F475701
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 694 | 321 | 680 | 182 |
Family's Representative Sequence
| Representative Sequence | 3300005335|Ga0070666_10095521|Ga0070666_100955212 |
| Length | 213 |
| Sequence | MRPCLQFSSGGINRTTVRLRRARIFQTTEGNVKVSDIKVIVLLGSLRATSINRQLAELAVEAAPEGVSLQLFDRLGELPFYNEDIDNDDVDEPVVALRAAAAEADAALVVTPEYNGSIPGVLKNAIDWLSRPFGNGALKDKPLAVVGAAAGQYGGVWAHDETRKSFGIAGPRVVEDLKLSVPAKSLDGKHPRANAEVAANLRDIVGKLAAEVA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221687 | Mycobacterium sp. Root135 | Isolate | Unclassified |
| 2 | 2643221715 | Mycobacterium sp. Root265 | Isolate | Unclassified |
| 3 | 2738541264 | Mycobacterium sp. OK889 | Isolate | Unclassified |
| 4 | 2738541274 | Mycobacterium sp. YR708 | Isolate | Unclassified |
| 5 | 2738541356 | Mycobacterium sp. OK887 | Isolate | Unclassified |
| 6 | 2738543028 | Mycobacterium sp. YR782 | Isolate | Unclassified |
| 7 | 2842134933 | Mycolicibacterium obuense SEMIA 442 | Isolate | Nodule |
| 8 | 2902792274 | Mycolicibacterium sp. P9-64 | Isolate | Unclassified |
| 9 | 2902799365 | Mycolicibacterium sp. P1-5 | Isolate | Unclassified |
| 10 | 2902810491 | Mycolicibacterium sp. P9-22 | Isolate | Unclassified |
| 11 | 2902837492 | Mycolicibacterium sp. P1-18 | Isolate | Unclassified |
| 12 | 2919051321 | Sinomonas atrocyanea 1003 | Isolate | Rhizosphere |
| 13 | 2929212328 | Mycolicibacterium sp. R-73050 Hybrid assembly | Isolate | Unclassified |
| 14 | 2939582691 | Mycolicibacterium sp. 624 | Isolate | Rhizosphere |
| 15 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 16 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 17 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 18 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 19 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 24 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 27 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 54 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 57 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 62 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 63 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 64 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 66 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 67 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 68 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 69 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 70 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 71 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 72 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 73 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 74 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 75 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 76 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 77 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 79 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 80 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 81 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 82 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 83 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 84 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 86 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 87 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 88 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 90 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 91 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 92 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 93 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 94 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 119 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 123 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 124 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 180 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 181 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 182 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 183 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 184 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 185 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 186 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 187 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 188 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 189 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 190 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 191 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 192 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 193 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 194 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 195 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 196 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 197 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 198 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 199 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 200 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 201 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 202 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 203 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 204 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 205 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 206 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 207 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 208 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 209 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 210 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 211 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 