949 3300044901 Bacteria 2904
453 Ga0466959_0213389 3300045049 Bacteria 1340
454 Ga0466958_0019745 3300045836 Bacteria 3923
455 Ga0466958_0827538 3300045836 Bacteria 604
456 Ga0466967_0060367 3300045976 Bacteria 3360
457 Ga0466967_0061315 3300045976 Bacteria 3336
458 Ga0466967_0109739 3300045976 Bacteria 2533
459 Ga0466967_0223288 3300045976 Bacteria 1791
460 Ga0466967_0231212 3300045976 Bacteria 1761
461 Ga0466967_0624976 3300045976 Bacteria 1064
462 Ga0466967_1496289 3300045976 Bacteria 672
463 Ga0466967_1622089 3300045976 Bacteria 644
464 Ga0466967_2557607 3300045976 Bacteria 505
465 Ga0495603_0036816 3300046455 Bacteria 2937
466 Ga0495638_0001564 3300046460 Bacteria 20515
467 Ga0495641_0155809 3300046461 Bacteria 1021
468 Ga0495582_0101284 3300046473 Bacteria 1613
469 Ga0495605_0201271 3300046474 Bacteria 868
470 Ga0495662_0264692 3300046476 Bacteria 846
471 Ga0495606_0187901 3300046507 Bacteria 1186
472 Ga0495616_0317507 3300046513 Bacteria 655
473 Ga0495628_1195758 3300046516 Bacteria 516
474 Ga0495630_0307900 3300046517 Bacteria 1211
475 Ga0495666_0241362 3300046526 Bacteria 824
476 Ga0495665_0502748 3300046531 Bacteria 610
477 Ga0495640_0066828 3300046533 Bacteria 2424
478 Ga0495586_0113210 3300046535 Bacteria 1511
479 Ga0495668_0136015 3300046616 Bacteria 1345
480 Ga0495635_0928327 3300046663 Bacteria 556
481 Ga0495599_0156287 3300046678 Bacteria 1411
482 Ga0495658_0211760 3300046683 Bacteria 1211
483 Ga0495624_0188452 3300046690 Bacteria 1255
484 Ga0495649_0030872 3300046694 Bacteria 2957
485 Ga0495581_0202115 3300047315 Bacteria 1162
486 Ga0495672_0043689 3300047320 Bacteria 2693
487 Ga0495672_0070446 3300047320 Bacteria 1981
488 Ga0495676_0234776 3300047321 Bacteria 1258
489 Ga0495686_0002683 3300047472 Bacteria 16376
490 Ga0495593_0059970 3300047673 Bacteria 1992
491 Ga0495626_0077751 3300048091 Bacteria 1479
492 Ga0496100_0000082 3300048903 Bacteria 53775
493 Ga0496100_0000497 3300048903 Bacteria 18899
494 Ga0496100_0012288 3300048903 Bacteria 4904
495 Ga0496100_0039831 3300048903 Bacteria 2986
496 Ga0496100_0048012 3300048903 Bacteria 2754
497 Ga0496100_0053171 3300048903 Bacteria 2636
498 Ga0496100_1147603 3300048903 Bacteria 613
499 Ga0496101_0000021 3300048904 Bacteria 217090
500 Ga0496101_0000034 3300048904 Bacteria 178045
501 Ga0496101_0000620 3300048904 Bacteria 21636
502 Ga0496101_0002260 3300048904 Bacteria 11763
503 Ga0496101_0171871 3300048904 Bacteria 1666
504 Ga0496101_0339841 3300048904 Bacteria 1179
505 Ga0496102_0000001 3300048905 Bacteria 873433
506 Ga0496102_0000458 3300048905 Bacteria 45701
507 Ga0496102_0001932 3300048905 Bacteria 17845
508 Ga0496102_0007532 3300048905 Bacteria 9306
509 Ga0496102_0011281 3300048905 Bacteria 7700
510 Ga0496102_0047421 3300048905 Bacteria 3904
511 Ga0496103_0000007 3300048906 Bacteria 354915
512 Ga0496103_0001469 3300048906 Bacteria 15776
513 Ga0496103_0001790 3300048906 Bacteria 14025
514 Ga0496103_0002472 3300048906 Bacteria 11602
515 Ga0496103_0018682 3300048906 Bacteria 4159
516 Ga0496103_0047727 3300048906 Bacteria 2646
517 Ga0496103_0098402 3300048906 Bacteria 1850
518 Ga0496104_0039873 3300048907 Bacteria 4399
519 Ga0496104_0074114 3300048907 Bacteria 3240
520 Ga0496104_0132156 3300048907 Bacteria 2398
521 Ga0496105_0010816 3300048908 Bacteria 7187
522 Ga0496105_0077871 3300048908 Bacteria 2738
523 Ga0496105_0113284 3300048908 Bacteria 2238
524 Ga0496105_0149256 3300048908 Bacteria 1922
525 Ga0496105_0466569 3300048908 Bacteria 995
526 Ga0496106_0000606 3300048909 Bacteria 25606
527 Ga0496106_0006964 3300048909 Bacteria 8358
528 Ga0496106_0007821 3300048909 Bacteria 7910
529 Ga0496106_0029022 3300048909 Bacteria 4122
530 Ga0496106_0049514 3300048909 Bacteria 3165
531 Ga0496106_1019295 3300048909 Bacteria 650
