F475701

General Info

Members Datasets Scaffolds Average Seq Length
694 321 680 182

Family's Representative Sequence

Representative Sequence 3300005335|Ga0070666_10095521|Ga0070666_100955212
Length 213
Sequence MRPCLQFSSGGINRTTVRLRRARIFQTTEGNVKVSDIKVIVLLGSLRATSINRQLAELAVEAAPEGVSLQLFDRLGELPFYNEDIDNDDVDEPVVALRAAAAEADAALVVTPEYNGSIPGVLKNAIDWLSRPFGNGALKDKPLAVVGAAAGQYGGVWAHDETRKSFGIAGPRVVEDLKLSVPAKSLDGKHPRANAEVAANLRDIVGKLAAEVA

Samples

Sample ID Description Type Environment
1 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
2 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
3 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
4 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
5 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
6 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
7 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
8 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
9 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
10 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
11 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
12 2919051321 Sinomonas atrocyanea 1003 Isolate Rhizosphere
13 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
14 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
15 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
16 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
17 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
18 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
22 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
29 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
30 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
31 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
37 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
41 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
42 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
43 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
44 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
45 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
46 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
47 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
48 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
49 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
50 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
51 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
52 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
53 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
54 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
55 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
56 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
57 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
58 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
76 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
77 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
78 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
79 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
80 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
81 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
82 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
83 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
84 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
85 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
86 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
87 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
88 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
90 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
91 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
92 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
93 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
94 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
96 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
97 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
99 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
100 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
102 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
103 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
104 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
105 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
106 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
107 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
108 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
109 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
110 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
111 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
112 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
113 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
114 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
115 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
116 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
117 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
118 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
119 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
120 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
121 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
122 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
123 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
124 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
180 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
181 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
182 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
183 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
184 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
185 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
186 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
187 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
188 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
189 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
190 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
191 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
192 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
193 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
194 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
195 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
196 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
197 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
198 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
199 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
200 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
201 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
202 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
203 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
204 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
205 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
206 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
207 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
208 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
209 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
210 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
211 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
212 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
213 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
214 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
215 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
216 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
217 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
218 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
219 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
220 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
221 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
222 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
223 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
224 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
225 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
226 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
227 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
228 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
229 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
230 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
231 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
232 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
233 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
234 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
235 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
236 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
237 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
238 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
239 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
240 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
241 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
242 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
243 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
244 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
245 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
246 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
247 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
248 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
249 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
250 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
251 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
252 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
253 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
254 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
255 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
256 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
257 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
258 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
259 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
260 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
261 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
262 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
263 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
264 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
265 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
266 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
267 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
268 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
269 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
270 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
273 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
275 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
278 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
284 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
285 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
286 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
287 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
288 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
289 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
291 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
292 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
293 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
294 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
295 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
296 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
297 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
298 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
299 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
300 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
301 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
302 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
303 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
304 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
305 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
306 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
307 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
308 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
309 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
310 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
311 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
312 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
313 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
314 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
315 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
316 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
317 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
318 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
319 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
320 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
321 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.98
Metatranscriptomes 0
Isolates 2.02