212 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 213 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 214 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 215 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 216 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 217 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 218 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 219 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 220 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 221 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 222 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 223 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 224 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 225 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 226 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 227 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 244 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 245 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 246 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 247 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 248 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 249 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 250 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 251 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 252 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 253 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 254 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 255 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 256 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 257 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 258 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 259 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 260 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 261 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 262 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 263 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 264 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 265 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 266 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 267 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 268 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 269 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 270 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 292 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 293 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 294 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 295 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 296 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 297 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 298 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 299 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 302 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 304 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 305 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 308 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 309 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 310 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 311 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 312 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 313 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 314 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 315 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 316 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 317 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 318 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 319 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 320 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.98 |
| Metatranscriptomes | 0 |
| Isolates | 2.02 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 14.27 |
| Nodule | 0.14 |
| Rhizoplane | 10.52 |
| Rhizosphere | 66.71 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.36 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24738J21930_10037639 | 3300002075 | Bacteria | 983 |
| 2 | JGI24751J29686_10004847 | 3300002459 | Bacteria | 2738 |
| 3 | rootH2_10074387 | 3300003320 | Bacteria | 1896 |
| 4 | Ga0055540_1000003 | 3300003792 | Bacteria | 428375 |
| 5 | Ga0055540_1000261 | 3300003792 | Bacteria | 47645 |
| 6 | Ga0055540_1002350 | 3300003792 | Bacteria | 10121 |
| 7 | Ga0055540_1005458 | 3300003792 | Bacteria | 5337 |
| 8 | Ga0070676_10216317 | 3300005328 | Bacteria | 1263 |
| 9 | Ga0070683_100102323 | 3300005329 | Bacteria | 2698 |
| 10 | Ga0070690_100100480 | 3300005330 | Bacteria | 1917 |
| 11 | Ga0070677_10059707 | 3300005333 | Bacteria | 1569 |
| 12 | Ga0068869_100081214 | 3300005334 | Bacteria | 2420 |
| 13 | Ga0070666_10095521 | 3300005335 | Bacteria | 2045 |
| 14 | Ga0070682_100033517 | 3300005337 | Bacteria | 3121 |
| 15 | Ga0068868_100077317 | 3300005338 | Bacteria | 2662 |
| 16 | Ga0068868_100112144 | 3300005338 | Bacteria | 2217 |
| 17 | Ga0070660_100210292 | 3300005339 | Bacteria | 1579 |
| 18 | Ga0070689_100239280 | 3300005340 | Bacteria | 1494 |
| 19 | Ga0070691_10008199 | 3300005341 | Bacteria | 4785 |
| 20 | Ga0070691_10094527 | 3300005341 | Bacteria | 1478 |
| 21 | Ga0070687_100062901 | 3300005343 | Bacteria | 1966 |
| 22 | Ga0070692_10079201 | 3300005345 | Bacteria | 1766 |
| 23 | Ga0070692_10091668 | 3300005345 | Bacteria | 1653 |
| 24 | Ga0070668_100003544 | 3300005347 | Bacteria | 11512 |
| 25 | Ga0070668_100073839 | 3300005347 | Bacteria | 2659 |
| 26 | Ga0070668_100102202 | 3300005347 | Bacteria | 2272 |