532 Ga0496107_0000091 3300048910 Bacteria 43490
533 Ga0496107_0000705 3300048910 Bacteria 19056
534 Ga0496107_0037962 3300048910 Bacteria 3457
535 Ga0496107_0055524 3300048910 Bacteria 2860
536 Ga0496107_0358985 3300048910 Bacteria 1084
537 Ga0496108_0000457 3300048911 Bacteria 32650
538 Ga0496108_0015378 3300048911 Bacteria 6241
539 Ga0496108_0069007 3300048911 Bacteria 2983
540 Ga0496108_0458800 3300048911 Bacteria 1113
541 Ga0496108_0468125 3300048911 Bacteria 1101
542 Ga0496109_0000838 3300048912 Bacteria 25672
543 Ga0496109_0012402 3300048912 Bacteria 7359
544 Ga0496109_0057622 3300048912 Bacteria 3547
545 Ga0496109_0140850 3300048912 Bacteria 2255
546 Ga0496109_0804297 3300048912 Bacteria 878
547 Ga0496110_0003596 3300048913 Bacteria 11918
548 Ga0496110_0126051 3300048913 Bacteria 2310
549 Ga0496110_1209165 3300048913 Bacteria 665
550 Ga0496111_0041796 3300048914 Bacteria 3291
551 Ga0496111_0088112 3300048914 Bacteria 2273
552 Ga0496111_0254781 3300048914 Bacteria 1302
553 Ga0496111_0652450 3300048914 Bacteria 768
554 Ga0496112_0007663 3300048915 Bacteria 9603
555 Ga0496112_0040115 3300048915 Bacteria 4577
556 Ga0496112_0726612 3300048915 Bacteria 920
557 Ga0496112_0801021 3300048915 Bacteria 867
558 Ga0496112_1863809 3300048915 Bacteria 513
559 Ga0496113_0144465 3300048916 Bacteria 1873
560 Ga0496113_0354205 3300048916 Bacteria 1178
561 Ga0496113_0381493 3300048916 Bacteria 1131
562 Ga0496114_0000123 3300048917 Bacteria 56062
563 Ga0496114_0000175 3300048917 Bacteria 45344
564 Ga0496114_0003876 3300048917 Bacteria 11530
565 Ga0496114_0184554 3300048917 Bacteria 1823
566 Ga0496114_0267162 3300048917 Bacteria 1507
567 Ga0496114_1048557 3300048917 Bacteria 699
568 Ga0496115_0003557 3300048918 Bacteria 11211
569 Ga0496115_0108459 3300048918 Bacteria 2279
570 Ga0496115_0332115 3300048918 Bacteria 1242
571 Ga0496116_0000018 3300048919 Bacteria 545877
572 Ga0496116_0000955 3300048919 Bacteria 35639
573 Ga0496116_0006424 3300048919 Bacteria 10657
574 Ga0496117_0000015 3300048920 Bacteria 583316
575 Ga0496117_0002163 3300048920 Bacteria 25620
576 Ga0496117_0063513 3300048920 Bacteria 2523
577 Ga0496118_0000012 3300048921 Bacteria 583316
578 Ga0496118_0004676 3300048921 Bacteria 16044
579 Ga0496118_0017515 3300048921 Bacteria 6515
580 Ga0496119_0000412 3300048922 Bacteria 58722
581 Ga0496119_0003659 3300048922 Bacteria 15786
582 Ga0496119_0059923 3300048922 Bacteria 2282
583 Ga0496119_0509943 3300048922 Bacteria 558
584 Ga0496120_0001076 3300048923 Bacteria 35962
585 Ga0496120_0004060 3300048923 Bacteria 12680
586 Ga0496121_0000048 3300048924 Bacteria 330242
587 Ga0496121_0000177 3300048924 Bacteria 141456
588 Ga0496121_0072071 3300048924 Bacteria 2774
589 Ga0496122_0000234 3300048925 Bacteria 125042
590 Ga0496122_0083734 3300048925 Bacteria 2210
591 Ga0496123_0019023 3300048926 Bacteria 5426
592 Ga0496123_0023999 3300048926 Bacteria 4651
593 Ga0496124_0000044 3300048927 Bacteria 289064
594 Ga0496124_0036850 3300048927 Bacteria 4259
595 Ga0496124_0833581 3300048927 Unclassified 567
596 Ga0496125_0000037 3300048928 Bacteria 330242
597 Ga0496125_0030362 3300048928 Bacteria 4836
598 Ga0496126_0000046 3300048929 Bacteria 330242
599 Ga0496126_0000954 3300048929 Bacteria 49569
600 Ga0496126_0352913 3300048929 Bacteria 1202
601 Ga0501032_0003249 3300049569 Bacteria 12501
602 Ga0501032_0035746 3300049569 Bacteria 3395
603 Ga0501033_0164245 3300049570 Bacteria 1597
604 Ga0501034_0001916 3300049571 Bacteria 26328
605 Ga0501034_0128836 3300049571 Bacteria 2514
606 Ga0501034_0161402 3300049571 Bacteria 2212
607 Ga0501034_0244894 3300049571 Bacteria 1738
608 Ga0501036_0120882 3300049572 Bacteria 2212
609 Ga0501037_0001695 3300049573 Bacteria 15989