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.27
Nodule 0.14
Rhizoplane 10.52
Rhizosphere 66.71
Stem 0
Stem Tuber 0
Unclassified 8.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24738J21930_10037639 3300002075 Bacteria 983
2 JGI24751J29686_10004847 3300002459 Bacteria 2738
3 rootH2_10074387 3300003320 Bacteria 1896
4 Ga0055540_1000003 3300003792 Bacteria 428375
5 Ga0055540_1000261 3300003792 Bacteria 47645
6 Ga0055540_1002350 3300003792 Bacteria 10121
7 Ga0055540_1005458 3300003792 Bacteria 5337
8 Ga0070676_10216317 3300005328 Bacteria 1263
9 Ga0070683_100102323 3300005329 Bacteria 2698
10 Ga0070690_100100480 3300005330 Bacteria 1917
11 Ga0070677_10059707 3300005333 Bacteria 1569
12 Ga0068869_100081214 3300005334 Bacteria 2420
13 Ga0070666_10095521 3300005335 Bacteria 2045
14 Ga0070682_100033517 3300005337 Bacteria 3121
15 Ga0068868_100077317 3300005338 Bacteria 2662
16 Ga0068868_100112144 3300005338 Bacteria 2217
17 Ga0070660_100210292 3300005339 Bacteria 1579
18 Ga0070689_100239280 3300005340 Bacteria 1494
19 Ga0070691_10008199 3300005341 Bacteria 4785
20 Ga0070691_10094527 3300005341 Bacteria 1478
21 Ga0070687_100062901 3300005343 Bacteria 1966
22 Ga0070692_10079201 3300005345 Bacteria 1766
23 Ga0070692_10091668 3300005345 Bacteria 1653
24 Ga0070668_100003544 3300005347 Bacteria 11512
25 Ga0070668_100073839 3300005347 Bacteria 2659
26 Ga0070668_100102202 3300005347 Bacteria 2272
27 Ga0070668_100148285 3300005347 Bacteria 1895
28 Ga0070669_100013949 3300005353 Bacteria 5715
29 Ga0070669_100048093 3300005353 Bacteria 3112
30 Ga0070675_100459877 3300005354 Bacteria 1142
31 Ga0070671_100006991 3300005355 Bacteria 9041
32 Ga0070671_100603192 3300005355 Bacteria 949
33 Ga0070674_100948979 3300005356 Bacteria 752
34 Ga0070688_100100436 3300005365 Bacteria 1907
35 Ga0070659_100105672 3300005366 Bacteria 2269
36 Ga0070667_100000087 3300005367 Bacteria 114528
37 Ga0070667_100001120 3300005367 Bacteria 24450
38 Ga0070667_100051541 3300005367 Bacteria 3470
39 Ga0070667_100161513 3300005367 Bacteria 1974
40 Ga0070667_100201490 3300005367 Bacteria 1766
41 Ga0070667_100324141 3300005367 Bacteria 1390
42 Ga0070667_100953488 3300005367 Bacteria 800
43 Ga0070703_10137064 3300005406 Bacteria 905
44 Ga0070709_10031344 3300005434 Bacteria 3197
45 Ga0070714_100055620 3300005435 Bacteria 3382
46 Ga0070714_100193485 3300005435 Bacteria 1857
47 Ga0070714_100203481 3300005435 Bacteria 1812
48 Ga0070714_100818078 3300005435 Bacteria 903
49 Ga0070713_100158980 3300005436 Bacteria 2016
50 Ga0070713_100164711 3300005436 Bacteria 1982
51 Ga0070710_10000360 3300005437 Bacteria 21408
52 Ga0070710_10002406 3300005437 Bacteria 8862
53 Ga0070701_10005732 3300005438 Bacteria 5162
54 Ga0070711_100000487 3300005439 Bacteria 20650
55 Ga0070711_100438613 3300005439 Bacteria 1067
56 Ga0070705_100009225 3300005440 Bacteria 4901
57 Ga0070705_100033171 3300005440 Bacteria 2875
58 Ga0070700_100001945 3300005441 Bacteria 10472
59 Ga0070700_100315949 3300005441 Bacteria 1146
60 Ga0070694_100041160 3300005444 Bacteria 3081
61 Ga0070663_100006881 3300005455 Bacteria 6882
62 Ga0070663_100049030 3300005455 Bacteria 2997
63 Ga0070663_100154605 3300005455 Bacteria 1762
64 Ga0070663_100273321 3300005455 Bacteria 1344
65 Ga0070663_100401737 3300005455 Bacteria 1120
66 Ga0070663_101270761 3300005455 Bacteria 649
67 Ga0070678_100000111 3300005456 Bacteria 31946
68 Ga0070678_100025788 3300005456 Bacteria 3962
69 Ga0070678_100196399 3300005456 Bacteria 1662
70 Ga0070662_100012627 3300005457 Bacteria 5605
71 Ga0070662_101157120 3300005457 Bacteria 664
72 Ga0068867_100004844 3300005459 Bacteria 9467
73 Ga0070685_10563589 3300005466 Bacteria 815
74 Ga0070684_100111816 3300005535 Bacteria 2450
75 Ga0068853_100125562 3300005539 Bacteria 2292
76 Ga0068853_100300457 3300005539 Bacteria 1484
77 Ga0070672_100071222 3300005543 Bacteria 2765
78 Ga0070672_100276474 3300005543 Bacteria 1419
79 Ga0070696_100001142 3300005546 Bacteria 17223
80 Ga0070696_100078905 3300005546 Bacteria 2328
81 Ga0070665_100002727 3300005548 Bacteria 19143
82 Ga0070665_100193633 3300005548 Bacteria 2034
83 Ga0070665_100746029 3300005548 Bacteria 992
84 Ga0070704_100002785 3300005549 Bacteria 9892
85 Ga0068855_100462303 3300005563 Bacteria 1384
86 Ga0068854_100000417 3300005578 Bacteria 26634
87 Ga0068854_100239364 3300005578 Bacteria 1444
88 Ga0068854_101051561 3300005578 Bacteria 723
89 Ga0068856_100114896 3300005614 Bacteria 2691
90 Ga0068856_100422971 3300005614 Bacteria 1352
91 Ga0070702_100006249 3300005615 Bacteria 5624
92 Ga0068852_100038965 3300005616 Bacteria 3998
93 Ga0068852_100237036 3300005616 Bacteria 1742
94 Ga0068859_100015088 3300005617 Bacteria 7756
95 Ga0068859_100130496 3300005617 Bacteria 2584
96 Ga0068864_100259422 3300005618 Bacteria 1616
97 Ga0068864_100289109 3300005618 Bacteria 1532
98 Ga0068866_10000413 3300005718 Bacteria 19893
99 Ga0068861_100000439 3300005719 Bacteria 24161
100 Ga0068861_100305119 3300005719 Bacteria 1380
101 Ga0068870_10191400 3300005840 Bacteria 1234
102 Ga0068863_100004572 3300005841 Bacteria 13647
103 Ga0068863_100027777 3300005841 Bacteria 5400
104 Ga0068863_100592385 3300005841 Bacteria 1097
105 Ga0068863_100650849 3300005841 Bacteria 1045
106 Ga0068858_100002903 3300005842 Bacteria 17243
107 Ga0068858_100094598 3300005842 Bacteria 2783
108 Ga0068858_100120360 3300005842 Bacteria 2455
109 Ga0068858_100260083 3300005842 Bacteria 1650
110 Ga0068860_100000020 3300005843 Bacteria 283324
111 Ga0068860_100195540 3300005843 Bacteria 1958
112 Ga0068860_100283737 3300005843 Bacteria 1619
113 Ga0068862_100000013 3300005844 Bacteria 263115
114 Ga0068862_100002547 3300005844 Bacteria 16115
115 Ga0068862_100132570 3300005844 Bacteria 2205
116 Ga0068862_100326463 3300005844 Bacteria 1418
117 Ga0081455_10012114 3300005937 Bacteria 8620
118 Ga0081455_10043344 3300005937 Bacteria 3936
119 Ga0081538_10013922 3300005981 Bacteria 6336
120 Ga0070717_10584541 3300006028 Bacteria 1013
121 Ga0075365_10025176 3300006038 Bacteria 3765
122 Ga0075365_10037749 3300006038 Bacteria 3137
123 Ga0075365_10044029 3300006038 Bacteria 2923
124 Ga0075365_10398594 3300006038 Bacteria 971
125 Ga0075368_10141345 3300006042 Bacteria 1003
126 Ga0075368_10247730 3300006042 Bacteria 761
127 Ga0075363_100005983 3300006048 Bacteria 5485
128 Ga0075363_100020694 3300006048 Bacteria 3303
129 Ga0075363_100098663 3300006048 Bacteria 1615
130 Ga0075363_100151689 3300006048 Bacteria 1308
131 Ga0075363_100155383 3300006048 Bacteria 1293
132 Ga0075363_100157736 3300006048 Bacteria 1284
133 Ga0075364_10005435 3300006051 Bacteria 7404
134 Ga0075364_10022446 3300006051 Bacteria 3985
135 Ga0075364_10024033 3300006051 Bacteria 3865
136 Ga0075364_10051701 3300006051 Bacteria 2684
137 Ga0075364_10059885 3300006051 Bacteria 2496
138 Ga0075364_10060750 3300006051 Bacteria 2478
139 Ga0075364_10065124 3300006051 Bacteria 2392
140 Ga0075364_10082366 3300006051 Bacteria 2129
141 Ga0075364_10493790 3300006051 Bacteria 837
142 Ga0075364_10522846 3300006051 Bacteria 811
143 Ga0075364_10586724 3300006051 Bacteria 761
144 Ga0070715_10000371 3300006163 Bacteria 11267
145 Ga0070716_100001209 3300006173 Bacteria 11367
146 Ga0070716_100002231 3300006173 Bacteria 8928
147 Ga0070716_100575793 3300006173 Bacteria 843
148 Ga0070712_100000301 3300006175 Bacteria 27855
149 Ga0070712_100005808 3300006175 Bacteria 7631
150 Ga0070712_100255619 3300006175 Bacteria 1402
151 Ga0075362_10028235 3300006177 Bacteria 2408
152 Ga0075362_10175234 3300006177 Bacteria 1037
153 Ga0075367_10001573 3300006178 Bacteria 9884
154 Ga0075367_10110801 3300006178 Bacteria 1685
155 Ga0075369_10004625 3300006186 Bacteria 5103
156 Ga0075369_10010862 3300006186 Bacteria 3569
157 Ga0075369_10012871 3300006186 Bacteria 3309
158 Ga0075369_10014385 3300006186 Bacteria 3160
159 Ga0075369_10016929 3300006186 Bacteria 2949
160 Ga0075369_10350998 3300006186 Bacteria 692
161 Ga0075369_10353427 3300006186 Bacteria 690
162 Ga0097621_100237672 3300006237 Bacteria 1592
163 Ga0075370_10009954 3300006353 Bacteria 4954
164 Ga0075370_10013914 3300006353 Bacteria 4283
165 Ga0075370_10098507 3300006353 Bacteria 1691
166 Ga0068871_100007901 3300006358 Bacteria 7627
167 Ga0075428_100069394 3300006844 Bacteria 3853
168 Ga0075428_101171832 3300006844 Bacteria 810
169 Ga0075430_100042525 3300006846 Bacteria 3842
170 Ga0075430_100119887 3300006846 Bacteria 2193
171 Ga0068865_100015576 3300006881 Bacteria 4850
172 Ga0068865_100040668 3300006881 Bacteria 3161
173 Ga0097620_100015089 3300006931 Bacteria 7756
174 Ga0097620_100130482 3300006931 Bacteria 2584
175 Ga0105250_10106293 3300009092 Bacteria 1148
176 Ga0105240_10277901 3300009093 Bacteria 1925
177 Ga0111539_10445761 3300009094 Bacteria 1507
178 Ga0105245_10007624 3300009098 Bacteria 9478
179 Ga0105245_10072810 3300009098 Bacteria 3122
180 Ga0105245_11483380 3300009098 Bacteria 729
181 Ga0105247_10000009 3300009101 Bacteria 385991
182 Ga0105247_10002522 3300009101 Bacteria 12435
183 Ga0105247_10103953 3300009101 Bacteria 1819
184 Ga0105247_10167702 3300009101 Bacteria 1458
185 Ga0105247_10237874 3300009101 Bacteria 1239
186 Ga0114129_10572881 3300009147 Bacteria 1466
187 Ga0114129_10608468 3300009147 Bacteria 1415
188 Ga0105243_10004430 3300009148 Bacteria 11106
189 Ga0105243_10605431 3300009148 Bacteria 1055
190 Ga0105243_10858959 3300009148 Bacteria 899
191 Ga0105242_10000106 3300009176 Bacteria 59999
192 Ga0105242_10030963 3300009176 Bacteria 4272
193 Ga0105242_10383816 3300009176 Bacteria 1307
194 Ga0105248_10000197 3300009177 Bacteria 70131
195 Ga0105248_10010396 3300009177 Bacteria 10249
196 Ga0105248_10035396 3300009177 Bacteria 5585
197 Ga0105248_10219646 3300009177 Bacteria 2140
198 Ga0105248_10912345 3300009177 Bacteria 992
199 Ga0105237_10003454 3300009545 Bacteria 18762
200 Ga0105238_10597014 3300009551 Bacteria 1112
201 Ga0105249_10000057 3300009553 Bacteria 159358
202 Ga0105249_10002095 3300009553 Bacteria 17303
203 Ga0105249_10031693 3300009553 Bacteria 4781
204 Ga0105249_10127933 3300009553 Bacteria 2421
205 Ga0105239_10003754 3300010375 Bacteria 18490
206 Ga0105239_10012567 3300010375 Bacteria 9425
207 Ga0105239_10032634 3300010375 Bacteria 5722
208 Ga0105239_10187726 3300010375 Bacteria 2313
209 Ga0105239_10752564 3300010375 Bacteria 1115
210 Ga0105239_10850862 3300010375 Bacteria 1046
211 Ga0105239_11461098 3300010375 Bacteria 790
212 Ga0105246_10220404 3300011119 Bacteria 1487
213 Ga0157373_10321734 3300013100 Bacteria 1100
214 Ga0157369_10048427 3300013105 Bacteria 4612
215 Ga0157369_10187107 3300013105 Bacteria 2177
216 Ga0157369_11748908 3300013105 Bacteria 632
217 Ga0157374_10132991 3300013296 Bacteria 2409
218 Ga0157378_10023502 3300013297 Bacteria 5423
219 Ga0157378_10232927 3300013297 Bacteria 1756
220 Ga0163162_10056300 3300013306 Bacteria 3961
221 Ga0163162_10078408 3300013306 Bacteria 3369
222 Ga0163162_10431718 3300013306 Bacteria 1449
223 Ga0157372_10021676 3300013307 Bacteria 6945