| 27 | Ga0070668_100148285 | 3300005347 | Bacteria | 1895 |
| 28 | Ga0070669_100013949 | 3300005353 | Bacteria | 5715 |
| 29 | Ga0070669_100048093 | 3300005353 | Bacteria | 3112 |
| 30 | Ga0070675_100459877 | 3300005354 | Bacteria | 1142 |
| 31 | Ga0070671_100006991 | 3300005355 | Bacteria | 9041 |
| 32 | Ga0070671_100603192 | 3300005355 | Bacteria | 949 |
| 33 | Ga0070674_100948979 | 3300005356 | Bacteria | 752 |
| 34 | Ga0070688_100100436 | 3300005365 | Bacteria | 1907 |
| 35 | Ga0070659_100105672 | 3300005366 | Bacteria | 2269 |
| 36 | Ga0070667_100000087 | 3300005367 | Bacteria | 114528 |
| 37 | Ga0070667_100001120 | 3300005367 | Bacteria | 24450 |
| 38 | Ga0070667_100051541 | 3300005367 | Bacteria | 3470 |
| 39 | Ga0070667_100161513 | 3300005367 | Bacteria | 1974 |
| 40 | Ga0070667_100201490 | 3300005367 | Bacteria | 1766 |
| 41 | Ga0070667_100324141 | 3300005367 | Bacteria | 1390 |
| 42 | Ga0070667_100953488 | 3300005367 | Bacteria | 800 |
| 43 | Ga0070703_10137064 | 3300005406 | Bacteria | 905 |
| 44 | Ga0070709_10031344 | 3300005434 | Bacteria | 3197 |
| 45 | Ga0070714_100055620 | 3300005435 | Bacteria | 3382 |
| 46 | Ga0070714_100193485 | 3300005435 | Bacteria | 1857 |
| 47 | Ga0070714_100203481 | 3300005435 | Bacteria | 1812 |
| 48 | Ga0070714_100818078 | 3300005435 | Bacteria | 903 |
| 49 | Ga0070713_100158980 | 3300005436 | Bacteria | 2016 |
| 50 | Ga0070713_100164711 | 3300005436 | Bacteria | 1982 |
| 51 | Ga0070710_10000360 | 3300005437 | Bacteria | 21408 |
| 52 | Ga0070710_10002406 | 3300005437 | Bacteria | 8862 |
| 53 | Ga0070701_10005732 | 3300005438 | Bacteria | 5162 |
| 54 | Ga0070711_100000487 | 3300005439 | Bacteria | 20650 |
| 55 | Ga0070711_100438613 | 3300005439 | Bacteria | 1067 |
| 56 | Ga0070705_100009225 | 3300005440 | Bacteria | 4901 |
| 57 | Ga0070705_100033171 | 3300005440 | Bacteria | 2875 |
| 58 | Ga0070700_100001945 | 3300005441 | Bacteria | 10472 |
| 59 | Ga0070700_100315949 | 3300005441 | Bacteria | 1146 |
| 60 | Ga0070694_100041160 | 3300005444 | Bacteria | 3081 |
| 61 | Ga0070663_100006881 | 3300005455 | Bacteria | 6882 |
| 62 | Ga0070663_100049030 | 3300005455 | Bacteria | 2997 |
| 63 | Ga0070663_100154605 | 3300005455 | Bacteria | 1762 |
| 64 | Ga0070663_100273321 | 3300005455 | Bacteria | 1344 |
| 65 | Ga0070663_100401737 | 3300005455 | Bacteria | 1120 |
| 66 | Ga0070663_101270761 | 3300005455 | Bacteria | 649 |
| 67 | Ga0070678_100000111 | 3300005456 | Bacteria | 31946 |
| 68 | Ga0070678_100025788 | 3300005456 | Bacteria | 3962 |
| 69 | Ga0070678_100196399 | 3300005456 | Bacteria | 1662 |
| 70 | Ga0070662_100012627 | 3300005457 | Bacteria | 5605 |
| 71 | Ga0070662_101157120 | 3300005457 | Bacteria | 664 |
| 72 | Ga0068867_100004844 | 3300005459 | Bacteria | 9467 |
| 73 | Ga0070685_10563589 | 3300005466 | Bacteria | 815 |
| 74 | Ga0070684_100111816 | 3300005535 | Bacteria | 2450 |
| 75 | Ga0068853_100125562 | 3300005539 | Bacteria | 2292 |
| 76 | Ga0068853_100300457 | 3300005539 | Bacteria | 1484 |
| 77 | Ga0070672_100071222 | 3300005543 | Bacteria | 2765 |
| 78 | Ga0070672_100276474 | 3300005543 | Bacteria | 1419 |
| 79 | Ga0070696_100001142 | 3300005546 | Bacteria | 17223 |
| 80 | Ga0070696_100078905 | 3300005546 | Bacteria | 2328 |
| 81 | Ga0070665_100002727 | 3300005548 | Bacteria | 19143 |
| 82 | Ga0070665_100193633 | 3300005548 | Bacteria | 2034 |
| 83 | Ga0070665_100746029 | 3300005548 | Bacteria | 992 |
| 84 | Ga0070704_100002785 | 3300005549 | Bacteria | 9892 |
| 85 | Ga0068855_100462303 | 3300005563 | Bacteria | 1384 |
| 86 | Ga0068854_100000417 | 3300005578 | Bacteria | 26634 |
| 87 | Ga0068854_100239364 | 3300005578 | Bacteria | 1444 |
| 88 | Ga0068854_101051561 | 3300005578 | Bacteria | 723 |
| 89 | Ga0068856_100114896 | 3300005614 | Bacteria | 2691 |
| 90 | Ga0068856_100422971 | 3300005614 | Bacteria | 1352 |
| 91 | Ga0070702_100006249 | 3300005615 | Bacteria | 5624 |
| 92 | Ga0068852_100038965 | 3300005616 | Bacteria | 3998 |
| 93 | Ga0068852_100237036 | 3300005616 | Bacteria | 1742 |
| 94 | Ga0068859_100015088 | 3300005617 | Bacteria | 7756 |
| 95 | Ga0068859_100130496 | 3300005617 | Bacteria | 2584 |
| 96 | Ga0068864_100259422 | 3300005618 | Bacteria | 1616 |
| 97 | Ga0068864_100289109 | 3300005618 | Bacteria | 1532 |
| 98 | Ga0068866_10000413 | 3300005718 | Bacteria | 19893 |
| 99 | Ga0068861_100000439 | 3300005719 | Bacteria | 24161 |
| 100 | Ga0068861_100305119 | 3300005719 | Bacteria | 1380 |
| 101 | Ga0068870_10191400 | 3300005840 | Bacteria | 1234 |
| 102 | Ga0068863_100004572 | 3300005841 | Bacteria | 13647 |
| 103 | Ga0068863_100027777 | 3300005841 | Bacteria | 5400 |
| 104 | Ga0068863_100592385 | 3300005841 | Bacteria | 1097 |
| 105 | Ga0068863_100650849 | 3300005841 | Bacteria | 1045 |
| 106 | Ga0068858_100002903 | 3300005842 | Bacteria | 17243 |
| 107 | Ga0068858_100094598 | 3300005842 | Bacteria | 2783 |
| 108 | Ga0068858_100120360 | 3300005842 | Bacteria | 2455 |
| 109 | Ga0068858_100260083 | 3300005842 | Bacteria | 1650 |
| 110 | Ga0068860_100000020 | 3300005843 | Bacteria | 283324 |
| 111 | Ga0068860_100195540 | 3300005843 | Bacteria | 1958 |
| 112 | Ga0068860_100283737 | 3300005843 | Bacteria | 1619 |
| 113 | Ga0068862_100000013 | 3300005844 | Bacteria | 263115 |
| 114 | Ga0068862_100002547 | 3300005844 | Bacteria | 16115 |
| 115 | Ga0068862_100132570 | 3300005844 | Bacteria | 2205 |
| 116 | Ga0068862_100326463 | 3300005844 | Bacteria | 1418 |
| 117 | Ga0081455_10012114 | 3300005937 | Bacteria | 8620 |
| 118 | Ga0081455_10043344 | 3300005937 | Bacteria | 3936 |
| 119 | Ga0081538_10013922 | 3300005981 | Bacteria | 6336 |
| 120 | Ga0070717_10584541 | 3300006028 | Bacteria | 1013 |
| 121 | Ga0075365_10025176 | 3300006038 | Bacteria | 3765 |