610 Ga0501037_0119593 3300049573 Bacteria 1895
611 Ga0501037_0173970 3300049573 Bacteria 1529
612 Ga0501038_0021264 3300049574 Bacteria 5825
613 Ga0501039_0000820 3300049575 Bacteria 22383
614 Ga0501040_0287850 3300049576 Bacteria 1174
615 Ga0501043_0001927 3300049579 Bacteria 17763
616 Ga0501043_0937910 3300049579 Bacteria 619
617 Ga0501043_1219699 3300049579 Bacteria 527
618 Ga0501046_0001059 3300049580 Bacteria 26939
619 Ga0501047_0065743 3300049581 Bacteria 3495
620 Ga0501047_0160227 3300049581 Bacteria 2122
621 Ga0501048_0001266 3300049582 Bacteria 19121
622 Ga0501070_0003494 3300049586 Bacteria 13621
623 Ga0501070_0011888 3300049586 Bacteria 7351
624 Ga0501080_0185499 3300049742 Bacteria 1913
625 Ga0501035_0000542 3300049822 Bacteria 41925
626 Ga0501035_0010624 3300049822 Bacteria 8525
627 Ga0501044_0000153 3300049823 Bacteria 85673
628 Ga0501044_0003155 3300049823 Bacteria 18643
629 Ga0501044_0037478 3300049823 Bacteria 5068
630 Ga0501044_0312160 3300049823 Bacteria 1499
631 Ga0501045_0370066 3300049824 Bacteria 1067
632 nmdc:mga03683_15574_c1 3300050489 Bacteria 2840
633 nmdc:mga03683_241211_c1 3300050489 Bacteria 838
634 nmdc:mga03683_24599_c1 3300050489 Bacteria 2357
635 nmdc:mga03683_66629_c1 3300050489 Bacteria 1531
636 nmdc:mga03n38_101875_c1 3300050490 Bacteria 1386
637 nmdc:mga03n38_117411_c1 3300050490 Bacteria 1303
638 nmdc:mga03n38_176781_c1 3300050490 Bacteria 1091
639 nmdc:mga03n38_22346_c1 3300050490 Bacteria 2559
640 nmdc:mga03n38_850_c1 3300050490 Bacteria 8176
641 nmdc:mga00v17_132285_c1 3300050491 Bacteria 1595
642 nmdc:mga00v17_22039_c1 3300050491 Bacteria 3672
643 nmdc:mga00v17_331221_c1 3300050491 Bacteria 989
644 nmdc:mga00v17_44374_c1 3300050491 Bacteria 2681
645 nmdc:mga00v17_62559_c1 3300050491 Bacteria 2290
646 nmdc:mga00v17_74703_c1 3300050491 Bacteria 2107
647 nmdc:mga0yw44_179929_c1 3300050492 Bacteria 1391
648 nmdc:mga0yw44_218849_c1 3300050492 Bacteria 1261
649 nmdc:mga0yw44_310892_c1 3300050492 Bacteria 1057
650 nmdc:mga0yw44_3865_c1 3300050492 Bacteria 6741
651 nmdc:mga0yw44_418402_c1 3300050492 Bacteria 907
652 nmdc:mga0yw44_4734_c2 3300050492 Bacteria 4900
653 nmdc:mga0yw44_64411_c1 3300050492 Bacteria 2256
654 nmdc:mga0yw44_746298_c1 3300050492 Bacteria 665
655 nmdc:mga06z11_22640_c1 3300050494 Bacteria 2938
656 nmdc:mga06z11_34954_c1 3300050494 Bacteria 2470
657 nmdc:mga06z11_55774_c1 3300050494 Bacteria 2041
658 nmdc:mga04h51_15493_c1 3300050495 Bacteria 2197
659 nmdc:mga07m45_248852_c1 3300050496 Bacteria 1034
660 nmdc:mga07m45_2847_c1 3300050496 Bacteria 4287
661 nmdc:mga07m45_30208_c1 3300050496 Bacteria 3000
662 nmdc:mga07m45_32185_c1 3300050496 Bacteria 2909
663 nmdc:mga07m45_55066_c1 3300050496 Bacteria 2248
664 nmdc:mga05p37_24345_c1 3300050507 Bacteria 7356
665 nmdc:mga09592_249797_c1 3300050508 Bacteria 1537
666 nmdc:mga0qj67_17183_c1 3300050509 Bacteria 5497
667 nmdc:mga06r32_19701_c1 3300050510 Bacteria 6198
668 nmdc:mga08y16_485925_c1 3300050511 Bacteria 1256
669 nmdc:mga0n895_1211992_c1 3300050512 Bacteria 728
670 nmdc:mga0sz30_103434_c2 3300050516 Bacteria 823
671 nmdc:mga0sz30_123015_c1 3300050516 Bacteria 1141
672 nmdc:mga0sz30_125950_c1 3300050516 Bacteria 1127
673 nmdc:mga0sz30_24750_c1 3300050516 Bacteria 2451
674 nmdc:mga0sz30_4861_c1 3300050516 Bacteria 4892
675 nmdc:mga0sz30_7720_c1 3300050516 Bacteria 4040
676 Ga0500610_0001906 3300053079 Bacteria 7410
677 Ga0500643_003426 3300053087 Bacteria 7644
678 Ga0500556_0012120 3300053104 Bacteria 2567
679 Ga0500562_002791 3300053108 Bacteria 4348
680 Ga0500642_0061793 3300053130 Bacteria 1684
681 Ga0500652_000098 3300053131 Bacteria 34947
682 Ga0500561_0152882 3300053137 Bacteria 718
683 Ga0500604_0014306 3300053151 Bacteria 2160
684 Ga0500616_0018877 3300053153 Bacteria 3895