224 Ga0157375_10093213 3300013308 Bacteria 3077
225 Ga0157375_10305259 3300013308 Bacteria 1755
226 Ga0157375_10799292 3300013308 Bacteria 1092
227 Ga0163163_10035394 3300014325 Bacteria 4843
228 Ga0163163_10312656 3300014325 Bacteria 1624
229 Ga0163163_10677977 3300014325 Bacteria 1094
230 Ga0157380_10000450 3300014326 Bacteria 25111
231 Ga0182008_10307940 3300014497 Bacteria 830
232 Ga0157379_10012525 3300014968 Bacteria 7407
233 Ga0157379_10215053 3300014968 Bacteria 1741
234 Ga0157379_10605115 3300014968 Bacteria 1023
235 Ga0157379_10637313 3300014968 Bacteria 997
236 Ga0157376_10080507 3300014969 Bacteria 2794
237 Ga0157376_10314972 3300014969 Bacteria 1486
238 Ga0163161_10000992 3300017792 Bacteria 21679
239 Ga0163161_10178942 3300017792 Bacteria 1625
240 Ga0213876_10012776 3300021384 Bacteria 4463
241 Ga0213876_10014315 3300021384 Bacteria 4205
242 Ga0213876_10467669 3300021384 Bacteria 671
243 Ga0213875_10012599 3300021388 Bacteria 4168
244 Ga0213875_10259009 3300021388 Bacteria 821
245 Ga0209051_1000011 3300025303 Bacteria 610828
246 Ga0209051_1000659 3300025303 Bacteria 38923
247 Ga0209051_1001255 3300025303 Bacteria 22688
248 Ga0209051_1002943 3300025303 Bacteria 11629
249 Ga0209051_1022605 3300025303 Bacteria 2643
250 Ga0209051_1049106 3300025303 Bacteria 1424
251 Ga0207696_1067320 3300025711 Bacteria 999
252 Ga0207653_10055209 3300025885 Bacteria 1330
253 Ga0207692_10038315 3300025898 Bacteria 2350
254 Ga0207642_10005614 3300025899 Bacteria 4107
255 Ga0207710_10000014 3300025900 Bacteria 408072
256 Ga0207710_10015701 3300025900 Bacteria 3203
257 Ga0207688_10000522 3300025901 Bacteria 18610
258 Ga0207688_10010982 3300025901 Bacteria 4927
259 Ga0207647_10058117 3300025904 Bacteria 2369
260 Ga0207685_10007577 3300025905 Bacteria 3034
261 Ga0207685_10009797 3300025905 Bacteria 2799
262 Ga0207699_10176429 3300025906 Bacteria 1433
263 Ga0207645_10008738 3300025907 Bacteria 7053
264 Ga0207643_10104713 3300025908 Bacteria 1662
265 Ga0207695_10201798 3300025913 Bacteria 1902
266 Ga0207671_10016098 3300025914 Bacteria 5826
267 Ga0207671_10158470 3300025914 Bacteria 1752
268 Ga0207693_10000181 3300025915 Bacteria 57362
269 Ga0207693_10003053 3300025915 Bacteria 14460
270 Ga0207693_10143190 3300025915 Bacteria 1880
271 Ga0207663_10008276 3300025916 Bacteria 5431
272 Ga0207663_10408902 3300025916 Bacteria 1039
273 Ga0207660_10955437 3300025917 Bacteria 699
274 Ga0207662_10079878 3300025918 Bacteria 1993
275 Ga0207657_10049807 3300025919 Bacteria 3648
276 Ga0207657_10221820 3300025919 Bacteria 1514
277 Ga0207652_10481353 3300025921 Bacteria 1118
278 Ga0207681_10001854 3300025923 Bacteria 13551
279 Ga0207681_10014124 3300025923 Bacteria 4954
280 Ga0207659_10373515 3300025926 Bacteria 1188
281 Ga0207687_10008495 3300025927 Bacteria 6714
282 Ga0207687_10074935 3300025927 Bacteria 2427
283 Ga0207687_10567644 3300025927 Bacteria 953
284 Ga0207664_10034467 3300025929 Bacteria 3899
285 Ga0207664_10097283 3300025929 Bacteria 2424
286 Ga0207664_10530419 3300025929 Bacteria 1055
287 Ga0207644_10001385 3300025931 Bacteria 15631
288 Ga0207644_10730595 3300025931 Bacteria 826
289 Ga0207690_10068485 3300025932 Bacteria 2439
290 Ga0207706_10003507 3300025933 Bacteria 14979
291 Ga0207706_10183638 3300025933 Bacteria 1837
292 Ga0207706_10782312 3300025933 Bacteria 811
293 Ga0207686_10012968 3300025934 Bacteria 4599
294 Ga0207709_10002689 3300025935 Bacteria 11000
295 Ga0207709_10401005 3300025935 Bacteria 1049
296 Ga0207670_10114443 3300025936 Bacteria 1950
297 Ga0207670_10122532 3300025936 Bacteria 1892
298 Ga0207704_10001846 3300025938 Bacteria 9484
299 Ga0207704_10089265 3300025938 Bacteria 2019
300 Ga0207665_10000813 3300025939 Bacteria 21107
301 Ga0207665_10005043 3300025939 Bacteria 8815
302 Ga0207665_10371646 3300025939 Bacteria 1083
303 Ga0207665_10457766 3300025939 Bacteria 980
304 Ga0207691_10145912 3300025940 Bacteria 2083
305 Ga0207711_10000146 3300025941 Bacteria 74464
306 Ga0207711_10007348 3300025941 Bacteria 9221
307 Ga0207711_10014104 3300025941 Bacteria 6640
308 Ga0207711_10249246 3300025941 Bacteria 1630
309 Ga0207711_10488253 3300025941 Bacteria 1147
310 Ga0207661_10083325 3300025944 Bacteria 2646
311 Ga0207667_10371846 3300025949 Bacteria 1456
312 Ga0207712_10000050 3300025961 Bacteria 159469
313 Ga0207712_10011630 3300025961 Bacteria 5610
314 Ga0207668_10001801 3300025972 Bacteria 12504
315 Ga0207668_10031761 3300025972 Bacteria 3482
316 Ga0207668_10259120 3300025972 Bacteria 1416
317 Ga0207640_10067449 3300025981 Bacteria 2394
318 Ga0207640_10381062 3300025981 Bacteria 1143
319 Ga0207658_10000065 3300025986 Bacteria 117079
320 Ga0207658_10000911 3300025986 Bacteria 24512
321 Ga0207658_10018379 3300025986 Bacteria 4828
322 Ga0207658_10140676 3300025986 Bacteria 1952
323 Ga0207658_10168160 3300025986 Bacteria 1803
324 Ga0207658_10169008 3300025986 Bacteria 1799
325 Ga0207658_10285796 3300025986 Bacteria 1416
326 Ga0207677_10113233 3300026023 Bacteria 2025
327 Ga0207703_10008408 3300026035 Bacteria 8159
328 Ga0207703_10642780 3300026035 Bacteria 1006
329 Ga0207703_10981890 3300026035 Bacteria 810
330 Ga0207639_10041710 3300026041 Bacteria 3436
331 Ga0207639_10063759 3300026041 Bacteria 2855
332 Ga0207639_10095059 3300026041 Bacteria 2394
333 Ga0207678_10076166 3300026067 Bacteria 2873
334 Ga0207678_10081985 3300026067 Bacteria 2760
335 Ga0207678_10290611 3300026067 Bacteria 1404
336 Ga0207708_10003449 3300026075 Bacteria 11654
337 Ga0207708_10032998 3300026075 Bacteria 3931
338 Ga0207702_10556340 3300026078 Bacteria 1123
339 Ga0207641_10006204 3300026088 Bacteria 10113
340 Ga0207641_10012030 3300026088 Bacteria 7099
341 Ga0207641_10435499 3300026088 Bacteria 1265
342 Ga0207641_11002256 3300026088 Bacteria 832
343 Ga0207648_10000268 3300026089 Bacteria 56658
344 Ga0207648_10565507 3300026089 Bacteria 1046
345 Ga0207676_10345569 3300026095 Bacteria 1374
346 Ga0207676_10661230 3300026095 Bacteria 1009
347 Ga0207675_100000702 3300026118 Bacteria 33154
348 Ga0207675_100157161 3300026118 Bacteria 2167
349 Ga0207675_100358379 3300026118 Bacteria 1430
350 Ga0207683_10000132 3300026121 Bacteria 61177
351 Ga0207698_10157612 3300026142 Bacteria 1980
352 Ga0268266_10007011 3300028379 Bacteria 10234
353 Ga0268266_10289182 3300028379 Bacteria 1526
354 Ga0268265_10000004 3300028380 Bacteria 648376
355 Ga0268265_10020654 3300028380 Bacteria 4600
356 Ga0268264_10000024 3300028381 Bacteria 470081
357 Ga0268264_10000758 3300028381 Bacteria 36107
358 Ga0268264_10115828 3300028381 Bacteria 2355
359 Ga0265327_10011780 3300031251 Bacteria 5983
360 Ga0316578_10049430 3300031728 Bacteria 2458
361 Ga0307405_10267140 3300031731 Bacteria 1281
362 Ga0307413_10110174 3300031824 Bacteria 1842
363 Ga0307410_10200787 3300031852 Bacteria 1522
364 Ga0307410_10206299 3300031852 Bacteria 1504
365 Ga0307410_10464508 3300031852 Bacteria 1035
366 Ga0307406_10186365 3300031901 Bacteria 1515
367 Ga0307407_10011747 3300031903 Bacteria 4183
368 Ga0307407_10516110 3300031903 Bacteria 878
369 Ga0307407_10679329 3300031903 Bacteria 774
370 Ga0307409_100149313 3300031995 Bacteria 2027
371 Ga0307409_100351442 3300031995 Bacteria 1391
372 Ga0307409_100463169 3300031995 Bacteria 1226
373 Ga0307409_100591902 3300031995 Bacteria 1095
374 Ga0307416_100248521 3300032002 Bacteria 1729
375 Ga0307416_101156561 3300032002 Bacteria 879
376 Ga0307414_10719971 3300032004 Bacteria 905
377 Ga0307411_11200326 3300032005 Bacteria 688
378 Ga0307415_100106228 3300032126 Bacteria 2072
379 Ga0373931_0047970 3300035691 Bacteria 2262
380 Ga0373947_0297791 3300035725 Bacteria 1075
381 Ga0316582_0211792 3300036647 Bacteria 1324
382 Ga0395899_0034523 3300037312 Bacteria 3799
383 Ga0395899_0063201 3300037312 Bacteria 2724
384 Ga0395900_1164664 3300037418 Bacteria 687
385 Ga0395898_0008900 3300037466 Bacteria 10577
386 Ga0395898_0355234 3300037466 Bacteria 1397
387 Ga0395898_0921908 3300037466 Bacteria 811
388 Ga0395905_0706803 3300037471 Bacteria 910
389 Ga0436364_0033630 3300037853 Bacteria 4612
390 Ga0436364_1070124 3300037853 Bacteria 1418
391 Ga0436364_1389257 3300037853 Bacteria 3461
392 Ga0436365_0152461 3300039437 Bacteria 40083
393 Ga0436365_0555334 3300039437 Bacteria 1666
394 Ga0436365_0666432 3300039437 Bacteria 30356
395 Ga0436360_0029208 3300039438 Bacteria 891
396 Ga0436363_0573861 3300039450 Bacteria 1233
397 Ga0439466_0006183 3300041411 Bacteria 4561
398 Ga0439466_0011813 3300041411 Bacteria 3224
399 Ga0439466_0021990 3300041411 Bacteria 2254
400 Ga0439465_0000929 3300041413 Bacteria 9290
401 Ga0439465_0007762 3300041413 Bacteria 3402
402 Ga0439465_0022012 3300041413 Bacteria 2001
403 Ga0439465_0098281 3300041413 Bacteria 1008
404 Ga0451793_0734024 3300041452 Bacteria 2228
405 Ga0451795_0605100 3300041456 Bacteria 631
406 Ga0451802_0757034 3300041460 Bacteria 643
407 Ga0451833_0118692 3300041491 Bacteria 747
408 Ga0451853_3086809 3300041512 Bacteria 653
409 Ga0439442_003455 3300042002 Bacteria 3125
410 Ga0439442_104186 3300042002 Bacteria 615
411 Ga0439445_0012035 3300042004 Bacteria 2072
412 Ga0439450_054106 3300042008 Bacteria 959
413 Ga0439434_0011229 3300042435 Bacteria 2645
414 Ga0439434_0056057 3300042435 Bacteria 1227
415 Ga0466969_0141788 3300044656 Bacteria 1110
416 Ga0466972_0011149 3300044658 Bacteria 4510
417 Ga0466972_0112014 3300044658 Bacteria 1289
418 Ga0466972_0246703 3300044658 Bacteria 835
419 Ga0466965_0020291 3300044683 Bacteria 3193
420 Ga0466965_0029020 3300044683 Bacteria 2690
421 Ga0466966_0000270 3300044684 Bacteria 33912
422 Ga0466966_0029719 3300044684 Bacteria 3553
423 Ga0466966_0472968 3300044684 Bacteria 753
424 Ga0466961_0001791 3300044693 Bacteria 13309
425 Ga0466961_0013283 3300044693 Bacteria 5270
426 Ga0466961_0174155 3300044693 Bacteria 1338
427 Ga0466963_0017219 3300044694 Bacteria 4502
428 Ga0466963_0043835 3300044694 Bacteria 2943
429 Ga0466963_0202563 3300044694 Bacteria 1388
430 Ga0466963_0327393 3300044694 Bacteria 1078
431 Ga0466971_0025244 3300044719 Bacteria 2654
432 Ga0466968_0002759 3300044735 Bacteria 6489
433 Ga0466968_0021812 3300044735 Bacteria 2596
434 Ga0466970_0023280 3300044765 Bacteria 3234
435 Ga0466970_0050522 3300044765 Bacteria 2218
436 Ga0466970_0057455 3300044765 Bacteria 2080
437 Ga0466970_0066995 3300044765 Bacteria 1927
438 Ga0466970_0073891 3300044765 Bacteria 1835
439 Ga0466970_0082622 3300044765 Bacteria 1738
440 Ga0466970_0132600 3300044765 Bacteria 1369
441 Ga0466957_0002330 3300044842 Bacteria 10179
442 Ga0466957_0003746 3300044842 Bacteria 8402
443 Ga0466957_0032109 3300044842 Bacteria 3142
444 Ga0466960_0001766 3300044901 Bacteria 7931
445 Ga0466960_0112969 3300044901 Bacteria 1413
446 Ga0466960_0183230 3300044901 Bacteria 1136
447 Ga0466960_0218092 3300044901 Bacteria 1049
448 Ga0466959_0003159 3300045049 Bacteria 10686
449 Ga0466959_0020403 3300045049 Bacteria 4882
450 Ga0466959_0161245 3300045049 Bacteria 1576
451 Ga0466958_0015008 3300045836 Bacteria 4432
452 Ga0466958_0030240 3300045836 Bacteria 3215
453 Ga0466958_0038213 3300045836 Bacteria 2880