| 122 | Ga0075365_10037749 | 3300006038 | Bacteria | 3137 |
| 123 | Ga0075365_10044029 | 3300006038 | Bacteria | 2923 |
| 124 | Ga0075365_10398594 | 3300006038 | Bacteria | 971 |
| 125 | Ga0075368_10141345 | 3300006042 | Bacteria | 1003 |
| 126 | Ga0075368_10247730 | 3300006042 | Bacteria | 761 |
| 127 | Ga0075363_100005983 | 3300006048 | Bacteria | 5485 |
| 128 | Ga0075363_100020694 | 3300006048 | Bacteria | 3303 |
| 129 | Ga0075363_100098663 | 3300006048 | Bacteria | 1615 |
| 130 | Ga0075363_100151689 | 3300006048 | Bacteria | 1308 |
| 131 | Ga0075363_100155383 | 3300006048 | Bacteria | 1293 |
| 132 | Ga0075363_100157736 | 3300006048 | Bacteria | 1284 |
| 133 | Ga0075364_10005435 | 3300006051 | Bacteria | 7404 |
| 134 | Ga0075364_10022446 | 3300006051 | Bacteria | 3985 |
| 135 | Ga0075364_10024033 | 3300006051 | Bacteria | 3865 |
| 136 | Ga0075364_10051701 | 3300006051 | Bacteria | 2684 |
| 137 | Ga0075364_10059885 | 3300006051 | Bacteria | 2496 |
| 138 | Ga0075364_10060750 | 3300006051 | Bacteria | 2478 |
| 139 | Ga0075364_10065124 | 3300006051 | Bacteria | 2392 |
| 140 | Ga0075364_10082366 | 3300006051 | Bacteria | 2129 |
| 141 | Ga0075364_10493790 | 3300006051 | Bacteria | 837 |
| 142 | Ga0075364_10522846 | 3300006051 | Bacteria | 811 |
| 143 | Ga0075364_10586724 | 3300006051 | Bacteria | 761 |
| 144 | Ga0070715_10000371 | 3300006163 | Bacteria | 11267 |
| 145 | Ga0070716_100001209 | 3300006173 | Bacteria | 11367 |
| 146 | Ga0070716_100002231 | 3300006173 | Bacteria | 8928 |
| 147 | Ga0070716_100575793 | 3300006173 | Bacteria | 843 |
| 148 | Ga0070712_100000301 | 3300006175 | Bacteria | 27855 |
| 149 | Ga0070712_100005808 | 3300006175 | Bacteria | 7631 |
| 150 | Ga0070712_100255619 | 3300006175 | Bacteria | 1402 |
| 151 | Ga0075362_10028235 | 3300006177 | Bacteria | 2408 |
| 152 | Ga0075362_10175234 | 3300006177 | Bacteria | 1037 |
| 153 | Ga0075367_10001573 | 3300006178 | Bacteria | 9884 |
| 154 | Ga0075367_10110801 | 3300006178 | Bacteria | 1685 |
| 155 | Ga0075369_10004625 | 3300006186 | Bacteria | 5103 |
| 156 | Ga0075369_10010862 | 3300006186 | Bacteria | 3569 |
| 157 | Ga0075369_10012871 | 3300006186 | Bacteria | 3309 |
| 158 | Ga0075369_10014385 | 3300006186 | Bacteria | 3160 |
| 159 | Ga0075369_10016929 | 3300006186 | Bacteria | 2949 |
| 160 | Ga0075369_10350998 | 3300006186 | Bacteria | 692 |
| 161 | Ga0075369_10353427 | 3300006186 | Bacteria | 690 |
| 162 | Ga0097621_100237672 | 3300006237 | Bacteria | 1592 |
| 163 | Ga0075370_10009954 | 3300006353 | Bacteria | 4954 |
| 164 | Ga0075370_10013914 | 3300006353 | Bacteria | 4283 |
| 165 | Ga0075370_10098507 | 3300006353 | Bacteria | 1691 |
| 166 | Ga0068871_100007901 | 3300006358 | Bacteria | 7627 |
| 167 | Ga0075428_100069394 | 3300006844 | Bacteria | 3853 |
| 168 | Ga0075428_101171832 | 3300006844 | Bacteria | 810 |
| 169 | Ga0075430_100042525 | 3300006846 | Bacteria | 3842 |
| 170 | Ga0075430_100119887 | 3300006846 | Bacteria | 2193 |
| 171 | Ga0068865_100015576 | 3300006881 | Bacteria | 4850 |
| 172 | Ga0068865_100040668 | 3300006881 | Bacteria | 3161 |
| 173 | Ga0097620_100015089 | 3300006931 | Bacteria | 7756 |
| 174 | Ga0097620_100130482 | 3300006931 | Bacteria | 2584 |
| 175 | Ga0105250_10106293 | 3300009092 | Bacteria | 1148 |
| 176 | Ga0105240_10277901 | 3300009093 | Bacteria | 1925 |
| 177 | Ga0111539_10445761 | 3300009094 | Bacteria | 1507 |
| 178 | Ga0105245_10007624 | 3300009098 | Bacteria | 9478 |
| 179 | Ga0105245_10072810 | 3300009098 | Bacteria | 3122 |
| 180 | Ga0105245_11483380 | 3300009098 | Bacteria | 729 |
| 181 | Ga0105247_10000009 | 3300009101 | Bacteria | 385991 |
| 182 | Ga0105247_10002522 | 3300009101 | Bacteria | 12435 |
| 183 | Ga0105247_10103953 | 3300009101 | Bacteria | 1819 |
| 184 | Ga0105247_10167702 | 3300009101 | Bacteria | 1458 |
| 185 | Ga0105247_10237874 | 3300009101 | Bacteria | 1239 |
| 186 | Ga0114129_10572881 | 3300009147 | Bacteria | 1466 |
| 187 | Ga0114129_10608468 | 3300009147 | Bacteria | 1415 |
| 188 | Ga0105243_10004430 | 3300009148 | Bacteria | 11106 |
| 189 | Ga0105243_10605431 | 3300009148 | Bacteria | 1055 |
| 190 | Ga0105243_10858959 | 3300009148 | Bacteria | 899 |
| 191 | Ga0105242_10000106 | 3300009176 | Bacteria | 59999 |
| 192 | Ga0105242_10030963 | 3300009176 | Bacteria | 4272 |
| 193 | Ga0105242_10383816 | 3300009176 | Bacteria | 1307 |
| 194 | Ga0105248_10000197 | 3300009177 | Bacteria | 70131 |
| 195 | Ga0105248_10010396 | 3300009177 | Bacteria | 10249 |
| 196 | Ga0105248_10035396 | 3300009177 | Bacteria | 5585 |
| 197 | Ga0105248_10219646 | 3300009177 | Bacteria | 2140 |
| 198 | Ga0105248_10912345 | 3300009177 | Bacteria | 992 |
| 199 | Ga0105237_10003454 | 3300009545 | Bacteria | 18762 |
| 200 | Ga0105238_10597014 | 3300009551 | Bacteria | 1112 |
| 201 | Ga0105249_10000057 | 3300009553 | Bacteria | 159358 |
| 202 | Ga0105249_10002095 | 3300009553 | Bacteria | 17303 |
| 203 | Ga0105249_10031693 | 3300009553 | Bacteria | 4781 |
| 204 | Ga0105249_10127933 | 3300009553 | Bacteria | 2421 |
| 205 | Ga0105239_10003754 | 3300010375 | Bacteria | 18490 |
| 206 | Ga0105239_10012567 | 3300010375 | Bacteria | 9425 |
| 207 | Ga0105239_10032634 | 3300010375 | Bacteria | 5722 |
| 208 | Ga0105239_10187726 | 3300010375 | Bacteria | 2313 |
| 209 | Ga0105239_10752564 | 3300010375 | Bacteria | 1115 |
| 210 | Ga0105239_10850862 | 3300010375 | Bacteria | 1046 |
| 211 | Ga0105239_11461098 | 3300010375 | Bacteria | 790 |
| 212 | Ga0105246_10220404 | 3300011119 | Bacteria | 1487 |
| 213 | Ga0157373_10321734 | 3300013100 | Bacteria | 1100 |
| 214 | Ga0157369_10048427 | 3300013105 | Bacteria | 4612 |
| 215 | Ga0157369_10187107 | 3300013105 | Bacteria | 2177 |
| 216 | Ga0157369_11748908 | 3300013105 | Bacteria | 632 |