685 Ga0500620_244889 3300053155 Bacteria 598
686 Ga0500627_0070801 3300053158 Bacteria 1545
687 Ga0501082_0896612 3300060353 Bacteria 776
688 Ga0466962_0577334 3300061719 Bacteria 572
689 2644488225 2643221687 Bacteria 6500351
690 2644636847 2643221715 Bacteria 6671032
691 2902795140 2902792274 Bacteria 7270173
692 2902811536 2902810491 Bacteria 6794147
693 2902841314 2902837492 Bacteria 6697721
694 2929218555 2929212328 Bacteria 7708288
695 2939583102 2939582691 Bacteria 7088898
696 Ga0501032_0005009
697 JGI24747J21853_1002267
698 JGI24739J22299_10051888
699 JGI24739J22299_10070502
700 JGI24743J22301_10053223
701 JGI24745J21846_1002455
702 JGI24748J21848_1004566
703 JGI24744J21845_10000392
704 JGI24744J21845_10002785
705 JGI24034J26672_10017063
706 JGI24742J22300_10000357
707 JGI24742J22300_10013799
708 JGI24751J29686_10015904
709 Ga0055540_1000038
710 Ga0070676_10403413
711 Ga0070690_100012584
712 Ga0070670_100407632
713 Ga0068869_100005615
714 Ga0070666_10025644
715 Ga0070666_10063621
716 Ga0068868_100003597
717 Ga0068868_100033955
718 Ga0068868_100055810
719 Ga0068868_101236463
720 Ga0070660_100522711
721 Ga0070689_100006443
722 Ga0070689_100105271
723 Ga0070691_10023298
724 Ga0070687_100109073
725 Ga0070661_100750378
726 Ga0070692_10085535
727 Ga0070668_100001040
728 Ga0070668_100282651
729 Ga0070668_100293187
730 Ga0070668_100850910
731 Ga0070669_100027536
732 Ga0070669_100087616
733 Ga0070675_100048207
734 Ga0070671_100152323
735 Ga0070671_100208599
736 Ga0070671_100342572
737 Ga0070674_100001171
738 Ga0070674_100120575
739 Ga0070674_100502950
740 Ga0070688_100044853
741 Ga0070688_100161684
742 Ga0070659_100006651
743 Ga0070659_100155095
744 Ga0070667_100000022
745 Ga0070667_100007354
746 Ga0070667_100007578
747 Ga0070667_100041558
748 Ga0070667_100413811
749 Ga0070667_100416017
750 Ga0070709_10284596
751 Ga0070709_10684446
752 Ga0070714_100301650
753 Ga0070713_100117910
754 Ga0070710_10001538
755 Ga0070710_10129160
756 Ga0070710_10129873
757 Ga0070710_10632362
758 Ga0070701_10000429
759 Ga0070711_100001329
760 Ga0070711_100260163
761 Ga0070705_100006336
762 Ga0070705_100131273
763 Ga0070705_100460366
764 Ga0070700_100577058
765 Ga0070694_100293803
766 Ga0070694_100486815
767 Ga0070663_100025944
768 Ga0070663_100053972
769 Ga0070678_100000249
770 Ga0070678_100165442
771 Ga0070678_100183036
772 Ga0070678_102348518
773 Ga0070662_100003214
774 Ga0070662_100176028
775 Ga0068867_100001950
776 Ga0068867_100348788
777 Ga0070685_10545071
778 Ga0070679_100269207
779 Ga0068853_100018838
780 Ga0068853_100098154
781 Ga0070672_100022541
782 Ga0070672_100036295
783 Ga0070686_100253400
784 Ga0070686_100543034
785 Ga0070696_100011040
786 Ga0070693_100001788
787 Ga0070665_100002935
788 Ga0070665_100046193
789 Ga0070665_100076869
790 Ga0070665_100078988
791 Ga0070704_100001518
792 Ga0070704_100362480
793 Ga0068854_100006438
794 Ga0068854_100058712
795 Ga0068854_100111140
796 Ga0068856_100251339
797 Ga0070702_100001944
798 Ga0068852_100308162
799 Ga0068859_100009035
800 Ga0068859_100011872
801 Ga0068859_100175679
802 Ga0068859_100425843
803 Ga0068859_101189683
804 Ga0068864_100115826
805 Ga0068864_100230376
806 Ga0068864_100507526
807 Ga0068864_100525519
808 Ga0068866_10006566
809 Ga0068866_10207816
810 Ga0068861_100002050
811 Ga0068861_100748646
812 Ga0068861_101467069
813 Ga0068870_10186768
814 Ga0068870_10907121
815 Ga0068863_100000699
816 Ga0068863_100739897
817 Ga0068863_101578928
818 Ga0068858_100001483
819 Ga0068858_100118978
820 Ga0068858_100411936
821 Ga0068858_100546595
822 Ga0068858_100688995
823 Ga0068860_100000038
824 Ga0068860_100660910
825 Ga0068862_100000064
826 Ga0068862_100002476
827 Ga0068862_100380473
828 Ga0081455_10156955
829 Ga0081538_10076922