454 Ga0466958_0439829 3300045836 Bacteria 844
455 Ga0466967_0019311 3300045976 Bacteria 5476
456 Ga0466967_0037557 3300045976 Bacteria 4146
457 Ga0466967_0041722 3300045976 Bacteria 3959
458 Ga0466967_0109962 3300045976 Bacteria 2531
459 Ga0466967_0256414 3300045976 Bacteria 1672
460 Ga0466967_0422777 3300045976 Bacteria 1299
461 Ga0466967_0771242 3300045976 Bacteria 954
462 Ga0495638_0025434 3300046460 Bacteria 3848
463 Ga0495641_0067200 3300046461 Bacteria 1612
464 Ga0495582_0525074 3300046473 Bacteria 684
465 Ga0495639_0114319 3300046475 Bacteria 1283
466 Ga0495606_0030112 3300046507 Bacteria 3797
467 Ga0495648_0002295 3300046524 Bacteria 17835
468 Ga0495666_0078831 3300046526 Bacteria 1560
469 Ga0495654_0041848 3300046530 Bacteria 2277
470 Ga0495611_0128291 3300046648 Bacteria 1183
471 Ga0495625_0085371 3300046660 Bacteria 2191
472 Ga0495624_0095181 3300046690 Bacteria 1836
473 Ga0495581_0188224 3300047315 Bacteria 1207
474 Ga0495672_0002577 3300047320 Bacteria 16477
475 Ga0495672_0030744 3300047320 Bacteria 3362
476 Ga0495673_0000681 3300047469 Bacteria 33251
477 Ga0495686_0001156 3300047472 Bacteria 30978
478 Ga0495593_0005139 3300047673 Bacteria 7736
479 Ga0496100_0000076 3300048903 Bacteria 54910
480 Ga0496100_0001111 3300048903 Bacteria 13043
481 Ga0496100_0031399 3300048903 Bacteria 3303
482 Ga0496100_0038939 3300048903 Bacteria 3016
483 Ga0496100_0238164 3300048903 Bacteria 1342
484 Ga0496100_0970662 3300048903 Bacteria 668
485 Ga0496101_0000084 3300048904 Bacteria 104071
486 Ga0496101_0000094 3300048904 Bacteria 95577
487 Ga0496101_0001150 3300048904 Bacteria 15826
488 Ga0496101_0026952 3300048904 Bacteria 3996
489 Ga0496101_0199299 3300048904 Bacteria 1547
490 Ga0496101_0456448 3300048904 Bacteria 1008
491 Ga0496101_0840694 3300048904 Bacteria 723
492 Ga0496102_0000014 3300048905 Bacteria 310241
493 Ga0496102_0000691 3300048905 Bacteria 33503
494 Ga0496102_0003943 3300048905 Bacteria 12573
495 Ga0496102_0011841 3300048905 Bacteria 7528
496 Ga0496102_0036464 3300048905 Bacteria 4430
497 Ga0496102_0063575 3300048905 Bacteria 3380
498 Ga0496102_0082846 3300048905 Bacteria 2959
499 Ga0496102_0260044 3300048905 Bacteria 1636
500 Ga0496102_0266808 3300048905 Bacteria 1614
501 Ga0496103_0000004 3300048906 Bacteria 510080
502 Ga0496103_0000652 3300048906 Bacteria 26249
503 Ga0496103_0002282 3300048906 Bacteria 12121
504 Ga0496104_0019292 3300048907 Bacteria 6236
505 Ga0496104_0218280 3300048907 Bacteria 1819
506 Ga0496105_0005330 3300048908 Bacteria 9745
507 Ga0496105_0074506 3300048908 Bacteria 2804
508 Ga0496105_0116600 3300048908 Bacteria 2203
509 Ga0496106_0002300 3300048909 Bacteria 14254
510 Ga0496106_0003609 3300048909 Bacteria 11537
511 Ga0496106_0013804 3300048909 Bacteria 5968
512 Ga0496106_0034193 3300048909 Bacteria 3796
513 Ga0496107_0001067 3300048910 Bacteria 16439
514 Ga0496107_0002101 3300048910 Bacteria 12756
515 Ga0496107_0020240 3300048910 Bacteria 4698
516 Ga0496107_0028862 3300048910 Bacteria 3945
517 Ga0496107_0039662 3300048910 Bacteria 3379
518 Ga0496108_0000409 3300048911 Bacteria 35236
519 Ga0496108_0136218 3300048911 Bacteria 2113
520 Ga0496108_0392105 3300048911 Bacteria 1213
521 Ga0496108_0450611 3300048911 Bacteria 1124
522 Ga0496108_0453423 3300048911 Bacteria 1120
523 Ga0496109_0000098 3300048912 Bacteria 90126
524 Ga0496109_0001452 3300048912 Bacteria 19635
525 Ga0496109_0294348 3300048912 Bacteria 1530
526 Ga0496110_0002401 3300048913 Bacteria 14027
527 Ga0496110_0139697 3300048913 Bacteria 2190
528 Ga0496110_0140117 3300048913 Bacteria 2186
529 Ga0496110_1249006 3300048913 Bacteria 652
530 Ga0496111_0011927 3300048914 Bacteria 5872
531 Ga0496111_0082498 3300048914 Bacteria 2348
532 Ga0496111_0166344 3300048914 Bacteria 1638
533 Ga0496111_0443252 3300048914 Bacteria 958
534 Ga0496112_0008418 3300048915 Bacteria 9234
535 Ga0496112_0013359 3300048915 Bacteria 7580
536 Ga0496112_0074708 3300048915 Bacteria 3352
537 Ga0496112_0141417 3300048915 Bacteria 2376
538 Ga0496113_0081588 3300048916 Bacteria 2479
539 Ga0496113_0103416 3300048916 Bacteria 2209
540 Ga0496113_0426567 3300048916 Bacteria 1065
541 Ga0496114_0000647 3300048917 Bacteria 25675
542 Ga0496114_0018600 3300048917 Bacteria 5621
543 Ga0496114_0035329 3300048917 Bacteria 4127
544 Ga0496114_0338716 3300048917 Bacteria 1330
545 Ga0496115_0002697 3300048918 Bacteria 12743
546 Ga0496115_0003548 3300048918 Bacteria 11224
547 Ga0496115_0010746 3300048918 Bacteria 6846
548 Ga0496115_0481218 3300048918 Bacteria 1000
549 Ga0496116_0000069 3300048919 Bacteria 252643
550 Ga0496116_0006505 3300048919 Bacteria 10587
551 Ga0496116_0088669 3300048919 Bacteria 1889
552 Ga0496117_0000003 3300048920 Bacteria 1881097
553 Ga0496117_0004834 3300048920 Bacteria 14566
554 Ga0496117_0175494 3300048920 Bacteria 1238
555 Ga0496118_0000001 3300048921 Bacteria 1881100
556 Ga0496118_0000324 3300048921 Bacteria 82637
557 Ga0496118_0000538 3300048921 Bacteria 62335
558 Ga0496118_0173725 3300048921 Bacteria 1312
559 Ga0496119_0004768 3300048922 Bacteria 13318
560 Ga0496119_0010866 3300048922 Bacteria 7609
561 Ga0496119_0045000 3300048922 Bacteria 2772
562 Ga0496120_0019168 3300048923 Bacteria 4385
563 Ga0496120_0048585 3300048923 Bacteria 2441
564 Ga0496120_0220817 3300048923 Bacteria 905
565 Ga0496121_0000016 3300048924 Bacteria 562911
566 Ga0496121_0000032 3300048924 Bacteria 378997
567 Ga0496121_0002438 3300048924 Bacteria 28440
568 Ga0496122_0000526 3300048925 Bacteria 79269
569 Ga0496122_0359550 3300048925 Bacteria 756
570 Ga0496123_0003559 3300048926 Bacteria 17267
571 Ga0496124_0000015 3300048927 Bacteria 460700
572 Ga0496124_0155404 3300048927 Bacteria 1789
573 Ga0496124_0192782 3300048927 Bacteria 1557
574 Ga0496125_0000021 3300048928 Bacteria 460688
575 Ga0496125_0021788 3300048928 Bacteria 5962
576 Ga0496125_0158370 3300048928 Bacteria 1543
577 Ga0496126_0000015 3300048929 Bacteria 663212
578 Ga0496126_0000067 3300048929 Bacteria 249091
579 Ga0496126_0003991 3300048929 Bacteria 18027
580 Ga0496126_0026840 3300048929 Bacteria 5514
581 Ga0501031_0213661 3300049568 Bacteria 1257
582 Ga0501032_0007006 3300049569 Bacteria 8267
583 Ga0501032_0033580 3300049569 Bacteria 3514
584 Ga0501033_0035813 3300049570 Bacteria 3721
585 Ga0501033_0073853 3300049570 Bacteria 2504
586 Ga0501034_0002951 3300049571 Bacteria 19708
587 Ga0501034_0006780 3300049571 Bacteria 12247
588 Ga0501034_0216353 3300049571 Bacteria 1870
589 Ga0501036_0178052 3300049572 Bacteria 1790
590 Ga0501037_0009367 3300049573 Bacteria 7188
591 Ga0501038_0013969 3300049574 Bacteria 7318
592 Ga0501039_0013109 3300049575 Bacteria 6338
593 Ga0501040_0336202 3300049576 Bacteria 1081
594 Ga0501043_0002544 3300049579 Bacteria 15415
595 Ga0501043_0043622 3300049579 Bacteria 3525
596 Ga0501046_0000660 3300049580 Bacteria 33434
597 Ga0501047_0046321 3300049581 Bacteria 4203
598 Ga0501047_0178902 3300049581 Bacteria 1988
599 Ga0501048_0006465 3300049582 Bacteria 8908
600 Ga0501067_0094286 3300049583 Bacteria 1662
601 Ga0501069_0120892 3300049585 Bacteria 1495
602 Ga0501070_0001595 3300049586 Bacteria 20107
603 Ga0501070_0004875 3300049586 Bacteria 11465
604 Ga0501070_0155696 3300049586 Bacteria 1884
605 Ga0501070_0295656 3300049586 Bacteria 1320
606 Ga0501070_0315003 3300049586 Bacteria 1273
607 Ga0501073_0015774 3300049589 Bacteria 5475
608 Ga0501073_0211285 3300049589 Bacteria 1341
609 Ga0501080_0059561 3300049742 Bacteria 3553
610 Ga0501083_0058552 3300049744 Bacteria 2578
611 Ga0501035_0001453 3300049822 Bacteria 24288
612 Ga0501035_0007175 3300049822 Bacteria 10425
613 Ga0501035_0451710 3300049822 Bacteria 1063
614 Ga0501044_0005246 3300049823 Bacteria 14415
615 Ga0501044_0006818 3300049823 Bacteria 12585
616 Ga0501044_0015265 3300049823 Bacteria 8274
617 Ga0501044_0032548 3300049823 Bacteria 5481
618 nmdc:mga03683_36754_c1 3300050489 Bacteria 1993
619 nmdc:mga03n38_125600_c1 3300050490 Bacteria 1266
620 nmdc:mga03n38_160447_c1 3300050490 Bacteria 1138
621 nmdc:mga03n38_46711_c1 3300050490 Bacteria 1913
622 nmdc:mga03n38_60765_c1 3300050490 Bacteria 1719
623 nmdc:mga03n38_762_c1 3300050490 Bacteria 8528
624 nmdc:mga00v17_175124_c1 3300050491 Bacteria 1384
625 nmdc:mga00v17_28468_c1 3300050491 Bacteria 3272
626 nmdc:mga00v17_30039_c1 3300050491 Bacteria 3194
627 nmdc:mga00v17_323012_c1 3300050491 Bacteria 1003
628 nmdc:mga00v17_47200_c1 3300050491 Bacteria 2608
629 nmdc:mga00v17_59077_c1 3300050491 Bacteria 2351
630 nmdc:mga00v17_6797_c1 3300050491 Bacteria 6078
631 nmdc:mga00v17_68045_c1 3300050491 Bacteria 2201
632 nmdc:mga00v17_71537_c1 3300050491 Bacteria 2150
633 nmdc:mga00v17_8645_c1 3300050491 Bacteria 5485
634 nmdc:mga0yw44_243488_c1 3300050492 Bacteria 1196
635 nmdc:mga0yw44_31556_c1 3300050492 Bacteria 3082
636 nmdc:mga0yw44_365443_c1 3300050492 Bacteria 973
637 nmdc:mga0yw44_474275_c1 3300050492 Bacteria 848
638 nmdc:mga0yw44_97769_c1 3300050492 Bacteria 1865
639 nmdc:mga06z11_158782_c1 3300050494 Bacteria 1291
640 nmdc:mga04h51_197472_c1 3300050495 Bacteria 789
641 nmdc:mga07m45_107843_c1 3300050496 Bacteria 1602
642 nmdc:mga07m45_19085_c1 3300050496 Bacteria 3712
643 nmdc:mga07m45_345083_c1 3300050496 Bacteria 865
644 nmdc:mga07m45_497565_c1 3300050496 Bacteria 706
645 nmdc:mga05p37_1273384_c1 3300050507 Bacteria 752
646 nmdc:mga05p37_495773_c1 3300050507 Bacteria 1403
647 nmdc:mga0qj67_35032_c1 3300050509 Bacteria 3923
648 nmdc:mga0qj67_36961_c1 3300050509 Bacteria 3823
649 nmdc:mga08y16_458640_c1 3300050511 Bacteria 1299
650 nmdc:mga0sz30_14117_c1 3300050516 Bacteria 3138
651 nmdc:mga0sz30_143314_c1 3300050516 Bacteria 1055
652 nmdc:mga0sz30_202281_c1 3300050516 Bacteria 882
653 nmdc:mga0sz30_243652_c1 3300050516 Bacteria 800
654 nmdc:mga0sz30_254319_c1 3300050516 Bacteria 782
655 nmdc:mga0sz30_3880_c1 3300050516 Bacteria 5391
656 nmdc:mga0sz30_5156_c1 3300050516 Bacteria 4781
657 nmdc:mga0sz30_6380_c1 3300050516 Bacteria 4378
658 Ga0495601_0493089 3300053077 Bacteria 791
659 Ga0500610_0287457 3300053079 Bacteria 733
660 Ga0500635_0006693 3300053080 Bacteria 3087
661 Ga0495655_0010778 3300053083 Bacteria 1816
662 Ga0495619_0108988 3300053085 Bacteria 1890
663 Ga0500643_002989 3300053087 Bacteria 8377
664 Ga0500644_0282919 3300053088 Bacteria 706
665 Ga0500641_0035588 3300053096 Bacteria 1988
666 Ga0500556_0129994 3300053104 Bacteria 986
667 Ga0500562_044887 3300053108 Bacteria 1177
668 Ga0500628_010050 3300053129 Bacteria 1684
669 Ga0500652_073270 3300053131 Bacteria 1421
670 Ga0500658_0089534 3300053134 Bacteria 1329
671 Ga0500559_0053630 3300053136 Bacteria 1785
672 Ga0500568_0179370 3300053139 Bacteria 779
673 Ga0500616_0079914 3300053153 Bacteria 1645
674 Ga0500627_0083447 3300053158 Bacteria 1426
675 Ga0500645_000057 3300053730 Bacteria 92092
676 Ga0500645_071821 3300053730 Bacteria 993
677 Ga0500645_081689 3300053730 Bacteria 922
678 Ga0501084_0236001 3300054114 Bacteria 1544
679 Ga0466962_0014337 3300061719 Bacteria 3820
680 Ga0466962_0265577 3300061719 Bacteria 845