| 217 | Ga0157374_10132991 | 3300013296 | Bacteria | 2409 |
| 218 | Ga0157378_10023502 | 3300013297 | Bacteria | 5423 |
| 219 | Ga0157378_10232927 | 3300013297 | Bacteria | 1756 |
| 220 | Ga0163162_10056300 | 3300013306 | Bacteria | 3961 |
| 221 | Ga0163162_10078408 | 3300013306 | Bacteria | 3369 |
| 222 | Ga0163162_10431718 | 3300013306 | Bacteria | 1449 |
| 223 | Ga0157372_10021676 | 3300013307 | Bacteria | 6945 |
| 224 | Ga0157375_10093213 | 3300013308 | Bacteria | 3077 |
| 225 | Ga0157375_10305259 | 3300013308 | Bacteria | 1755 |
| 226 | Ga0157375_10799292 | 3300013308 | Bacteria | 1092 |
| 227 | Ga0163163_10035394 | 3300014325 | Bacteria | 4843 |
| 228 | Ga0163163_10312656 | 3300014325 | Bacteria | 1624 |
| 229 | Ga0163163_10677977 | 3300014325 | Bacteria | 1094 |
| 230 | Ga0157380_10000450 | 3300014326 | Bacteria | 25111 |
| 231 | Ga0182008_10307940 | 3300014497 | Bacteria | 830 |
| 232 | Ga0157379_10012525 | 3300014968 | Bacteria | 7407 |
| 233 | Ga0157379_10215053 | 3300014968 | Bacteria | 1741 |
| 234 | Ga0157379_10605115 | 3300014968 | Bacteria | 1023 |
| 235 | Ga0157379_10637313 | 3300014968 | Bacteria | 997 |
| 236 | Ga0157376_10080507 | 3300014969 | Bacteria | 2794 |
| 237 | Ga0157376_10314972 | 3300014969 | Bacteria | 1486 |
| 238 | Ga0163161_10000992 | 3300017792 | Bacteria | 21679 |
| 239 | Ga0163161_10178942 | 3300017792 | Bacteria | 1625 |
| 240 | Ga0213876_10012776 | 3300021384 | Bacteria | 4463 |
| 241 | Ga0213876_10014315 | 3300021384 | Bacteria | 4205 |
| 242 | Ga0213876_10467669 | 3300021384 | Bacteria | 671 |
| 243 | Ga0213875_10012599 | 3300021388 | Bacteria | 4168 |
| 244 | Ga0213875_10259009 | 3300021388 | Bacteria | 821 |
| 245 | Ga0209051_1000011 | 3300025303 | Bacteria | 610828 |
| 246 | Ga0209051_1000659 | 3300025303 | Bacteria | 38923 |
| 247 | Ga0209051_1001255 | 3300025303 | Bacteria | 22688 |
| 248 | Ga0209051_1002943 | 3300025303 | Bacteria | 11629 |
| 249 | Ga0209051_1022605 | 3300025303 | Bacteria | 2643 |
| 250 | Ga0209051_1049106 | 3300025303 | Bacteria | 1424 |
| 251 | Ga0207696_1067320 | 3300025711 | Bacteria | 999 |
| 252 | Ga0207653_10055209 | 3300025885 | Bacteria | 1330 |
| 253 | Ga0207692_10038315 | 3300025898 | Bacteria | 2350 |
| 254 | Ga0207642_10005614 | 3300025899 | Bacteria | 4107 |
| 255 | Ga0207710_10000014 | 3300025900 | Bacteria | 408072 |
| 256 | Ga0207710_10015701 | 3300025900 | Bacteria | 3203 |
| 257 | Ga0207688_10000522 | 3300025901 | Bacteria | 18610 |
| 258 | Ga0207688_10010982 | 3300025901 | Bacteria | 4927 |
| 259 | Ga0207647_10058117 | 3300025904 | Bacteria | 2369 |
| 260 | Ga0207685_10007577 | 3300025905 | Bacteria | 3034 |
| 261 | Ga0207685_10009797 | 3300025905 | Bacteria | 2799 |
| 262 | Ga0207699_10176429 | 3300025906 | Bacteria | 1433 |
| 263 | Ga0207645_10008738 | 3300025907 | Bacteria | 7053 |
| 264 | Ga0207643_10104713 | 3300025908 | Bacteria | 1662 |
| 265 | Ga0207695_10201798 | 3300025913 | Bacteria | 1902 |
| 266 | Ga0207671_10016098 | 3300025914 | Bacteria | 5826 |
| 267 | Ga0207671_10158470 | 3300025914 | Bacteria | 1752 |
| 268 | Ga0207693_10000181 | 3300025915 | Bacteria | 57362 |
| 269 | Ga0207693_10003053 | 3300025915 | Bacteria | 14460 |
| 270 | Ga0207693_10143190 | 3300025915 | Bacteria | 1880 |
| 271 | Ga0207663_10008276 | 3300025916 | Bacteria | 5431 |
| 272 | Ga0207663_10408902 | 3300025916 | Bacteria | 1039 |
| 273 | Ga0207660_10955437 | 3300025917 | Bacteria | 699 |
| 274 | Ga0207662_10079878 | 3300025918 | Bacteria | 1993 |
| 275 | Ga0207657_10049807 | 3300025919 | Bacteria | 3648 |
| 276 | Ga0207657_10221820 | 3300025919 | Bacteria | 1514 |
| 277 | Ga0207652_10481353 | 3300025921 | Bacteria | 1118 |
| 278 | Ga0207681_10001854 | 3300025923 | Bacteria | 13551 |
| 279 | Ga0207681_10014124 | 3300025923 | Bacteria | 4954 |
| 280 | Ga0207659_10373515 | 3300025926 | Bacteria | 1188 |
| 281 | Ga0207687_10008495 | 3300025927 | Bacteria | 6714 |
| 282 | Ga0207687_10074935 | 3300025927 | Bacteria | 2427 |
| 283 | Ga0207687_10567644 | 3300025927 | Bacteria | 953 |
| 284 | Ga0207664_10034467 | 3300025929 | Bacteria | 3899 |
| 285 | Ga0207664_10097283 | 3300025929 | Bacteria | 2424 |
| 286 | Ga0207664_10530419 | 3300025929 | Bacteria | 1055 |
| 287 | Ga0207644_10001385 | 3300025931 | Bacteria | 15631 |
| 288 | Ga0207644_10730595 | 3300025931 | Bacteria | 826 |
| 289 | Ga0207690_10068485 | 3300025932 | Bacteria | 2439 |
| 290 | Ga0207706_10003507 | 3300025933 | Bacteria | 14979 |
| 291 | Ga0207706_10183638 | 3300025933 | Bacteria | 1837 |
| 292 | Ga0207706_10782312 | 3300025933 | Bacteria | 811 |
| 293 | Ga0207686_10012968 | 3300025934 | Bacteria | 4599 |
| 294 | Ga0207709_10002689 | 3300025935 | Bacteria | 11000 |
| 295 | Ga0207709_10401005 | 3300025935 | Bacteria | 1049 |
| 296 | Ga0207670_10114443 | 3300025936 | Bacteria | 1950 |
| 297 | Ga0207670_10122532 | 3300025936 | Bacteria | 1892 |
| 298 | Ga0207704_10001846 | 3300025938 | Bacteria | 9484 |
| 299 | Ga0207704_10089265 | 3300025938 | Bacteria | 2019 |
| 300 | Ga0207665_10000813 | 3300025939 | Bacteria | 21107 |
| 301 | Ga0207665_10005043 | 3300025939 | Bacteria | 8815 |
| 302 | Ga0207665_10371646 | 3300025939 | Bacteria | 1083 |
| 303 | Ga0207665_10457766 | 3300025939 | Bacteria | 980 |
| 304 | Ga0207691_10145912 | 3300025940 | Bacteria | 2083 |
| 305 | Ga0207711_10000146 | 3300025941 | Bacteria | 74464 |
| 306 | Ga0207711_10007348 | 3300025941 | Bacteria | 9221 |
| 307 | Ga0207711_10014104 | 3300025941 | Bacteria | 6640 |
| 308 | Ga0207711_10249246 | 3300025941 | Bacteria | 1630 |
| 309 | Ga0207711_10488253 | 3300025941 | Bacteria | 1147 |
| 310 | Ga0207661_10083325 | 3300025944 | Bacteria | 2646 |
| 311 | Ga0207667_10371846 | 3300025949 | Bacteria | 1456 |