830 Ga0070717_10609356
831 Ga0075365_10002956
832 Ga0075365_10003210
833 Ga0075365_10099509
834 Ga0075365_10437339
835 Ga0075365_10632334
836 Ga0075368_10008461
837 Ga0075363_100000574
838 Ga0075363_100001643
839 Ga0075363_100002118
840 Ga0075363_100009732
841 Ga0075363_100029209
842 Ga0075364_10003316
843 Ga0075364_10007628
844 Ga0075364_10021954
845 Ga0075364_10025804
846 Ga0075364_10121389
847 Ga0075364_10121552
848 Ga0075364_10163548
849 Ga0075364_10364390
850 Ga0075364_10693575
851 Ga0070715_10002243
852 Ga0070715_10093634
853 Ga0070716_100042797
854 Ga0070716_100120862
855 Ga0070712_100003128
856 Ga0070712_100014400
857 Ga0075362_10015300
858 Ga0075362_10036339
859 Ga0075362_10040661
860 Ga0075367_10022157
861 Ga0075367_10091390
862 Ga0075367_10152348
863 Ga0075369_10001151
864 Ga0075369_10003238
865 Ga0075369_10025081
866 Ga0075369_10061079
867 Ga0075369_10156723
868 Ga0075369_10165197
869 Ga0097621_100367895
870 Ga0097621_100814729
871 Ga0075370_10001712
872 Ga0075370_10155593
873 Ga0075370_10266013
874 Ga0075370_10664763
875 Ga0075428_101302098
876 Ga0075430_100006095
877 Ga0075431_100029389
878 Ga0068865_100005899
879 Ga0068865_100056766
880 Ga0097620_100009033
881 Ga0097620_100011872
882 Ga0097620_100175691
883 Ga0097620_100425867
884 Ga0097620_101189951
885 Ga0105240_10995301
886 Ga0111539_10201976
887 Ga0111539_11054623
888 Ga0105245_10031033
889 Ga0105245_10630142
890 Ga0105247_10000021
891 Ga0105247_10001116
892 Ga0105247_10098319
893 Ga0105247_10301036
894 Ga0105247_10720426
895 Ga0105247_10748241
896 Ga0114129_10016340
897 Ga0105243_10001479
898 Ga0105243_10062498
899 Ga0105243_10390569
900 Ga0105241_10012136
901 Ga0105241_11778726
902 Ga0105242_10000716
903 Ga0105248_10000777
904 Ga0105248_10003844
905 Ga0105248_10919884
906 Ga0105237_10007320
907 Ga0105237_10493609
908 Ga0105237_10634241
909 Ga0105237_11366007
910 Ga0105238_10156014
911 Ga0105249_10000334
912 Ga0105249_10014869
913 Ga0105249_10228251
914 Ga0105249_11223406
915 Ga0099796_10002927
916 Ga0105239_10016749
917 Ga0105239_10018692
918 Ga0105239_10539240
919 Ga0105239_11035498
920 Ga0105239_11178454
921 Ga0105246_10644493
922 Ga0157369_10096694
923 Ga0157369_10167310
924 Ga0157369_10325444
925 Ga0157374_10005899
926 Ga0157378_10010350
927 Ga0163162_10004707
928 Ga0157372_10012574
929 Ga0157372_11376828
930 Ga0157372_11554428
931 Ga0157375_10003155
932 Ga0163163_10005889
933 Ga0163163_10021699
934 Ga0163163_10522582
935 Ga0157380_10001845
936 Ga0157380_10079223
937 Ga0157377_10005606
938 Ga0157379_10005502
939 Ga0157379_10231887
940 Ga0157376_10020999
941 Ga0157376_10077318
942 Ga0163161_10004243
943 Ga0163161_10255533
944 Ga0163161_10611001
945 Ga0213874_10170834
946 Ga0213876_10032315
947 Ga0213875_10024916
948 Ga0209051_1000014
949 Ga0209051_1000237
950 Ga0209051_1005429
951 Ga0209051_1007553
952 Ga0209051_1065031
953 Ga0207692_10000980
954 Ga0207692_10444805
955 Ga0207642_10000477
956 Ga0207642_10142258
957 Ga0207710_10000027
958 Ga0207710_10003368
959 Ga0207710_10043591
960 Ga0207688_10000806
961 Ga0207688_10004448
962 Ga0207680_10027051
963 Ga0207680_10048543
964 Ga0207647_10014156
965 Ga0207647_10148309
966 Ga0207647_10359112
967 Ga0207685_10192052
968 Ga0207699_10134046
969 Ga0207699_10384492
970 Ga0207645_10044796
971 Ga0207643_10065460
972 Ga0207654_10260681
973 Ga0207671_10003326
974 Ga0207671_10060073
975 Ga0207693_10001596
976 Ga0207693_10001850
977 Ga0207663_10001880
978 Ga0207663_10045099
979 Ga0207662_10137699
980 Ga0207662_11330446
981 Ga0207657_10052760
982 Ga0207681_10001503
983 Ga0207681_10078244
984 Ga0207681_10359835
985 Ga0207694_10086326
986 Ga0207687_10000558
987 Ga0207687_10061677
988 Ga0207664_10196838
989 Ga0207664_10364514
990 Ga0207664_10715291
991 Ga0207644_10028638