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048917 Ga0496114_0338716 Ga0496114_0338716_626_1156 158
2 3300005435 Ga0070714_100055620 Ga0070714_1000556205 168
3 3300025929 Ga0207664_10530419 Ga0207664_105304192 168
4 3300037853 Ga0436364_1070124 Ga0436364_1070124_630_1151 168
5 3300041411 Ga0439466_0011813 Ga0439466_0011813_85_645 168
6 3300042435 Ga0439434_0011229 Ga0439434_0011229_87_647 168
7 3300006051 Ga0075364_10059885 Ga0075364_100598853 170
8 3300006051 Ga0075364_10586724 Ga0075364_105867241 170
9 3300031731 Ga0307405_10267140 Ga0307405_102671402 170
10 3300031824 Ga0307413_10110174 Ga0307413_101101742 170
11 3300031901 Ga0307406_10186365 Ga0307406_101863652 170
12 3300041413 Ga0439465_0007762 Ga0439465_0007762_1489_2049 170
13 3300050491 nmdc:mga00v17_175124_c1 nmdc:mga00v17_175124_c1_513_1073 170
14 3300009093 Ga0105240_10277901 Ga0105240_102779012 171
15 3300037418 Ga0395900_1164664 Ga0395900_1164664_159_674 171
16 3300044694 Ga0466963_0043835 Ga0466963_0043835_1558_2088 171
17 3300044694 Ga0466963_0202563 Ga0466963_0202563_572_1102 171
18 3300044694 Ga0466963_0327393 Ga0466963_0327393_377_907 171
19 3300044842 Ga0466957_0002330 Ga0466957_0002330_7062_7592 171
20 3300044901 Ga0466960_0001766 Ga0466960_0001766_3248_3778 171
21 3300045836 Ga0466958_0038213 Ga0466958_0038213_1302_1832 171
22 3300045976 Ga0466967_0041722 Ga0466967_0041722_1910_2440 171
23 3300048929 Ga0496126_0026840 Ga0496126_0026840_2449_2979 171
24 3300049568 Ga0501031_0213661 Ga0501031_0213661_151_681 171
25 3300049569 Ga0501032_0007006 Ga0501032_0007006_617_1147 171
26 3300049571 Ga0501034_0006780 Ga0501034_0006780_9156_9686 171
27 3300049579 Ga0501043_0043622 Ga0501043_0043622_277_807 171
28 3300049580 Ga0501046_0000660 Ga0501046_0000660_2877_3407 171
29 3300049582 Ga0501048_0006465 Ga0501048_0006465_8108_8638 171
30 3300049585 Ga0501069_0120892 Ga0501069_0120892_297_827 171
31 3300049586 Ga0501070_0001595 Ga0501070_0001595_2884_3414 171
32 3300049589 Ga0501073_0211285 Ga0501073_0211285_628_1158 171
33 3300049742 Ga0501080_0059561 Ga0501080_0059561_2584_3114 171
34 3300049822 Ga0501035_0007175 Ga0501035_0007175_9748_10278 171
35 3300049823 Ga0501044_0015265 Ga0501044_0015265_1190_1720 171
36 3300054114 Ga0501084_0236001 Ga0501084_0236001_166_696 171
37 3300013308 Ga0157375_10799292 Ga0157375_107992922 172
38 3300037312 Ga0395899_0034523 Ga0395899_0034523_1758_2342 172
39 3300037466 Ga0395898_0008900 Ga0395898_0008900_5037_5621 172
40 3300037853 Ga0436364_0033630 Ga0436364_0033630_1833_2366 172
41 3300039437 Ga0436365_0666432 Ga0436365_0666432_2182_2715 172
42 3300041411 Ga0439466_0006183 Ga0439466_0006183_2372_2914 172
43 3300041413 Ga0439465_0022012 Ga0439465_0022012_694_1236 172
44 3300042002 Ga0439442_003455 Ga0439442_003455_2170_2712 172
45 3300035725 Ga0373947_0297791 Ga0373947_0297791_90_614 174
46 3300044656 Ga0466969_0141788 Ga0466969_0141788_245_769 174
47 3300044684 Ga0466966_0000270 Ga0466966_0000270_10050_10574 174
48 3300044694 Ga0466963_0017219 Ga0466963_0017219_2542_3066 174
49 3300044735 Ga0466968_0002759 Ga0466968_0002759_4112_4636 174
50 3300044765 Ga0466970_0023280 Ga0466970_0023280_1898_2422 174
51 3300045049 Ga0466959_0003159 Ga0466959_0003159_5468_5992 174
52 3300061719 Ga0466962_0265577 Ga0466962_0265577_191_715 174
53 iso_pu_bacteria 2919051321 2919051807 174
54 iso_pu_bacteria 2738541264 2738665250 175
55 iso_pu_bacteria 2738541356 2739144384 175
56 3300005578 Ga0068854_101051561 Ga0068854_1010515611 176
57 iso_pu_bacteria 2643221687 2644486619 176
58 iso_pu_bacteria 2738541274 2738705503 176
59 iso_pu_bacteria 2738543028 2739332292 176
60 iso_pu_bacteria 2842134933 2842138637 176
61 iso_pu_bacteria 2902792274 2902798225 176
62 iso_pu_bacteria 2902799365 2902801866 176
63 iso_pu_bacteria 2902837492 2902838967 176
64 iso_pu_bacteria 2929212328 2929214657 176
65 3300021384 Ga0213876_10467669 Ga0213876_104676691 177
66 3300025981 Ga0207640_10381062 Ga0207640_103810622 177
67 3300039437 Ga0436365_0555334 Ga0436365_0555334_275_835 177
68 3300045976 Ga0466967_0771242 Ga0466967_0771242_229_789 177
69 3300005356 Ga0070674_100948979 Ga0070674_1009489791 178
70 3300005618 Ga0068864_100259422 Ga0068864_1002594222 178
71 3300025927 Ga0207687_10567644 Ga0207687_105676441 178
72 3300025986 Ga0207658_10285796 Ga0207658_102857963 178
73 3300026095 Ga0207676_10661230 Ga0207676_106612302 178
74 3300037466 Ga0395898_0921908 Ga0395898_0921908_125_712 178
75 3300003320 rootH2_10074387 rootH2_100743873 179
76 3300003792 Ga0055540_1000003 Ga0055540_1000003300 179
77 3300005329 Ga0070683_100102323 Ga0070683_1001023231 179
78 3300005347 Ga0070668_100073839 Ga0070668_1000738394 179
79 3300005367 Ga0070667_100001120 Ga0070667_10000112013 179
80 3300005435 Ga0070714_100193485 Ga0070714_1001934851 179
81 3300005435 Ga0070714_100818078 Ga0070714_1008180781 179
82 3300005436 Ga0070713_100164711 Ga0070713_1001647115 179
83 3300005439 Ga0070711_100438613 Ga0070711_1004386131 179
84 3300005937 Ga0081455_10043344 Ga0081455_100433445 179
85 3300006028 Ga0070717_10584541 Ga0070717_105845412 179
86 3300006042 Ga0075368_10141345 Ga0075368_101413452 179
87 3300006175 Ga0070712_100255619 Ga0070712_1002556194 179
88 3300009148 Ga0105243_10858959 Ga0105243_108589591 179
89 3300010375 Ga0105239_10032634 Ga0105239_100326342 179
90 3300013105 Ga0157369_10048427 Ga0157369_100484273 179
91 3300013306 Ga0163162_10056300 Ga0163162_100563003 179
92 3300014325 Ga0163163_10677977 Ga0163163_106779771 179
93 3300021384 Ga0213876_10012776 Ga0213876_100127765 179
94 3300021388 Ga0213875_10012599 Ga0213875_100125994 179
95 3300021388 Ga0213875_10259009 Ga0213875_102590091 179
96 3300025303 Ga0209051_1000011 Ga0209051_1000011296 179
97 3300025913 Ga0207695_10201798 Ga0207695_102017982 179
98 3300025921 Ga0207652_10481353 Ga0207652_104813531 179
99 3300025929 Ga0207664_10034467 Ga0207664_100344675 179
100 3300025929 Ga0207664_10097283 Ga0207664_100972834 179
101 3300025933 Ga0207706_10782312 Ga0207706_107823122 179
102 3300025944 Ga0207661_10083325 Ga0207661_100833251 179
103 3300025986 Ga0207658_10000911 Ga0207658_1000091112 179
104 3300026035 Ga0207703_10981890 Ga0207703_109818902 179
105 3300026118 Ga0207675_100358379 Ga0207675_1003583792 179
106 3300031251 Ga0265327_10011780 Ga0265327_100117803 179
107 3300037853 Ga0436364_1389257 Ga0436364_1389257_2893_3435 179
108 3300039438 Ga0436360_0029208 Ga0436360_0029208_54_608 179
109 3300045976 Ga0466967_0037557 Ga0466967_0037557_1975_2514 179
110 3300048903 Ga0496100_0000076 Ga0496100_0000076_7702_8241 179
111 3300048903 Ga0496100_0238164 Ga0496100_0238164_728_1267 179
112 3300048904 Ga0496101_0000084 Ga0496101_0000084_51402_51941 179
113 3300048904 Ga0496101_0456448 Ga0496101_0456448_194_733 179
114 3300048905 Ga0496102_0260044 Ga0496102_0260044_64_603 179
115 3300048906 Ga0496103_0002282 Ga0496103_0002282_3216_3755 179
116 3300048909 Ga0496106_0002300 Ga0496106_0002300_13678_14217 179
117 3300048910 Ga0496107_0001067 Ga0496107_0001067_6994_7533 179
118 3300048911 Ga0496108_0453423 Ga0496108_0453423_75_614 179
119 3300048912 Ga0496109_0000098 Ga0496109_0000098_87002_87541 179
120 3300048913 Ga0496110_0002401 Ga0496110_0002401_5896_6435 179
121 3300048914 Ga0496111_0011927 Ga0496111_0011927_4397_4936 179
122 3300048915 Ga0496112_0074708 Ga0496112_0074708_195_734 179
123 3300048916 Ga0496113_0103416 Ga0496113_0103416_943_1482 179
124 3300048917 Ga0496114_0000647 Ga0496114_0000647_21396_21935 179
125 3300048918 Ga0496115_0003548 Ga0496115_0003548_7431_7970 179
126 3300048919 Ga0496116_0006505 Ga0496116_0006505_5742_6281 179
127 3300048922 Ga0496119_0010866 Ga0496119_0010866_78_617 179
128 3300048923 Ga0496120_0019168 Ga0496120_0019168_3778_4317 179
129 3300048923 Ga0496120_0220817 Ga0496120_0220817_49_588 179
130 3300048924 Ga0496121_0000016 Ga0496121_0000016_213129_213668 179
131 3300048925 Ga0496122_0000526 Ga0496122_0000526_32107_32646 179
132 3300048926 Ga0496123_0003559 Ga0496123_0003559_3846_4385 179
133 3300048927 Ga0496124_0000015 Ga0496124_0000015_164722_165261 179
134 3300048928 Ga0496125_0000021 Ga0496125_0000021_295440_295979 179
135 3300048928 Ga0496125_0158370 Ga0496125_0158370_257_796 179
136 3300048929 Ga0496126_0000015 Ga0496126_0000015_295440_295979 179
137 3300048929 Ga0496126_0003991 Ga0496126_0003991_4624_5163 179
138 3300049570 Ga0501033_0035813 Ga0501033_0035813_729_1286 179
139 3300049570 Ga0501033_0073853 Ga0501033_0073853_307_864 179
140 3300049586 Ga0501070_0295656 Ga0501070_0295656_600_1157 179
141 3300049822 Ga0501035_0001453 Ga0501035_0001453_10860_11417 179
142 3300049823 Ga0501044_0005246 Ga0501044_0005246_8017_8574 179
143 3300050490 nmdc:mga03n38_762_c1 nmdc:mga03n38_762_c1_4454_5014 179
144 3300050491 nmdc:mga00v17_8645_c1 nmdc:mga00v17_8645_c1_2721_3281 179
145 3300050492 nmdc:mga0yw44_474275_c1 nmdc:mga0yw44_474275_c1_184_735 179
146 3300050496 nmdc:mga07m45_19085_c1 nmdc:mga07m45_19085_c1_2433_2993 179
147 3300050516 nmdc:mga0sz30_6380_c1 nmdc:mga0sz30_6380_c1_657_1217 179
148 iso_pu_bacteria 2643221715 2644634820 179
149 iso_pu_bacteria 2902810491 2902817147 179
150 iso_pu_bacteria 2939582691 2939586536 179
151 3300002459 JGI24751J29686_10004847 JGI24751J29686_100048472 180
152 3300003792 Ga0055540_1000261 Ga0055540_10002614 180
153 3300003792 Ga0055540_1002350 Ga0055540_10023508 180
154 3300003792 Ga0055540_1005458 Ga0055540_10054586 180
155 3300005328 Ga0070676_10216317 Ga0070676_102163172 180
156 3300005330 Ga0070690_100100480 Ga0070690_1001004802 180
157 3300005333 Ga0070677_10059707 Ga0070677_100597072 180
158 3300005337 Ga0070682_100033517 Ga0070682_1000335172 180
159 3300005338 Ga0068868_100077317 Ga0068868_1000773172 180
160 3300005339 Ga0070660_100210292 Ga0070660_1002102921 180
161 3300005340 Ga0070689_100239280 Ga0070689_1002392802 180
162 3300005341 Ga0070691_10008199 Ga0070691_100081992 180
163 3300005341 Ga0070691_10094527 Ga0070691_100945272 180
164 3300005343 Ga0070687_100062901 Ga0070687_1000629012 180
165 3300005345 Ga0070692_10079201 Ga0070692_100792012 180
166 3300005347 Ga0070668_100003544 Ga0070668_1000035448 180
167 3300005347 Ga0070668_100148285 Ga0070668_1001482853 180
168 3300005354 Ga0070675_100459877 Ga0070675_1004598772 180
169 3300005355 Ga0070671_100006991 Ga0070671_10000699110 180
170 3300005355 Ga0070671_100603192 Ga0070671_1006031921 180
171 3300005367 Ga0070667_100051541 Ga0070667_1000515412 180
172 3300005367 Ga0070667_100201490 Ga0070667_1002014903 180
173 3300005367 Ga0070667_100324141 Ga0070667_1003241411 180
174 3300005367 Ga0070667_100953488 Ga0070667_1009534881 180
175 3300005406 Ga0070703_10137064 Ga0070703_101370642 180
176 3300005434 Ga0070709_10031344 Ga0070709_100313442 180
177 3300005437 Ga0070710_10000360 Ga0070710_1000036020 180
178 3300005438 Ga0070701_10005732 Ga0070701_100057324 180
179 3300005439 Ga0070711_100000487 Ga0070711_10000048718 180
180 3300005440 Ga0070705_100009225 Ga0070705_1000092255 180
181 3300005440 Ga0070705_100033171 Ga0070705_1000331712 180
182 3300005441 Ga0070700_100001945 Ga0070700_1000019458 180
183 3300005441 Ga0070700_100315949 Ga0070700_1003159492 180
184 3300005444 Ga0070694_100041160 Ga0070694_1000411603 180
185 3300005455 Ga0070663_100006881 Ga0070663_1000068813 180
186 3300005455 Ga0070663_100273321 Ga0070663_1002733213 180
187 3300005455 Ga0070663_100401737 Ga0070663_1004017372 180
188 3300005455 Ga0070663_101270761 Ga0070663_1012707611 180
189 3300005456 Ga0070678_100000111 Ga0070678_1000001118 180
190 3300005456 Ga0070678_100025788 Ga0070678_1000257885 180
191 3300005456 Ga0070678_100196399 Ga0070678_1001963991 180
192 3300005457 Ga0070662_100012627 Ga0070662_1000126277 180
193 3300005457 Ga0070662_101157120 Ga0070662_1011571201 180
194 3300005459 Ga0068867_100004844 Ga0068867_10000484410 180
195 3300005466 Ga0070685_10563589 Ga0070685_105635892 180
196 3300005535 Ga0070684_100111816 Ga0070684_1001118164 180
197 3300005539 Ga0068853_100125562 Ga0068853_1001255622 180
198 3300005539 Ga0068853_100300457 Ga0068853_1003004571 180
199 3300005543 Ga0070672_100071222 Ga0070672_1000712223 180
200 3300005546 Ga0070696_100001142 Ga0070696_1000011422 180
201 3300005546 Ga0070696_100078905 Ga0070696_1000789053 180
202 3300005548 Ga0070665_100002727 Ga0070665_1000027274 180
203 3300005548 Ga0070665_100193633 Ga0070665_1001936334 180
204 3300005548 Ga0070665_100746029 Ga0070665_1007460291 180
205 3300005549 Ga0070704_100002785 Ga0070704_1000027854 180
206 3300005563 Ga0068855_100462303 Ga0068855_1004623032 180
207 3300005578 Ga0068854_100000417 Ga0068854_10000041720 180
208 3300005614 Ga0068856_100114896 Ga0068856_1001148963 180
209 3300005616 Ga0068852_100038965 Ga0068852_1000389652 180
210 3300005617 Ga0068859_100015088 Ga0068859_1000150889 180
211 3300005618 Ga0068864_100289109 Ga0068864_1002891092 180
212 3300005718 Ga0068866_10000413 Ga0068866_100004134 180
213 3300005719 Ga0068861_100000439 Ga0068861_10000043913 180
214 3300005841 Ga0068863_100027777 Ga0068863_1000277776 180
215 3300005841 Ga0068863_100592385 Ga0068863_1005923852 180
216 3300005841 Ga0068863_100650849 Ga0068863_1006508492 180
217 3300005842 Ga0068858_100002903 Ga0068858_1000029032 180
218 3300005842 Ga0068858_100260083 Ga0068858_1002600832 180
219 3300005843 Ga0068860_100283737 Ga0068860_1002837372 180
220 3300005844 Ga0068862_100002547 Ga0068862_1000025476 180
221 3300005937 Ga0081455_10012114 Ga0081455_100121145 180
222 3300005981 Ga0081538_10013922 Ga0081538_100139223 180
223 3300006038 Ga0075365_10025176 Ga0075365_100251765 180
224 3300006038 Ga0075365_10037749 Ga0075365_100377496 180
225 3300006038 Ga0075365_10044029 Ga0075365_100440295 180
226 3300006038 Ga0075365_10398594 Ga0075365_103985941 180
227 3300006042 Ga0075368_10247730 Ga0075368_102477301 180
228 3300006048 Ga0075363_100020694 Ga0075363_1000206942 180
229 3300006048 Ga0075363_100098663 Ga0075363_1000986633 180
230 3300006048 Ga0075363_100151689 Ga0075363_1001516892 180
231 3300006048 Ga0075363_100155383 Ga0075363_1001553831 180
232 3300006048 Ga0075363_100157736 Ga0075363_1001577362 180
233 3300006051 Ga0075364_10005435 Ga0075364_100054356 180
234 3300006051 Ga0075364_10024033 Ga0075364_100240333 180
235 3300006051 Ga0075364_10051701 Ga0075364_100517013 180