| 312 | Ga0207712_10000050 | 3300025961 | Bacteria | 159469 |
| 313 | Ga0207712_10011630 | 3300025961 | Bacteria | 5610 |
| 314 | Ga0207668_10001801 | 3300025972 | Bacteria | 12504 |
| 315 | Ga0207668_10031761 | 3300025972 | Bacteria | 3482 |
| 316 | Ga0207668_10259120 | 3300025972 | Bacteria | 1416 |
| 317 | Ga0207640_10067449 | 3300025981 | Bacteria | 2394 |
| 318 | Ga0207640_10381062 | 3300025981 | Bacteria | 1143 |
| 319 | Ga0207658_10000065 | 3300025986 | Bacteria | 117079 |
| 320 | Ga0207658_10000911 | 3300025986 | Bacteria | 24512 |
| 321 | Ga0207658_10018379 | 3300025986 | Bacteria | 4828 |
| 322 | Ga0207658_10140676 | 3300025986 | Bacteria | 1952 |
| 323 | Ga0207658_10168160 | 3300025986 | Bacteria | 1803 |
| 324 | Ga0207658_10169008 | 3300025986 | Bacteria | 1799 |
| 325 | Ga0207658_10285796 | 3300025986 | Bacteria | 1416 |
| 326 | Ga0207677_10113233 | 3300026023 | Bacteria | 2025 |
| 327 | Ga0207703_10008408 | 3300026035 | Bacteria | 8159 |
| 328 | Ga0207703_10642780 | 3300026035 | Bacteria | 1006 |
| 329 | Ga0207703_10981890 | 3300026035 | Bacteria | 810 |
| 330 | Ga0207639_10041710 | 3300026041 | Bacteria | 3436 |
| 331 | Ga0207639_10063759 | 3300026041 | Bacteria | 2855 |
| 332 | Ga0207639_10095059 | 3300026041 | Bacteria | 2394 |
| 333 | Ga0207678_10076166 | 3300026067 | Bacteria | 2873 |
| 334 | Ga0207678_10081985 | 3300026067 | Bacteria | 2760 |
| 335 | Ga0207678_10290611 | 3300026067 | Bacteria | 1404 |
| 336 | Ga0207708_10003449 | 3300026075 | Bacteria | 11654 |
| 337 | Ga0207708_10032998 | 3300026075 | Bacteria | 3931 |
| 338 | Ga0207702_10556340 | 3300026078 | Bacteria | 1123 |
| 339 | Ga0207641_10006204 | 3300026088 | Bacteria | 10113 |
| 340 | Ga0207641_10012030 | 3300026088 | Bacteria | 7099 |
| 341 | Ga0207641_10435499 | 3300026088 | Bacteria | 1265 |
| 342 | Ga0207641_11002256 | 3300026088 | Bacteria | 832 |
| 343 | Ga0207648_10000268 | 3300026089 | Bacteria | 56658 |
| 344 | Ga0207648_10565507 | 3300026089 | Bacteria | 1046 |
| 345 | Ga0207676_10345569 | 3300026095 | Bacteria | 1374 |
| 346 | Ga0207676_10661230 | 3300026095 | Bacteria | 1009 |
| 347 | Ga0207675_100000702 | 3300026118 | Bacteria | 33154 |
| 348 | Ga0207675_100157161 | 3300026118 | Bacteria | 2167 |
| 349 | Ga0207675_100358379 | 3300026118 | Bacteria | 1430 |
| 350 | Ga0207683_10000132 | 3300026121 | Bacteria | 61177 |
| 351 | Ga0207698_10157612 | 3300026142 | Bacteria | 1980 |
| 352 | Ga0268266_10007011 | 3300028379 | Bacteria | 10234 |
| 353 | Ga0268266_10289182 | 3300028379 | Bacteria | 1526 |
| 354 | Ga0268265_10000004 | 3300028380 | Bacteria | 648376 |
| 355 | Ga0268265_10020654 | 3300028380 | Bacteria | 4600 |
| 356 | Ga0268264_10000024 | 3300028381 | Bacteria | 470081 |
| 357 | Ga0268264_10000758 | 3300028381 | Bacteria | 36107 |
| 358 | Ga0268264_10115828 | 3300028381 | Bacteria | 2355 |
| 359 | Ga0265327_10011780 | 3300031251 | Bacteria | 5983 |
| 360 | Ga0316578_10049430 | 3300031728 | Bacteria | 2458 |
| 361 | Ga0307405_10267140 | 3300031731 | Bacteria | 1281 |
| 362 | Ga0307413_10110174 | 3300031824 | Bacteria | 1842 |
| 363 | Ga0307410_10200787 | 3300031852 | Bacteria | 1522 |
| 364 | Ga0307410_10206299 | 3300031852 | Bacteria | 1504 |
| 365 | Ga0307410_10464508 | 3300031852 | Bacteria | 1035 |
| 366 | Ga0307406_10186365 | 3300031901 | Bacteria | 1515 |
| 367 | Ga0307407_10011747 | 3300031903 | Bacteria | 4183 |
| 368 | Ga0307407_10516110 | 3300031903 | Bacteria | 878 |
| 369 | Ga0307407_10679329 | 3300031903 | Bacteria | 774 |
| 370 | Ga0307409_100149313 | 3300031995 | Bacteria | 2027 |
| 371 | Ga0307409_100351442 | 3300031995 | Bacteria | 1391 |
| 372 | Ga0307409_100463169 | 3300031995 | Bacteria | 1226 |
| 373 | Ga0307409_100591902 | 3300031995 | Bacteria | 1095 |
| 374 | Ga0307416_100248521 | 3300032002 | Bacteria | 1729 |
| 375 | Ga0307416_101156561 | 3300032002 | Bacteria | 879 |
| 376 | Ga0307414_10719971 | 3300032004 | Bacteria | 905 |
| 377 | Ga0307411_11200326 | 3300032005 | Bacteria | 688 |
| 378 | Ga0307415_100106228 | 3300032126 | Bacteria | 2072 |
| 379 | Ga0373931_0047970 | 3300035691 | Bacteria | 2262 |
| 380 | Ga0373947_0297791 | 3300035725 | Bacteria | 1075 |
| 381 | Ga0316582_0211792 | 3300036647 | Bacteria | 1324 |
| 382 | Ga0395899_0034523 | 3300037312 | Bacteria | 3799 |
| 383 | Ga0395899_0063201 | 3300037312 | Bacteria | 2724 |
| 384 | Ga0395900_1164664 | 3300037418 | Bacteria | 687 |
| 385 | Ga0395898_0008900 | 3300037466 | Bacteria | 10577 |
| 386 | Ga0395898_0355234 | 3300037466 | Bacteria | 1397 |
| 387 | Ga0395898_0921908 | 3300037466 | Bacteria | 811 |
| 388 | Ga0395905_0706803 | 3300037471 | Bacteria | 910 |
| 389 | Ga0436364_0033630 | 3300037853 | Bacteria | 4612 |
| 390 | Ga0436364_1070124 | 3300037853 | Bacteria | 1418 |
| 391 | Ga0436364_1389257 | 3300037853 | Bacteria | 3461 |
| 392 | Ga0436365_0152461 | 3300039437 | Bacteria | 40083 |
| 393 | Ga0436365_0555334 | 3300039437 | Bacteria | 1666 |
| 394 | Ga0436365_0666432 | 3300039437 | Bacteria | 30356 |
| 395 | Ga0436360_0029208 | 3300039438 | Bacteria | 891 |
| 396 | Ga0436363_0573861 | 3300039450 | Bacteria | 1233 |
| 397 | Ga0439466_0006183 | 3300041411 | Bacteria | 4561 |
| 398 | Ga0439466_0011813 | 3300041411 | Bacteria | 3224 |
| 399 | Ga0439466_0021990 | 3300041411 | Bacteria | 2254 |
| 400 | Ga0439465_0000929 | 3300041413 | Bacteria | 9290 |
| 401 | Ga0439465_0007762 | 3300041413 | Bacteria | 3402 |
| 402 | Ga0439465_0022012 | 3300041413 | Bacteria | 2001 |
| 403 | Ga0439465_0098281 | 3300041413 | Bacteria | 1008 |
| 404 | Ga0451793_0734024 | 3300041452 | Bacteria | 2228 |
| 405 | Ga0451795_0605100 | 3300041456 | Bacteria | 631 |
| 406 | Ga0451802_0757034 | 3300041460 | Bacteria | 643 |
| 407 | Ga0451833_0118692 | 3300041491 | Bacteria | 747 |