992 Ga0207644_10062582
993 Ga0207644_10079606
994 Ga0207690_10054069
995 Ga0207690_10089696
996 Ga0207706_10007171
997 Ga0207706_10018400
998 Ga0207686_10011184
999 Ga0207686_10318975
1000 Ga0207709_10224939
1001 Ga0207670_10005772
1002 Ga0207670_10437713
1003 Ga0207670_11176932
1004 Ga0207669_10000804
1005 Ga0207669_10314839
1006 Ga0207704_10001518
1007 Ga0207704_10117590
1008 Ga0207665_10004003
1009 Ga0207665_10007144
1010 Ga0207691_10041718
1011 Ga0207691_10058165
1012 Ga0207711_10001437
1013 Ga0207711_10020901
1014 Ga0207711_10449202
1015 Ga0207689_10031701
1016 Ga0207667_10048360
1017 Ga0207651_10170737
1018 Ga0207712_10000282
1019 Ga0207712_10006857
1020 Ga0207712_10219552
1021 Ga0207668_10001037
1022 Ga0207668_10067268
1023 Ga0207668_10080077
1024 Ga0207668_10891743
1025 Ga0207668_11598459
1026 Ga0207640_10002389
1027 Ga0207658_10002883
1028 Ga0207658_10004966
1029 Ga0207658_10006963
1030 Ga0207658_10025217
1031 Ga0207658_10260456
1032 Ga0207677_10029869
1033 Ga0207677_10337801
1034 Ga0207677_10792128
1035 Ga0207703_10008778
1036 Ga0207703_10051498
1037 Ga0207703_10064786
1038 Ga0207703_10193670
1039 Ga0207703_10454272
1040 Ga0207639_10003450
1041 Ga0207639_10014266
1042 Ga0207678_10017557
1043 Ga0207678_10020872
1044 Ga0207708_10033650
1045 Ga0207708_10455651
1046 Ga0207702_11987940
1047 Ga0207641_10002033
1048 Ga0207641_10096815
1049 Ga0207641_10864171
1050 Ga0207648_10003301
1051 Ga0207648_10020590
1052 Ga0207648_11502408
1053 Ga0207676_10302481
1054 Ga0207676_10486783
1055 Ga0207676_10550443
1056 Ga0207675_100001865
1057 Ga0207675_100037018
1058 Ga0207675_101501195
1059 Ga0207675_102011481
1060 Ga0207683_10001241
1061 Ga0207683_10045963
1062 Ga0207683_10383612
1063 Ga0207698_10084086
1064 Ga0207698_10164537
1065 Ga0209813_10116154
1066 Ga0207428_10777165
1067 Ga0268266_10018132
1068 Ga0268266_10061296
1069 Ga0268266_10082195
1070 Ga0268266_10399532
1071 Ga0268265_10000028
1072 Ga0268265_10008592
1073 Ga0268265_10161112
1074 Ga0268265_10207027
1075 Ga0268264_10000092
1076 Ga0268264_10010947
1077 Ga0268264_10222874
1078 Ga0265327_10000230
1079 Ga0307413_10186255
1080 Ga0307413_10238047
1081 Ga0307413_10902178
1082 Ga0307406_10425588
1083 Ga0307407_10317501
1084 Ga0307416_100248011
1085 Ga0307416_100474382
1086 Ga0307416_100535763
1087 Ga0307416_101248349
1088 Ga0307414_10297407
1089 Ga0307415_101824932
1090 Ga0373961_0066029
1091 Ga0373931_0044108
1092 Ga0373931_0045644
1093 Ga0316584_0020298
1094 Ga0436364_0849829
1095 Ga0436365_0217155
1096 Ga0436365_0410802
1097 Ga0436365_1081282
1098 Ga0436360_1274458
1099 Ga0436363_0784449
1100 Ga0436362_0550820
1101 Ga0439461_0003839
1102 Ga0439461_0005637
1103 Ga0439466_0005104
1104 Ga0439466_0052240
1105 Ga0439466_0057297
1106 Ga0439465_0030190
1107 Ga0439465_0030858
1108 Ga0439465_0114405
1109 Ga0451793_0545667
1110 Ga0451793_1271377
1111 Ga0451795_0321590
1112 Ga0451802_1381128
1113 Ga0451841_0623550
1114 Ga0439431_0002870
1115 Ga0439442_024957
1116 Ga0439445_0004747
1117 Ga0439445_0024864
1118 Ga0439448_0011454
1119 Ga0439448_0136257
1120 Ga0439459_0150913
1121 Ga0466969_0362733
1122 Ga0466972_0006444
1123 Ga0466972_0032027
1124 Ga0466972_0061771
1125 Ga0466972_0357974
1126 Ga0466965_0000314
1127 Ga0466965_0002169
1128 Ga0466965_0011702
1129 Ga0466965_0039291
1130 Ga0466966_0097709
1131 Ga0466961_0007122
1132 Ga0466963_0071037
1133 Ga0466971_0005516
1134 Ga0466971_0016838
1135 Ga0466971_0456743
1136 Ga0466968_0039691
1137 Ga0466968_0056715
1138 Ga0466968_0419552
1139 Ga0466970_0044911
1140 Ga0466970_0147327
1141 Ga0466970_0228488
1142 Ga0466957_0017690
1143 Ga0466957_0019591
1144 Ga0466957_0022614
1145 Ga0466960_0000191
1146 Ga0466960_0008545
1147 Ga0466960_0020949
1148 Ga0466959_0213389
1149 Ga0466958_0019745