236 3300006051 Ga0075364_10060750 Ga0075364_100607501 180
237 3300006051 Ga0075364_10065124 Ga0075364_100651243 180
238 3300006051 Ga0075364_10082366 Ga0075364_100823663 180
239 3300006051 Ga0075364_10493790 Ga0075364_104937901 180
240 3300006051 Ga0075364_10522846 Ga0075364_105228461 180
241 3300006163 Ga0070715_10000371 Ga0070715_100003718 180
242 3300006173 Ga0070716_100002231 Ga0070716_1000022315 180
243 3300006173 Ga0070716_100575793 Ga0070716_1005757931 180
244 3300006175 Ga0070712_100000301 Ga0070712_10000030121 180
245 3300006177 Ga0075362_10028235 Ga0075362_100282354 180
246 3300006177 Ga0075362_10175234 Ga0075362_101752341 180
247 3300006178 Ga0075367_10001573 Ga0075367_1000157310 180
248 3300006178 Ga0075367_10110801 Ga0075367_101108012 180
249 3300006186 Ga0075369_10004625 Ga0075369_100046253 180
250 3300006186 Ga0075369_10012871 Ga0075369_100128715 180
251 3300006186 Ga0075369_10014385 Ga0075369_100143853 180
252 3300006186 Ga0075369_10016929 Ga0075369_100169295 180
253 3300006186 Ga0075369_10350998 Ga0075369_103509981 180
254 3300006186 Ga0075369_10353427 Ga0075369_103534271 180
255 3300006353 Ga0075370_10009954 Ga0075370_100099543 180
256 3300006353 Ga0075370_10098507 Ga0075370_100985072 180
257 3300006358 Ga0068871_100007901 Ga0068871_1000079014 180
258 3300006844 Ga0075428_100069394 Ga0075428_1000693946 180
259 3300006844 Ga0075428_101171832 Ga0075428_1011718322 180
260 3300006846 Ga0075430_100042525 Ga0075430_1000425252 180
261 3300006846 Ga0075430_100119887 Ga0075430_1001198872 180
262 3300006881 Ga0068865_100015576 Ga0068865_1000155764 180
263 3300006931 Ga0097620_100015089 Ga0097620_1000150899 180
264 3300009092 Ga0105250_10106293 Ga0105250_101062932 180
265 3300009094 Ga0111539_10445761 Ga0111539_104457612 180
266 3300009098 Ga0105245_10007624 Ga0105245_100076249 180
267 3300009098 Ga0105245_11483380 Ga0105245_114833801 180
268 3300009101 Ga0105247_10002522 Ga0105247_100025227 180
269 3300009101 Ga0105247_10167702 Ga0105247_101677022 180
270 3300009101 Ga0105247_10237874 Ga0105247_102378742 180
271 3300009147 Ga0114129_10572881 Ga0114129_105728812 180
272 3300009147 Ga0114129_10608468 Ga0114129_106084682 180
273 3300009148 Ga0105243_10004430 Ga0105243_1000443010 180
274 3300009176 Ga0105242_10000106 Ga0105242_1000010616 180
275 3300009177 Ga0105248_10010396 Ga0105248_100103962 180
276 3300009177 Ga0105248_10035396 Ga0105248_100353964 180
277 3300009177 Ga0105248_10912345 Ga0105248_109123452 180
278 3300009545 Ga0105237_10003454 Ga0105237_1000345417 180
279 3300009553 Ga0105249_10002095 Ga0105249_1000209518 180
280 3300009553 Ga0105249_10031693 Ga0105249_100316934 180
281 3300009553 Ga0105249_10127933 Ga0105249_101279333 180
282 3300010375 Ga0105239_10003754 Ga0105239_1000375416 180
283 3300010375 Ga0105239_10012567 Ga0105239_100125677 180
284 3300010375 Ga0105239_10752564 Ga0105239_107525641 180
285 3300010375 Ga0105239_11461098 Ga0105239_114610981 180
286 3300013100 Ga0157373_10321734 Ga0157373_103217341 180
287 3300013105 Ga0157369_10187107 Ga0157369_101871073 180
288 3300013297 Ga0157378_10023502 Ga0157378_100235023 180
289 3300013297 Ga0157378_10232927 Ga0157378_102329272 180
290 3300013307 Ga0157372_10021676 Ga0157372_100216767 180
291 3300014325 Ga0163163_10312656 Ga0163163_103126562 180
292 3300014326 Ga0157380_10000450 Ga0157380_1000045021 180
293 3300014497 Ga0182008_10307940 Ga0182008_103079402 180
294 3300014968 Ga0157379_10012525 Ga0157379_100125251 180
295 3300014968 Ga0157379_10605115 Ga0157379_106051152 180
296 3300014968 Ga0157379_10637313 Ga0157379_106373131 180
297 3300014969 Ga0157376_10080507 Ga0157376_100805072 180
298 3300017792 Ga0163161_10000992 Ga0163161_100009922 180
299 3300025303 Ga0209051_1000659 Ga0209051_10006597 180
300 3300025303 Ga0209051_1001255 Ga0209051_10012551 180
301 3300025303 Ga0209051_1002943 Ga0209051_10029432 180
302 3300025303 Ga0209051_1022605 Ga0209051_10226053 180
303 3300025303 Ga0209051_1049106 Ga0209051_10491061 180
304 3300025711 Ga0207696_1067320 Ga0207696_10673202 180
305 3300025898 Ga0207692_10038315 Ga0207692_100383153 180
306 3300025899 Ga0207642_10005614 Ga0207642_100056142 180
307 3300025900 Ga0207710_10015701 Ga0207710_100157014 180
308 3300025901 Ga0207688_10000522 Ga0207688_100005229 180
309 3300025904 Ga0207647_10058117 Ga0207647_100581171 180
310 3300025905 Ga0207685_10007577 Ga0207685_100075772 180
311 3300025906 Ga0207699_10176429 Ga0207699_101764291 180
312 3300025907 Ga0207645_10008738 Ga0207645_100087387 180
313 3300025914 Ga0207671_10016098 Ga0207671_100160983 180
314 3300025914 Ga0207671_10158470 Ga0207671_101584702 180
315 3300025915 Ga0207693_10000181 Ga0207693_1000018113 180
316 3300025915 Ga0207693_10143190 Ga0207693_101431903 180
317 3300025916 Ga0207663_10408902 Ga0207663_104089021 180
318 3300025917 Ga0207660_10955437 Ga0207660_109554371 180
319 3300025918 Ga0207662_10079878 Ga0207662_100798782 180
320 3300025919 Ga0207657_10049807 Ga0207657_100498074 180
321 3300025919 Ga0207657_10221820 Ga0207657_102218202 180
322 3300025923 Ga0207681_10014124 Ga0207681_100141245 180
323 3300025926 Ga0207659_10373515 Ga0207659_103735152 180
324 3300025927 Ga0207687_10008495 Ga0207687_100084958 180
325 3300025931 Ga0207644_10001385 Ga0207644_1000138519 180
326 3300025931 Ga0207644_10730595 Ga0207644_107305951 180
327 3300025933 Ga0207706_10003507 Ga0207706_1000350714 180
328 3300025933 Ga0207706_10183638 Ga0207706_101836382 180
329 3300025934 Ga0207686_10012968 Ga0207686_100129684 180
330 3300025935 Ga0207709_10002689 Ga0207709_100026899 180
331 3300025936 Ga0207670_10114443 Ga0207670_101144432 180
332 3300025936 Ga0207670_10122532 Ga0207670_101225321 180
333 3300025938 Ga0207704_10001846 Ga0207704_100018468 180
334 3300025939 Ga0207665_10000813 Ga0207665_100008138 180
335 3300025939 Ga0207665_10371646 Ga0207665_103716461 180
336 3300025941 Ga0207711_10007348 Ga0207711_100073489 180
337 3300025941 Ga0207711_10014104 Ga0207711_100141044 180
338 3300025941 Ga0207711_10249246 Ga0207711_102492463 180
339 3300025949 Ga0207667_10371846 Ga0207667_103718462 180
340 3300025972 Ga0207668_10001801 Ga0207668_1000180110 180
341 3300025972 Ga0207668_10031761 Ga0207668_100317614 180
342 3300025972 Ga0207668_10259120 Ga0207668_102591202 180
343 3300025981 Ga0207640_10067449 Ga0207640_100674492 180
344 3300025986 Ga0207658_10018379 Ga0207658_100183792 180
345 3300025986 Ga0207658_10140676 Ga0207658_101406764 180
346 3300025986 Ga0207658_10168160 Ga0207658_101681603 180
347 3300025986 Ga0207658_10169008 Ga0207658_101690082 180
348 3300026023 Ga0207677_10113233 Ga0207677_101132333 180
349 3300026035 Ga0207703_10008408 Ga0207703_100084085 180
350 3300026041 Ga0207639_10041710 Ga0207639_100417103 180
351 3300026041 Ga0207639_10063759 Ga0207639_100637593 180
352 3300026067 Ga0207678_10081985 Ga0207678_100819853 180
353 3300026067 Ga0207678_10290611 Ga0207678_102906113 180
354 3300026075 Ga0207708_10003449 Ga0207708_100034498 180
355 3300026078 Ga0207702_10556340 Ga0207702_105563402 180
356 3300026088 Ga0207641_10012030 Ga0207641_100120302 180
357 3300026088 Ga0207641_10435499 Ga0207641_104354992 180
358 3300026088 Ga0207641_11002256 Ga0207641_110022561 180
359 3300026089 Ga0207648_10000268 Ga0207648_1000026816 180
360 3300026095 Ga0207676_10345569 Ga0207676_103455692 180
361 3300026118 Ga0207675_100000702 Ga0207675_10000070226 180
362 3300026118 Ga0207675_100157161 Ga0207675_1001571613 180
363 3300026121 Ga0207683_10000132 Ga0207683_1000013215 180
364 3300026142 Ga0207698_10157612 Ga0207698_101576122 180
365 3300028379 Ga0268266_10007011 Ga0268266_100070116 180
366 3300028379 Ga0268266_10289182 Ga0268266_102891822 180
367 3300028380 Ga0268265_10020654 Ga0268265_100206545 180
368 3300028381 Ga0268264_10000758 Ga0268264_100007588 180
369 3300028381 Ga0268264_10115828 Ga0268264_101158284 180
370 3300031728 Ga0316578_10049430 Ga0316578_100494301 180
371 3300031852 Ga0307410_10200787 Ga0307410_102007872 180
372 3300031852 Ga0307410_10206299 Ga0307410_102062992 180
373 3300031852 Ga0307410_10464508 Ga0307410_104645081 180
374 3300031903 Ga0307407_10011747 Ga0307407_100117472 180
375 3300031903 Ga0307407_10516110 Ga0307407_105161101 180
376 3300031903 Ga0307407_10679329 Ga0307407_106793291 180
377 3300031995 Ga0307409_100149313 Ga0307409_1001493132 180
378 3300031995 Ga0307409_100351442 Ga0307409_1003514423 180
379 3300031995 Ga0307409_100463169 Ga0307409_1004631692 180
380 3300031995 Ga0307409_100591902 Ga0307409_1005919021 180
381 3300032002 Ga0307416_100248521 Ga0307416_1002485213 180
382 3300032002 Ga0307416_101156561 Ga0307416_1011565612 180
383 3300032004 Ga0307414_10719971 Ga0307414_107199712 180
384 3300032005 Ga0307411_11200326 Ga0307411_112003261 180
385 3300032126 Ga0307415_100106228 Ga0307415_1001062282 180
386 3300035691 Ga0373931_0047970 Ga0373931_0047970_501_1043 180
387 3300036647 Ga0316582_0211792 Ga0316582_0211792_24_566 180
388 3300037312 Ga0395899_0063201 Ga0395899_0063201_121_690 180
389 3300037466 Ga0395898_0355234 Ga0395898_0355234_809_1378 180
390 3300037471 Ga0395905_0706803 Ga0395905_0706803_117_686 180
391 3300039437 Ga0436365_0152461 Ga0436365_0152461_2425_3000 180
392 3300039450 Ga0436363_0573861 Ga0436363_0573861_243_800 180
393 3300041411 Ga0439466_0021990 Ga0439466_0021990_307_849 180
394 3300041413 Ga0439465_0000929 Ga0439465_0000929_1086_1628 180
395 3300041452 Ga0451793_0734024 Ga0451793_0734024_916_1458 180
396 3300041456 Ga0451795_0605100 Ga0451795_0605100_79_621 180
397 3300041460 Ga0451802_0757034 Ga0451802_0757034_55_597 180
398 3300041491 Ga0451833_0118692 Ga0451833_0118692_115_657 180
399 3300042002 Ga0439442_104186 Ga0439442_104186_31_573 180
400 3300042004 Ga0439445_0012035 Ga0439445_0012035_1390_1932 180
401 3300042008 Ga0439450_054106 Ga0439450_054106_14_556 180
402 3300042435 Ga0439434_0056057 Ga0439434_0056057_105_647 180
403 3300044658 Ga0466972_0011149 Ga0466972_0011149_1459_2001 180
404 3300044658 Ga0466972_0112014 Ga0466972_0112014_286_828 180
405 3300044658 Ga0466972_0246703 Ga0466972_0246703_171_713 180
406 3300044683 Ga0466965_0020291 Ga0466965_0020291_2511_3053 180
407 3300044683 Ga0466965_0029020 Ga0466965_0029020_2019_2561 180
408 3300044684 Ga0466966_0029719 Ga0466966_0029719_967_1521 180
409 3300044684 Ga0466966_0472968 Ga0466966_0472968_181_723 180
410 3300044693 Ga0466961_0001791 Ga0466961_0001791_4143_4685 180
411 3300044693 Ga0466961_0013283 Ga0466961_0013283_2978_3532 180
412 3300044765 Ga0466970_0050522 Ga0466970_0050522_1193_1735 180
413 3300044765 Ga0466970_0057455 Ga0466970_0057455_1401_1943 180
414 3300044765 Ga0466970_0073891 Ga0466970_0073891_426_968 180
415 3300044765 Ga0466970_0132600 Ga0466970_0132600_320_862 180
416 3300044842 Ga0466957_0003746 Ga0466957_0003746_19_573 180
417 3300044901 Ga0466960_0183230 Ga0466960_0183230_507_1049 180
418 3300044901 Ga0466960_0218092 Ga0466960_0218092_458_1000 180
419 3300045049 Ga0466959_0020403 Ga0466959_0020403_1385_1939 180
420 3300045836 Ga0466958_0015008 Ga0466958_0015008_228_770 180
421 3300045836 Ga0466958_0030240 Ga0466958_0030240_1585_2139 180
422 3300045836 Ga0466958_0439829 Ga0466958_0439829_44_586 180
423 3300045976 Ga0466967_0109962 Ga0466967_0109962_1801_2343 180
424 3300045976 Ga0466967_0256414 Ga0466967_0256414_38_625 180
425 3300045976 Ga0466967_0422777 Ga0466967_0422777_417_986 180
426 3300046460 Ga0495638_0025434 Ga0495638_0025434_1593_2135 180
427 3300046461 Ga0495641_0067200 Ga0495641_0067200_761_1303 180
428 3300046473 Ga0495582_0525074 Ga0495582_0525074_90_632 180
429 3300046475 Ga0495639_0114319 Ga0495639_0114319_75_617 180
430 3300046524 Ga0495648_0002295 Ga0495648_0002295_3708_4250 180
431 3300046526 Ga0495666_0078831 Ga0495666_0078831_282_824 180
432 3300046530 Ga0495654_0041848 Ga0495654_0041848_393_935 180
433 3300046648 Ga0495611_0128291 Ga0495611_0128291_32_574 180
434 3300046660 Ga0495625_0085371 Ga0495625_0085371_176_718 180
435 3300046690 Ga0495624_0095181 Ga0495624_0095181_20_562 180
436 3300047315 Ga0495581_0188224 Ga0495581_0188224_254_796 180
437 3300047320 Ga0495672_0002577 Ga0495672_0002577_2498_3040 180
438 3300047320 Ga0495672_0030744 Ga0495672_0030744_681_1223 180
439 3300047469 Ga0495673_0000681 Ga0495673_0000681_13316_13858 180
440 3300047472 Ga0495686_0001156 Ga0495686_0001156_17076_17618 180
441 3300047673 Ga0495593_0005139 Ga0495593_0005139_4723_5265 180
442 3300048903 Ga0496100_0001111 Ga0496100_0001111_6273_6815 180
443 3300048903 Ga0496100_0031399 Ga0496100_0031399_1186_1731 180
444 3300048903 Ga0496100_0038939 Ga0496100_0038939_1937_2479 180
445 3300048904 Ga0496101_0000094 Ga0496101_0000094_44823_45365 180
446 3300048904 Ga0496101_0001150 Ga0496101_0001150_12263_12805 180
447 3300048904 Ga0496101_0026952 Ga0496101_0026952_1416_1958 180
448 3300048904 Ga0496101_0840694 Ga0496101_0840694_79_624 180
449 3300048905 Ga0496102_0000014 Ga0496102_0000014_163994_164536 180
450 3300048905 Ga0496102_0003943 Ga0496102_0003943_5309_5851 180
451 3300048905 Ga0496102_0011841 Ga0496102_0011841_555_1097 180
452 3300048905 Ga0496102_0063575 Ga0496102_0063575_1510_2052 180
453 3300048905 Ga0496102_0082846 Ga0496102_0082846_1874_2440 180
454 3300048906 Ga0496103_0000004 Ga0496103_0000004_164500_165042 180
455 3300048907 Ga0496104_0019292 Ga0496104_0019292_352_894 180
456 3300048908 Ga0496105_0005330 Ga0496105_0005330_1178_1720 180
457 3300048908 Ga0496105_0074506 Ga0496105_0074506_1640_2182 180
458 3300048909 Ga0496106_0003609 Ga0496106_0003609_9744_10286 180
459 3300048909 Ga0496106_0013804 Ga0496106_0013804_3718_4260 180
460 3300048909 Ga0496106_0034193 Ga0496106_0034193_1871_2413 180
461 3300048910 Ga0496107_0002101 Ga0496107_0002101_9986_10528 180
462 3300048910 Ga0496107_0028862 Ga0496107_0028862_3156_3698 180
463 3300048910 Ga0496107_0039662 Ga0496107_0039662_1129_1671 180
464 3300048911 Ga0496108_0392105 Ga0496108_0392105_560_1102 180
465 3300048911 Ga0496108_0450611 Ga0496108_0450611_321_863 180
466 3300048913 Ga0496110_0140117 Ga0496110_0140117_907_1449 180
467 3300048913 Ga0496110_1249006 Ga0496110_1249006_26_568 180
468 3300048914 Ga0496111_0082498 Ga0496111_0082498_537_1079 180
469 3300048914 Ga0496111_0443252 Ga0496111_0443252_270_812 180
470 3300048915 Ga0496112_0008418 Ga0496112_0008418_5009_5551 180
471 3300048915 Ga0496112_0141417 Ga0496112_0141417_481_1023 180