| 408 | Ga0451853_3086809 | 3300041512 | Bacteria | 653 |
| 409 | Ga0439442_003455 | 3300042002 | Bacteria | 3125 |
| 410 | Ga0439442_104186 | 3300042002 | Bacteria | 615 |
| 411 | Ga0439445_0012035 | 3300042004 | Bacteria | 2072 |
| 412 | Ga0439450_054106 | 3300042008 | Bacteria | 959 |
| 413 | Ga0439434_0011229 | 3300042435 | Bacteria | 2645 |
| 414 | Ga0439434_0056057 | 3300042435 | Bacteria | 1227 |
| 415 | Ga0466969_0141788 | 3300044656 | Bacteria | 1110 |
| 416 | Ga0466972_0011149 | 3300044658 | Bacteria | 4510 |
| 417 | Ga0466972_0112014 | 3300044658 | Bacteria | 1289 |
| 418 | Ga0466972_0246703 | 3300044658 | Bacteria | 835 |
| 419 | Ga0466965_0020291 | 3300044683 | Bacteria | 3193 |
| 420 | Ga0466965_0029020 | 3300044683 | Bacteria | 2690 |
| 421 | Ga0466966_0000270 | 3300044684 | Bacteria | 33912 |
| 422 | Ga0466966_0029719 | 3300044684 | Bacteria | 3553 |
| 423 | Ga0466966_0472968 | 3300044684 | Bacteria | 753 |
| 424 | Ga0466961_0001791 | 3300044693 | Bacteria | 13309 |
| 425 | Ga0466961_0013283 | 3300044693 | Bacteria | 5270 |
| 426 | Ga0466961_0174155 | 3300044693 | Bacteria | 1338 |
| 427 | Ga0466963_0017219 | 3300044694 | Bacteria | 4502 |
| 428 | Ga0466963_0043835 | 3300044694 | Bacteria | 2943 |
| 429 | Ga0466963_0202563 | 3300044694 | Bacteria | 1388 |
| 430 | Ga0466963_0327393 | 3300044694 | Bacteria | 1078 |
| 431 | Ga0466971_0025244 | 3300044719 | Bacteria | 2654 |
| 432 | Ga0466968_0002759 | 3300044735 | Bacteria | 6489 |
| 433 | Ga0466968_0021812 | 3300044735 | Bacteria | 2596 |
| 434 | Ga0466970_0023280 | 3300044765 | Bacteria | 3234 |
| 435 | Ga0466970_0050522 | 3300044765 | Bacteria | 2218 |
| 436 | Ga0466970_0057455 | 3300044765 | Bacteria | 2080 |
| 437 | Ga0466970_0066995 | 3300044765 | Bacteria | 1927 |
| 438 | Ga0466970_0073891 | 3300044765 | Bacteria | 1835 |
| 439 | Ga0466970_0082622 | 3300044765 | Bacteria | 1738 |
| 440 | Ga0466970_0132600 | 3300044765 | Bacteria | 1369 |
| 441 | Ga0466957_0002330 | 3300044842 | Bacteria | 10179 |
| 442 | Ga0466957_0003746 | 3300044842 | Bacteria | 8402 |
| 443 | Ga0466957_0032109 | 3300044842 | Bacteria | 3142 |
| 444 | Ga0466960_0001766 | 3300044901 | Bacteria | 7931 |
| 445 | Ga0466960_0112969 | 3300044901 | Bacteria | 1413 |
| 446 | Ga0466960_0183230 | 3300044901 | Bacteria | 1136 |
| 447 | Ga0466960_0218092 | 3300044901 | Bacteria | 1049 |
| 448 | Ga0466959_0003159 | 3300045049 | Bacteria | 10686 |
| 449 | Ga0466959_0020403 | 3300045049 | Bacteria | 4882 |
| 450 | Ga0466959_0161245 | 3300045049 | Bacteria | 1576 |
| 451 | Ga0466958_0015008 | 3300045836 | Bacteria | 4432 |
| 452 | Ga0466958_0030240 | 3300045836 | Bacteria | 3215 |
| 453 | Ga0466958_0038213 | 3300045836 | Bacteria | 2880 |
| 454 | Ga0466958_0439829 | 3300045836 | Bacteria | 844 |
| 455 | Ga0466967_0019311 | 3300045976 | Bacteria | 5476 |
| 456 | Ga0466967_0037557 | 3300045976 | Bacteria | 4146 |
| 457 | Ga0466967_0041722 | 3300045976 | Bacteria | 3959 |
| 458 | Ga0466967_0109962 | 3300045976 | Bacteria | 2531 |
| 459 | Ga0466967_0256414 | 3300045976 | Bacteria | 1672 |
| 460 | Ga0466967_0422777 | 3300045976 | Bacteria | 1299 |
| 461 | Ga0466967_0771242 | 3300045976 | Bacteria | 954 |
| 462 | Ga0495638_0025434 | 3300046460 | Bacteria | 3848 |
| 463 | Ga0495641_0067200 | 3300046461 | Bacteria | 1612 |
| 464 | Ga0495582_0525074 | 3300046473 | Bacteria | 684 |
| 465 | Ga0495639_0114319 | 3300046475 | Bacteria | 1283 |
| 466 | Ga0495606_0030112 | 3300046507 | Bacteria | 3797 |
| 467 | Ga0495648_0002295 | 3300046524 | Bacteria | 17835 |
| 468 | Ga0495666_0078831 | 3300046526 | Bacteria | 1560 |
| 469 | Ga0495654_0041848 | 3300046530 | Bacteria | 2277 |
| 470 | Ga0495611_0128291 | 3300046648 | Bacteria | 1183 |
| 471 | Ga0495625_0085371 | 3300046660 | Bacteria | 2191 |
| 472 | Ga0495624_0095181 | 3300046690 | Bacteria | 1836 |
| 473 | Ga0495581_0188224 | 3300047315 | Bacteria | 1207 |
| 474 | Ga0495672_0002577 | 3300047320 | Bacteria | 16477 |
| 475 | Ga0495672_0030744 | 3300047320 | Bacteria | 3362 |
| 476 | Ga0495673_0000681 | 3300047469 | Bacteria | 33251 |
| 477 | Ga0495686_0001156 | 3300047472 | Bacteria | 30978 |
| 478 | Ga0495593_0005139 | 3300047673 | Bacteria | 7736 |
| 479 | Ga0496100_0000076 | 3300048903 | Bacteria | 54910 |
| 480 | Ga0496100_0001111 | 3300048903 | Bacteria | 13043 |
| 481 | Ga0496100_0031399 | 3300048903 | Bacteria | 3303 |
| 482 | Ga0496100_0038939 | 3300048903 | Bacteria | 3016 |
| 483 | Ga0496100_0238164 | 3300048903 | Bacteria | 1342 |
| 484 | Ga0496100_0970662 | 3300048903 | Bacteria | 668 |
| 485 | Ga0496101_0000084 | 3300048904 | Bacteria | 104071 |
| 486 | Ga0496101_0000094 | 3300048904 | Bacteria | 95577 |
| 487 | Ga0496101_0001150 | 3300048904 | Bacteria | 15826 |
| 488 | Ga0496101_0026952 | 3300048904 | Bacteria | 3996 |
| 489 | Ga0496101_0199299 | 3300048904 | Bacteria | 1547 |
| 490 | Ga0496101_0456448 | 3300048904 | Bacteria | 1008 |
| 491 | Ga0496101_0840694 | 3300048904 | Bacteria | 723 |
| 492 | Ga0496102_0000014 | 3300048905 | Bacteria | 310241 |
| 493 | Ga0496102_0000691 | 3300048905 | Bacteria | 33503 |
| 494 | Ga0496102_0003943 | 3300048905 | Bacteria | 12573 |
| 495 | Ga0496102_0011841 | 3300048905 | Bacteria | 7528 |
| 496 | Ga0496102_0036464 | 3300048905 | Bacteria | 4430 |
| 497 | Ga0496102_0063575 | 3300048905 | Bacteria | 3380 |
| 498 | Ga0496102_0082846 | 3300048905 | Bacteria | 2959 |
| 499 | Ga0496102_0260044 | 3300048905 | Bacteria | 1636 |
| 500 | Ga0496102_0266808 | 3300048905 | Bacteria | 1614 |
| 501 | Ga0496103_0000004 | 3300048906 | Bacteria | 510080 |
| 502 | Ga0496103_0000652 | 3300048906 | Bacteria | 26249 |
| 503 | Ga0496103_0002282 | 3300048906 | Bacteria | 12121 |
| 504 | Ga0496104_0019292 | 3300048907 | Bacteria | 6236 |