1150 Ga0466958_0827538
1151 Ga0466967_0060367
1152 Ga0466967_0061315
1153 Ga0466967_0109739
1154 Ga0466967_0223288
1155 Ga0466967_0231212
1156 Ga0466967_0624976
1157 Ga0466967_1496289
1158 Ga0466967_1622089
1159 Ga0466967_2557607
1160 Ga0495603_0036816
1161 Ga0495638_0001564
1162 Ga0495641_0155809
1163 Ga0495582_0101284
1164 Ga0495605_0201271
1165 Ga0495662_0264692
1166 Ga0495606_0187901
1167 Ga0495616_0317507
1168 Ga0495628_1195758
1169 Ga0495630_0307900
1170 Ga0495666_0241362
1171 Ga0495665_0502748
1172 Ga0495640_0066828
1173 Ga0495586_0113210
1174 Ga0495668_0136015
1175 Ga0495635_0928327
1176 Ga0495599_0156287
1177 Ga0495658_0211760
1178 Ga0495624_0188452
1179 Ga0495649_0030872
1180 Ga0495581_0202115
1181 Ga0495672_0043689
1182 Ga0495672_0070446
1183 Ga0495676_0234776
1184 Ga0495686_0002683
1185 Ga0495593_0059970
1186 Ga0495626_0077751
1187 Ga0496100_0000082
1188 Ga0496100_0000497
1189 Ga0496100_0012288
1190 Ga0496100_0039831
1191 Ga0496100_0048012
1192 Ga0496100_0053171
1193 Ga0496100_1147603
1194 Ga0496101_0000021
1195 Ga0496101_0000034
1196 Ga0496101_0000620
1197 Ga0496101_0002260
1198 Ga0496101_0171871
1199 Ga0496101_0339841
1200 Ga0496102_0000001
1201 Ga0496102_0000458
1202 Ga0496102_0001932
1203 Ga0496102_0007532
1204 Ga0496102_0011281
1205 Ga0496102_0047421
1206 Ga0496103_0000007
1207 Ga0496103_0001469
1208 Ga0496103_0001790
1209 Ga0496103_0002472
1210 Ga0496103_0018682
1211 Ga0496103_0047727
1212 Ga0496103_0098402
1213 Ga0496104_0039873
1214 Ga0496104_0074114
1215 Ga0496104_0132156
1216 Ga0496105_0010816
1217 Ga0496105_0077871
1218 Ga0496105_0113284
1219 Ga0496105_0149256
1220 Ga0496105_0466569
1221 Ga0496106_0000606
1222 Ga0496106_0006964
1223 Ga0496106_0007821
1224 Ga0496106_0029022
1225 Ga0496106_0049514
1226 Ga0496106_1019295
1227 Ga0496107_0000091
1228 Ga0496107_0000705
1229 Ga0496107_0037962
1230 Ga0496107_0055524
1231 Ga0496107_0358985
1232 Ga0496108_0000457
1233 Ga0496108_0015378
1234 Ga0496108_0069007
1235 Ga0496108_0458800
1236 Ga0496108_0468125
1237 Ga0496109_0000838
1238 Ga0496109_0012402
1239 Ga0496109_0057622
1240 Ga0496109_0140850
1241 Ga0496109_0804297
1242 Ga0496110_0003596
1243 Ga0496110_0126051
1244 Ga0496110_1209165
1245 Ga0496111_0041796
1246 Ga0496111_0088112
1247 Ga0496111_0254781
1248 Ga0496111_0652450
1249 Ga0496112_0007663
1250 Ga0496112_0040115
1251 Ga0496112_0726612
1252 Ga0496112_0801021
1253 Ga0496112_1863809
1254 Ga0496113_0144465
1255 Ga0496113_0354205
1256 Ga0496113_0381493
1257 Ga0496114_0000123
1258 Ga0496114_0000175
1259 Ga0496114_0003876
1260 Ga0496114_0184554
1261 Ga0496114_0267162
1262 Ga0496114_1048557
1263 Ga0496115_0003557
1264 Ga0496115_0108459
1265 Ga0496115_0332115
1266 Ga0496116_0000018
1267 Ga0496116_0000955
1268 Ga0496116_0006424
1269 Ga0496117_0000015
1270 Ga0496117_0002163
1271 Ga0496117_0063513
1272 Ga0496118_0000012
1273 Ga0496118_0004676
1274 Ga0496118_0017515
1275 Ga0496119_0000412
1276 Ga0496119_0003659
1277 Ga0496119_0059923
1278 Ga0496119_0509943
1279 Ga0496120_0001076
1280 Ga0496120_0004060
1281 Ga0496121_0000048
1282 Ga0496121_0000177
1283 Ga0496121_0072071
1284 Ga0496122_0000234
1285 Ga0496122_0083734
1286 Ga0496123_0019023
1287 Ga0496123_0023999
1288 Ga0496124_0000044
1289 Ga0496124_0036850
1290 Ga0496124_0833581
1291 Ga0496125_0000037
1292 Ga0496125_0030362
1293 Ga0496126_0000046
1294 Ga0496126_0000954
1295 Ga0496126_0352913
1296 Ga0501032_0003249
1297 Ga0501032_0035746
1298 Ga0501033_0164245
1299 Ga0501034_0001916
1300 Ga0501034_0128836
1301 Ga0501034_0161402
1302 Ga0501034_0244894
1303 Ga0501036_0120882
1304 Ga0501037_0001695
1305 Ga0501037_0119593
1306 Ga0501037_0173970
1307 Ga0501038_0021264
1308 Ga0501039_0000820
1309 Ga0501040_0287850
1310 Ga0501043_0001927
1311 Ga0501043_0937910