472 3300048916 Ga0496113_0081588 Ga0496113_0081588_1106_1648 180
473 3300048916 Ga0496113_0426567 Ga0496113_0426567_488_1030 180
474 3300048917 Ga0496114_0018600 Ga0496114_0018600_1705_2247 180
475 3300048918 Ga0496115_0002697 Ga0496115_0002697_8116_8658 180
476 3300048918 Ga0496115_0010746 Ga0496115_0010746_5953_6495 180
477 3300048919 Ga0496116_0000069 Ga0496116_0000069_165451_165993 180
478 3300048920 Ga0496117_0000003 Ga0496117_0000003_1362903_1363445 180
479 3300048920 Ga0496117_0175494 Ga0496117_0175494_226_792 180
480 3300048921 Ga0496118_0000001 Ga0496118_0000001_1362906_1363448 180
481 3300048921 Ga0496118_0000538 Ga0496118_0000538_4419_4985 180
482 3300048922 Ga0496119_0045000 Ga0496119_0045000_2086_2628 180
483 3300048924 Ga0496121_0000032 Ga0496121_0000032_253292_253834 180
484 3300048925 Ga0496122_0359550 Ga0496122_0359550_36_578 180
485 3300048929 Ga0496126_0000067 Ga0496126_0000067_147963_148505 180
486 3300049571 Ga0501034_0216353 Ga0501034_0216353_225_812 180
487 3300049581 Ga0501047_0046321 Ga0501047_0046321_1925_2512 180
488 3300049586 Ga0501070_0315003 Ga0501070_0315003_135_722 180
489 3300049744 Ga0501083_0058552 Ga0501083_0058552_1979_2530 180
490 3300049822 Ga0501035_0451710 Ga0501035_0451710_64_651 180
491 3300049823 Ga0501044_0032548 Ga0501044_0032548_69_611 180
492 3300050489 nmdc:mga03683_36754_c1 nmdc:mga03683_36754_c1_925_1467 180
493 3300050490 nmdc:mga03n38_46711_c1 nmdc:mga03n38_46711_c1_509_1051 180
494 3300050490 nmdc:mga03n38_60765_c1 nmdc:mga03n38_60765_c1_1089_1631 180
495 3300050491 nmdc:mga00v17_28468_c1 nmdc:mga00v17_28468_c1_1510_2052 180
496 3300050491 nmdc:mga00v17_30039_c1 nmdc:mga00v17_30039_c1_2531_3073 180
497 3300050491 nmdc:mga00v17_323012_c1 nmdc:mga00v17_323012_c1_151_693 180
498 3300050491 nmdc:mga00v17_47200_c1 nmdc:mga00v17_47200_c1_1155_1697 180
499 3300050491 nmdc:mga00v17_59077_c1 nmdc:mga00v17_59077_c1_277_834 180
500 3300050491 nmdc:mga00v17_6797_c1 nmdc:mga00v17_6797_c1_843_1385 180
501 3300050491 nmdc:mga00v17_71537_c1 nmdc:mga00v17_71537_c1_918_1460 180
502 3300050492 nmdc:mga0yw44_31556_c1 nmdc:mga0yw44_31556_c1_1322_1864 180
503 3300050492 nmdc:mga0yw44_365443_c1 nmdc:mga0yw44_365443_c1_286_828 180
504 3300050494 nmdc:mga06z11_158782_c1 nmdc:mga06z11_158782_c1_655_1197 180
505 3300050495 nmdc:mga04h51_197472_c1 nmdc:mga04h51_197472_c1_132_674 180
506 3300050507 nmdc:mga05p37_1273384_c1 nmdc:mga05p37_1273384_c1_168_710 180
507 3300050507 nmdc:mga05p37_495773_c1 nmdc:mga05p37_495773_c1_742_1284 180
508 3300050509 nmdc:mga0qj67_35032_c1 nmdc:mga0qj67_35032_c1_2207_2749 180
509 3300050509 nmdc:mga0qj67_36961_c1 nmdc:mga0qj67_36961_c1_2563_3105 180
510 3300050516 nmdc:mga0sz30_143314_c1 nmdc:mga0sz30_143314_c1_478_1020 180
511 3300050516 nmdc:mga0sz30_202281_c1 nmdc:mga0sz30_202281_c1_307_849 180
512 3300050516 nmdc:mga0sz30_243652_c1 nmdc:mga0sz30_243652_c1_128_670 180
513 3300050516 nmdc:mga0sz30_254319_c1 nmdc:mga0sz30_254319_c1_129_671 180
514 3300050516 nmdc:mga0sz30_3880_c1 nmdc:mga0sz30_3880_c1_1679_2221 180
515 3300050516 nmdc:mga0sz30_5156_c1 nmdc:mga0sz30_5156_c1_195_737 180
516 3300053077 Ga0495601_0493089 Ga0495601_0493089_10_552 180
517 3300053079 Ga0500610_0287457 Ga0500610_0287457_60_602 180
518 3300053080 Ga0500635_0006693 Ga0500635_0006693_1149_1691 180
519 3300053085 Ga0495619_0108988 Ga0495619_0108988_692_1234 180
520 3300053087 Ga0500643_002989 Ga0500643_002989_3158_3700 180
521 3300053088 Ga0500644_0282919 Ga0500644_0282919_96_638 180
522 3300053096 Ga0500641_0035588 Ga0500641_0035588_1249_1791 180
523 3300053104 Ga0500556_0129994 Ga0500556_0129994_81_623 180
524 3300053108 Ga0500562_044887 Ga0500562_044887_89_631 180
525 3300053131 Ga0500652_073270 Ga0500652_073270_322_864 180
526 3300053134 Ga0500658_0089534 Ga0500658_0089534_89_631 180
527 3300053139 Ga0500568_0179370 Ga0500568_0179370_12_554 180
528 3300053153 Ga0500616_0079914 Ga0500616_0079914_310_852 180
529 3300053158 Ga0500627_0083447 Ga0500627_0083447_774_1316 180
530 3300053730 Ga0500645_000057 Ga0500645_000057_55360_55902 180
531 3300053730 Ga0500645_071821 Ga0500645_071821_340_882 180
532 3300053730 Ga0500645_081689 Ga0500645_081689_42_584 180
533 3300005334 Ga0068869_100081214 Ga0068869_1000812142 182
534 3300005345 Ga0070692_10091668 Ga0070692_100916682 182
535 3300005347 Ga0070668_100102202 Ga0070668_1001022023 182
536 3300005353 Ga0070669_100048093 Ga0070669_1000480932 182
537 3300005365 Ga0070688_100100436 Ga0070688_1001004363 182
538 3300005366 Ga0070659_100105672 Ga0070659_1001056722 182
539 3300005367 Ga0070667_100161513 Ga0070667_1001615132 182
540 3300005437 Ga0070710_10002406 Ga0070710_100024067 182
541 3300005455 Ga0070663_100154605 Ga0070663_1001546052 182
542 3300005615 Ga0070702_100006249 Ga0070702_1000062494 182
543 3300005616 Ga0068852_100237036 Ga0068852_1002370362 182
544 3300005617 Ga0068859_100130496 Ga0068859_1001304963 182
545 3300006173 Ga0070716_100001209 Ga0070716_1000012098 182
546 3300006175 Ga0070712_100005808 Ga0070712_1000058088 182
547 3300006237 Ga0097621_100237672 Ga0097621_1002376721 182
548 3300006931 Ga0097620_100130482 Ga0097620_1001304823 182
549 3300017792 Ga0163161_10178942 Ga0163161_101789422 182
550 3300025885 Ga0207653_10055209 Ga0207653_100552092 182
551 3300025905 Ga0207685_10009797 Ga0207685_100097972 182
552 3300025915 Ga0207693_10003053 Ga0207693_100030538 182
553 3300025916 Ga0207663_10008276 Ga0207663_100082763 182
554 3300025932 Ga0207690_10068485 Ga0207690_100684853 182
555 3300025935 Ga0207709_10401005 Ga0207709_104010052 182
556 3300025939 Ga0207665_10005043 Ga0207665_100050434 182
557 3300026075 Ga0207708_10032998 Ga0207708_100329983 182
558 3300041413 Ga0439465_0098281 Ga0439465_0098281_366_914 182
559 3300044719 Ga0466971_0025244 Ga0466971_0025244_961_1548 182
560 3300049569 Ga0501032_0033580 Ga0501032_0033580_572_1120 182
561 3300049571 Ga0501034_0002951 Ga0501034_0002951_14810_15358 182
562 3300049572 Ga0501036_0178052 Ga0501036_0178052_544_1092 182
563 3300049573 Ga0501037_0009367 Ga0501037_0009367_3688_4236 182
564 3300049574 Ga0501038_0013969 Ga0501038_0013969_3689_4237 182
565 3300049575 Ga0501039_0013109 Ga0501039_0013109_4552_5100 182
566 3300049576 Ga0501040_0336202 Ga0501040_0336202_334_882 182
567 3300049579 Ga0501043_0002544 Ga0501043_0002544_4565_5113 182
568 3300049581 Ga0501047_0178902 Ga0501047_0178902_1396_1944 182
569 3300049583 Ga0501067_0094286 Ga0501067_0094286_209_757 182
570 3300049586 Ga0501070_0004875 Ga0501070_0004875_1595_2143 182
571 3300049589 Ga0501073_0015774 Ga0501073_0015774_2957_3505 182
572 3300049823 Ga0501044_0006818 Ga0501044_0006818_11504_12052 182
573 3300050490 nmdc:mga03n38_125600_c1 nmdc:mga03n38_125600_c1_69_617 182
574 3300050490 nmdc:mga03n38_160447_c1 nmdc:mga03n38_160447_c1_226_774 182
575 3300050492 nmdc:mga0yw44_243488_c1 nmdc:mga0yw44_243488_c1_627_1175 182
576 3300050496 nmdc:mga07m45_345083_c1 nmdc:mga07m45_345083_c1_113_661 182
577 3300050496 nmdc:mga07m45_497565_c1 nmdc:mga07m45_497565_c1_31_579 182
578 3300061719 Ga0466962_0014337 Ga0466962_0014337_246_833 182
579 3300005436 Ga0070713_100158980 Ga0070713_1001589803 183
580 3300021384 Ga0213876_10014315 Ga0213876_100143153 183
581 3300044765 Ga0466970_0082622 Ga0466970_0082622_1154_1708 183
582 3300045976 Ga0466967_0019311 Ga0466967_0019311_4397_4984 183
583 3300046507 Ga0495606_0030112 Ga0495606_0030112_1501_2052 183
584 3300053136 Ga0500559_0053630 Ga0500559_0053630_969_1520 183
585 3300005353 Ga0070669_100013949 Ga0070669_1000139492 184
586 3300005367 Ga0070667_100000087 Ga0070667_1000000875 184
587 3300005841 Ga0068863_100004572 Ga0068863_10000457210 184
588 3300005842 Ga0068858_100120360 Ga0068858_1001203603 184
589 3300005843 Ga0068860_100000020 Ga0068860_100000020160 184
590 3300005844 Ga0068862_100000013 Ga0068862_100000013142 184
591 3300009101 Ga0105247_10000009 Ga0105247_10000009262 184
592 3300009177 Ga0105248_10000197 Ga0105248_1000019743 184
593 3300009553 Ga0105249_10000057 Ga0105249_1000005746 184
594 3300014968 Ga0157379_10215053 Ga0157379_102150533 184
595 3300025900 Ga0207710_10000014 Ga0207710_10000014278 184
596 3300025923 Ga0207681_10001854 Ga0207681_100018544 184
597 3300025941 Ga0207711_10000146 Ga0207711_1000014629 184
598 3300025961 Ga0207712_10000050 Ga0207712_10000050111 184
599 3300025986 Ga0207658_10000065 Ga0207658_100000654 184
600 3300026035 Ga0207703_10642780 Ga0207703_106427801 184
601 3300026088 Ga0207641_10006204 Ga0207641_1000620411 184
602 3300028380 Ga0268265_10000004 Ga0268265_10000004111 184
603 3300028381 Ga0268264_10000024 Ga0268264_10000024110 184
604 3300048904 Ga0496101_0199299 Ga0496101_0199299_648_1202 184
605 3300048905 Ga0496102_0000691 Ga0496102_0000691_16086_16640 184
606 3300048906 Ga0496103_0000652 Ga0496103_0000652_22399_22953 184
607 3300048910 Ga0496107_0020240 Ga0496107_0020240_3945_4499 184
608 3300048919 Ga0496116_0088669 Ga0496116_0088669_1079_1633 184
609 3300048920 Ga0496117_0004834 Ga0496117_0004834_2414_2968 184
610 3300048921 Ga0496118_0000324 Ga0496118_0000324_63813_64367 184
611 3300048921 Ga0496118_0173725 Ga0496118_0173725_107_661 184
612 3300048922 Ga0496119_0004768 Ga0496119_0004768_11171_11725 184
613 3300048923 Ga0496120_0048585 Ga0496120_0048585_18_572 184
614 3300048924 Ga0496121_0002438 Ga0496121_0002438_11473_12027 184
615 3300048927 Ga0496124_0155404 Ga0496124_0155404_758_1312 184
616 3300048927 Ga0496124_0192782 Ga0496124_0192782_286_840 184
617 3300048928 Ga0496125_0021788 Ga0496125_0021788_3068_3622 184
618 3300009148 Ga0105243_10605431 Ga0105243_106054312 187
619 3300009176 Ga0105242_10030963 Ga0105242_100309632 187
620 3300009551 Ga0105238_10597014 Ga0105238_105970141 187
621 3300013308 Ga0157375_10093213 Ga0157375_100932133 187
622 3300048908 Ga0496105_0116600 Ga0496105_0116600_68_631 187
623 3300048913 Ga0496110_0139697 Ga0496110_0139697_342_905 187
624 3300048917 Ga0496114_0035329 Ga0496114_0035329_1892_2455 187
625 3300048918 Ga0496115_0481218 Ga0496115_0481218_364_927 187
626 3300005435 Ga0070714_100203481 Ga0070714_1002034812 190
627 3300044735 Ga0466968_0021812 Ga0466968_0021812_1032_1604 190
628 3300044765 Ga0466970_0066995 Ga0466970_0066995_392_964 190
629 3300044842 Ga0466957_0032109 Ga0466957_0032109_1806_2378 190
630 3300044901 Ga0466960_0112969 Ga0466960_0112969_802_1374 190
631 3300045049 Ga0466959_0161245 Ga0466959_0161245_177_749 190
632 3300049586 Ga0501070_0155696 Ga0501070_0155696_597_1208 190
633 3300005338 Ga0068868_100112144 Ga0068868_1001121441 191
634 3300009176 Ga0105242_10383816 Ga0105242_103838161 191
635 3300010375 Ga0105239_10850862 Ga0105239_108508621 191
636 3300041512 Ga0451853_3086809 Ga0451853_3086809_28_603 191
637 3300048911 Ga0496108_0136218 Ga0496108_0136218_589_1164 191
638 3300048912 Ga0496109_0294348 Ga0496109_0294348_865_1440 191
639 3300048914 Ga0496111_0166344 Ga0496111_0166344_427_1002 191
640 3300048915 Ga0496112_0013359 Ga0496112_0013359_4853_5428 191
641 3300050496 nmdc:mga07m45_107843_c1 nmdc:mga07m45_107843_c1_164_739 191
642 3300050511 nmdc:mga08y16_458640_c1 nmdc:mga08y16_458640_c1_429_1007 191
643 3300053083 Ga0495655_0010778 Ga0495655_0010778_569_1144 191
644 3300053129 Ga0500628_010050 Ga0500628_010050_566_1141 191
645 3300006048 Ga0075363_100005983 Ga0075363_1000059835 192
646 3300006051 Ga0075364_10022446 Ga0075364_100224464 192
647 3300006186 Ga0075369_10010862 Ga0075369_100108622 192
648 3300006353 Ga0075370_10013914 Ga0075370_100139144 192
649 3300013306 Ga0163162_10078408 Ga0163162_100784084 193
650 3300044693 Ga0466961_0174155 Ga0466961_0174155_213_797 193
651 3300025939 Ga0207665_10457766 Ga0207665_104577662 194
652 3300002075 JGI24738J21930_10037639 JGI24738J21930_100376392 195
653 3300005335 Ga0070666_10095521 Ga0070666_100955212 195
654 3300005455 Ga0070663_100049030 Ga0070663_1000490302 195
655 3300005543 Ga0070672_100276474 Ga0070672_1002764742 195
656 3300005578 Ga0068854_100239364 Ga0068854_1002393642 195
657 3300005614 Ga0068856_100422971 Ga0068856_1004229712 195
658 3300005719 Ga0068861_100305119 Ga0068861_1003051192 195
659 3300005840 Ga0068870_10191400 Ga0068870_101914002 195
660 3300005842 Ga0068858_100094598 Ga0068858_1000945982 195
661 3300005843 Ga0068860_100195540 Ga0068860_1001955403 195
662 3300005844 Ga0068862_100132570 Ga0068862_1001325702 195
663 3300005844 Ga0068862_100326463 Ga0068862_1003264632 195
664 3300006881 Ga0068865_100040668 Ga0068865_1000406684 195
665 3300009098 Ga0105245_10072810 Ga0105245_100728103 195
666 3300009101 Ga0105247_10103953 Ga0105247_101039533 195
667 3300009177 Ga0105248_10219646 Ga0105248_102196462 195
668 3300010375 Ga0105239_10187726 Ga0105239_101877263 195
669 3300011119 Ga0105246_10220404 Ga0105246_102204042 195
670 3300013105 Ga0157369_11748908 Ga0157369_117489081 195
671 3300013296 Ga0157374_10132991 Ga0157374_101329912 195
672 3300013306 Ga0163162_10431718 Ga0163162_104317182 195
673 3300013308 Ga0157375_10305259 Ga0157375_103052593 195
674 3300014325 Ga0163163_10035394 Ga0163163_100353941 195
675 3300014969 Ga0157376_10314972 Ga0157376_103149722 195
676 3300025901 Ga0207688_10010982 Ga0207688_100109823 195
677 3300025908 Ga0207643_10104713 Ga0207643_101047132 195
678 3300025927 Ga0207687_10074935 Ga0207687_100749353 195
679 3300025938 Ga0207704_10089265 Ga0207704_100892653 195
680 3300025940 Ga0207691_10145912 Ga0207691_101459122 195
681 3300025941 Ga0207711_10488253 Ga0207711_104882532 195
682 3300025961 Ga0207712_10011630 Ga0207712_100116305 195
683 3300026041 Ga0207639_10095059 Ga0207639_100950593 195
684 3300026067 Ga0207678_10076166 Ga0207678_100761662 195
685 3300026089 Ga0207648_10565507 Ga0207648_105655072 195
686 3300048903 Ga0496100_0970662 Ga0496100_0970662_25_612 195
687 3300048905 Ga0496102_0036464 Ga0496102_0036464_1821_2408 195
688 3300048905 Ga0496102_0266808 Ga0496102_0266808_494_1081 195
689 3300048907 Ga0496104_0218280 Ga0496104_0218280_352_939 195
690 3300048911 Ga0496108_0000409 Ga0496108_0000409_4360_4947 195
691 3300048912 Ga0496109_0001452 Ga0496109_0001452_11964_12551 195
692 3300050491 nmdc:mga00v17_68045_c1 nmdc:mga00v17_68045_c1_1011_1601 195
693 3300050492 nmdc:mga0yw44_97769_c1 nmdc:mga0yw44_97769_c1_343_933 195
694 3300050516 nmdc:mga0sz30_14117_c1 nmdc:mga0sz30_14117_c1_160_750 195