1312 Ga0501043_1219699
1313 Ga0501046_0001059
1314 Ga0501047_0065743
1315 Ga0501047_0160227
1316 Ga0501048_0001266
1317 Ga0501070_0003494
1318 Ga0501070_0011888
1319 Ga0501080_0185499
1320 Ga0501035_0000542
1321 Ga0501035_0010624
1322 Ga0501044_0000153
1323 Ga0501044_0003155
1324 Ga0501044_0037478
1325 Ga0501044_0312160
1326 Ga0501045_0370066
1327 nmdc:mga03683_15574_c1
1328 nmdc:mga03683_241211_c1
1329 nmdc:mga03683_24599_c1
1330 nmdc:mga03683_66629_c1
1331 nmdc:mga03n38_101875_c1
1332 nmdc:mga03n38_117411_c1
1333 nmdc:mga03n38_176781_c1
1334 nmdc:mga03n38_22346_c1
1335 nmdc:mga03n38_850_c1
1336 nmdc:mga00v17_132285_c1
1337 nmdc:mga00v17_22039_c1
1338 nmdc:mga00v17_331221_c1
1339 nmdc:mga00v17_44374_c1
1340 nmdc:mga00v17_62559_c1
1341 nmdc:mga00v17_74703_c1
1342 nmdc:mga0yw44_179929_c1
1343 nmdc:mga0yw44_218849_c1
1344 nmdc:mga0yw44_310892_c1
1345 nmdc:mga0yw44_3865_c1
1346 nmdc:mga0yw44_418402_c1
1347 nmdc:mga0yw44_4734_c2
1348 nmdc:mga0yw44_64411_c1
1349 nmdc:mga0yw44_746298_c1
1350 nmdc:mga06z11_22640_c1
1351 nmdc:mga06z11_34954_c1
1352 nmdc:mga06z11_55774_c1
1353 nmdc:mga04h51_15493_c1
1354 nmdc:mga07m45_248852_c1
1355 nmdc:mga07m45_2847_c1
1356 nmdc:mga07m45_30208_c1
1357 nmdc:mga07m45_32185_c1
1358 nmdc:mga07m45_55066_c1
1359 nmdc:mga05p37_24345_c1
1360 nmdc:mga09592_249797_c1
1361 nmdc:mga0qj67_17183_c1
1362 nmdc:mga06r32_19701_c1
1363 nmdc:mga08y16_485925_c1
1364 nmdc:mga0n895_1211992_c1
1365 nmdc:mga0sz30_103434_c2
1366 nmdc:mga0sz30_123015_c1
1367 nmdc:mga0sz30_125950_c1
1368 nmdc:mga0sz30_24750_c1
1369 nmdc:mga0sz30_4861_c1
1370 nmdc:mga0sz30_7720_c1
1371 Ga0500610_0001906
1372 Ga0500643_003426
1373 Ga0500556_0012120
1374 Ga0500562_002791
1375 Ga0500642_0061793
1376 Ga0500652_000098
1377 Ga0500561_0152882
1378 Ga0500604_0014306
1379 Ga0500616_0018877
1380 Ga0500620_244889
1381 Ga0500627_0070801
1382 Ga0501082_0896612
1383 Ga0466962_0577334
1384 2644488225
1385 2644636847
1386 2902795140
1387 2902811536
1388 2902841314
1389 2929218555
1390 2939583102

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12802

MarR_2

MarR family

37

96

0.99

PF01047

MarR

MarR family

39

96

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4kmf-assembly1.cif.gz_A-2 crystal structure of zalpha domain from carassius auratus pkz in complex with z-dna 0.9536 37 98
4lb5-assembly1.cif.gz_A-2 crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.941 37 98
4ija-assembly1.cif.gz_B structure of s. aureus methicillin resistance factor mecr2 0.9331 37 97
2ia0-assembly1.cif.gz_A transcriptional regulatory protein pf0864 from pyrococcus furiosus a member of the asnc family (pf0864) 0.9316 35 79
5duk-assembly1.cif.gz_A n-terminal structure of putative dna binding transcription factor from thermoplasmatales archaeon scgc ab-539-n05 0.9294 37 88
ID Description Score Start End Superfamily
af_P0ACK8_1_59_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9697 39 99 1.10.10.10
af_P30852_292_361_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.965 51 84 1.10.10.10
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.959 35 96 1.10.10.10
3tgnA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9574 35 82 1.10.10.10
af_P15082_1_58_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9546 37 84 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A0H5RV74-F1-model_v4 MarR family transcriptional regulator 0.9769 4 147 GO:0003700
GO:0006950
AF-A0A5N0E822-F1-model_v4 MarR family transcriptional regulator 0.9734 3 147 GO:0003700
GO:0006950
AF-A0A1G7I541-F1-model_v4 deleted 0.9733 4 150
AF-A0A2T2YSH6-F1-model_v4 MarR family transcriptional regulator 0.9721 15 147 GO:0003700
GO:0006950
AF-A0A1X1TJR4-F1-model_v4 MarR family transcriptional regulator 0.962 2 150 GO:0003700
GO:0006950

Map