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03358

FMN_red

NADPH-dependent FMN reductase

37

185

0.94

PF02525

Flavodoxin_2

Flavodoxin-like fold

37

170

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
3svl-assembly1.cif.gz_B structural basis of the improvement of chrr - a multi-purpose enzyme 0.8896 19 193
1x77-assembly1.cif.gz_B crystal structure of a nad(p)h-dependent fmn reductase complexed with fmn 0.8757 19 189
3s2y-assembly1.cif.gz_A crystal structure of a chromate/uranium reductase from gluconacetobacter hansenii 0.8749 17 194
3u7r-assembly1.cif.gz_A ferb - flavoenzyme nad(p)h:(acceptor) oxidoreductase (ferb) from paracoccus denitrificans 0.8598 20 193
1x77-assembly1.cif.gz_B crystal structure of a nad(p)h-dependent fmn reductase complexed with fmn 0.8569 19 189
ID Description Score Start End Superfamily
af_P95105_3_183_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9688 16 192 3.40.50.360
af_P95105_3_183_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9426 16 192 3.40.50.360
3svlA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8921 19 194 3.40.50.360
1x77B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8757 19 189 3.40.50.360
3svlA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8645 19 194 3.40.50.360
ID Description Score Start End GO Terms
AF-A0A0J6WRG8-F1-model_v4 FMN-dependent NADPH-azoreductase (EC 1.7.-.-) 0.9804 34 194 GO:0005829
GO:0010181
GO:0016491
AF-A0A2S9FHX1-F1-model_v4 FMN reductase 0.9797 16 173 GO:0005829
GO:0010181
GO:0016491
AF-A0A0I9VKA0-F1-model_v4 FMN reductase 0.9741 38 194 GO:0005829
GO:0010181
GO:0016491
AF-A0A1G8R8N0-F1-model_v4 NAD(P)H-dependent FMN reductase 0.9716 17 164 GO:0005829
GO:0010181
GO:0016491
AF-A0A1V3XZI5-F1-model_v4 NADPH-dependent FMN reductase family protein 0.9677 60 194 GO:0005829
GO:0010181
GO:0016491

Feature Viewer

pLDDT pTM Quality
90.52 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map