| 505 | Ga0496104_0218280 | 3300048907 | Bacteria | 1819 |
| 506 | Ga0496105_0005330 | 3300048908 | Bacteria | 9745 |
| 507 | Ga0496105_0074506 | 3300048908 | Bacteria | 2804 |
| 508 | Ga0496105_0116600 | 3300048908 | Bacteria | 2203 |
| 509 | Ga0496106_0002300 | 3300048909 | Bacteria | 14254 |
| 510 | Ga0496106_0003609 | 3300048909 | Bacteria | 11537 |
| 511 | Ga0496106_0013804 | 3300048909 | Bacteria | 5968 |
| 512 | Ga0496106_0034193 | 3300048909 | Bacteria | 3796 |
| 513 | Ga0496107_0001067 | 3300048910 | Bacteria | 16439 |
| 514 | Ga0496107_0002101 | 3300048910 | Bacteria | 12756 |
| 515 | Ga0496107_0020240 | 3300048910 | Bacteria | 4698 |
| 516 | Ga0496107_0028862 | 3300048910 | Bacteria | 3945 |
| 517 | Ga0496107_0039662 | 3300048910 | Bacteria | 3379 |
| 518 | Ga0496108_0000409 | 3300048911 | Bacteria | 35236 |
| 519 | Ga0496108_0136218 | 3300048911 | Bacteria | 2113 |
| 520 | Ga0496108_0392105 | 3300048911 | Bacteria | 1213 |
| 521 | Ga0496108_0450611 | 3300048911 | Bacteria | 1124 |
| 522 | Ga0496108_0453423 | 3300048911 | Bacteria | 1120 |
| 523 | Ga0496109_0000098 | 3300048912 | Bacteria | 90126 |
| 524 | Ga0496109_0001452 | 3300048912 | Bacteria | 19635 |
| 525 | Ga0496109_0294348 | 3300048912 | Bacteria | 1530 |
| 526 | Ga0496110_0002401 | 3300048913 | Bacteria | 14027 |
| 527 | Ga0496110_0139697 | 3300048913 | Bacteria | 2190 |
| 528 | Ga0496110_0140117 | 3300048913 | Bacteria | 2186 |
| 529 | Ga0496110_1249006 | 3300048913 | Bacteria | 652 |
| 530 | Ga0496111_0011927 | 3300048914 | Bacteria | 5872 |
| 531 | Ga0496111_0082498 | 3300048914 | Bacteria | 2348 |
| 532 | Ga0496111_0166344 | 3300048914 | Bacteria | 1638 |
| 533 | Ga0496111_0443252 | 3300048914 | Bacteria | 958 |
| 534 | Ga0496112_0008418 | 3300048915 | Bacteria | 9234 |
| 535 | Ga0496112_0013359 | 3300048915 | Bacteria | 7580 |
| 536 | Ga0496112_0074708 | 3300048915 | Bacteria | 3352 |
| 537 | Ga0496112_0141417 | 3300048915 | Bacteria | 2376 |
| 538 | Ga0496113_0081588 | 3300048916 | Bacteria | 2479 |
| 539 | Ga0496113_0103416 | 3300048916 | Bacteria | 2209 |
| 540 | Ga0496113_0426567 | 3300048916 | Bacteria | 1065 |
| 541 | Ga0496114_0000647 | 3300048917 | Bacteria | 25675 |
| 542 | Ga0496114_0018600 | 3300048917 | Bacteria | 5621 |
| 543 | Ga0496114_0035329 | 3300048917 | Bacteria | 4127 |
| 544 | Ga0496114_0338716 | 3300048917 | Bacteria | 1330 |
| 545 | Ga0496115_0002697 | 3300048918 | Bacteria | 12743 |
| 546 | Ga0496115_0003548 | 3300048918 | Bacteria | 11224 |
| 547 | Ga0496115_0010746 | 3300048918 | Bacteria | 6846 |
| 548 | Ga0496115_0481218 | 3300048918 | Bacteria | 1000 |
| 549 | Ga0496116_0000069 | 3300048919 | Bacteria | 252643 |
| 550 | Ga0496116_0006505 | 3300048919 | Bacteria | 10587 |
| 551 | Ga0496116_0088669 | 3300048919 | Bacteria | 1889 |
| 552 | Ga0496117_0000003 | 3300048920 | Bacteria | 1881097 |
| 553 | Ga0496117_0004834 | 3300048920 | Bacteria | 14566 |
| 554 | Ga0496117_0175494 | 3300048920 | Bacteria | 1238 |
| 555 | Ga0496118_0000001 | 3300048921 | Bacteria | 1881100 |
| 556 | Ga0496118_0000324 | 3300048921 | Bacteria | 82637 |
| 557 | Ga0496118_0000538 | 3300048921 | Bacteria | 62335 |
| 558 | Ga0496118_0173725 | 3300048921 | Bacteria | 1312 |
| 559 | Ga0496119_0004768 | 3300048922 | Bacteria | 13318 |
| 560 | Ga0496119_0010866 | 3300048922 | Bacteria | 7609 |
| 561 | Ga0496119_0045000 | 3300048922 | Bacteria | 2772 |
| 562 | Ga0496120_0019168 | 3300048923 | Bacteria | 4385 |
| 563 | Ga0496120_0048585 | 3300048923 | Bacteria | 2441 |
| 564 | Ga0496120_0220817 | 3300048923 | Bacteria | 905 |
| 565 | Ga0496121_0000016 | 3300048924 | Bacteria | 562911 |
| 566 | Ga0496121_0000032 | 3300048924 | Bacteria | 378997 |
| 567 | Ga0496121_0002438 | 3300048924 | Bacteria | 28440 |
| 568 | Ga0496122_0000526 | 3300048925 | Bacteria | 79269 |
| 569 | Ga0496122_0359550 | 3300048925 | Bacteria | 756 |
| 570 | Ga0496123_0003559 | 3300048926 | Bacteria | 17267 |
| 571 | Ga0496124_0000015 | 3300048927 | Bacteria | 460700 |
| 572 | Ga0496124_0155404 | 3300048927 | Bacteria | 1789 |
| 573 | Ga0496124_0192782 | 3300048927 | Bacteria | 1557 |
| 574 | Ga0496125_0000021 | 3300048928 | Bacteria | 460688 |
| 575 | Ga0496125_0021788 | 3300048928 | Bacteria | 5962 |
| 576 | Ga0496125_0158370 | 3300048928 | Bacteria | 1543 |
| 577 | Ga0496126_0000015 | 3300048929 | Bacteria | 663212 |
| 578 | Ga0496126_0000067 | 3300048929 | Bacteria | 249091 |
| 579 | Ga0496126_0003991 | 3300048929 | Bacteria | 18027 |
| 580 | Ga0496126_0026840 | 3300048929 | Bacteria | 5514 |
| 581 | Ga0501031_0213661 | 3300049568 | Bacteria | 1257 |
| 582 | Ga0501032_0007006 | 3300049569 | Bacteria | 8267 |
| 583 | Ga0501032_0033580 | 3300049569 | Bacteria | 3514 |
| 584 | Ga0501033_0035813 | 3300049570 | Bacteria | 3721 |
| 585 | Ga0501033_0073853 | 3300049570 | Bacteria | 2504 |
| 586 | Ga0501034_0002951 | 3300049571 | Bacteria | 19708 |
| 587 | Ga0501034_0006780 | 3300049571 | Bacteria | 12247 |
| 588 | Ga0501034_0216353 | 3300049571 | Bacteria | 1870 |
| 589 | Ga0501036_0178052 | 3300049572 | Bacteria | 1790 |
| 590 | Ga0501037_0009367 | 3300049573 | Bacteria | 7188 |
| 591 | Ga0501038_0013969 | 3300049574 | Bacteria | 7318 |
| 592 | Ga0501039_0013109 | 3300049575 | Bacteria | 6338 |
| 593 | Ga0501040_0336202 | 3300049576 | Bacteria | 1081 |
| 594 | Ga0501043_0002544 | 3300049579 | Bacteria | 15415 |
| 595 | Ga0501043_0043622 | 3300049579 | Bacteria | 3525 |
| 596 | Ga0501046_0000660 | 3300049580 | Bacteria | 33434 |
| 597 | Ga0501047_0046321 | 3300049581 | Bacteria | 4203 |
| 598 | Ga0501047_0178902 | 3300049581 | Bacteria | 1988 |
| 599 | Ga0501048_0006465 | 3300049582 | Bacteria | 8908 |
| 600 | Ga0501067_0094286 | 3300049583 | Bacteria | 1662 |
| 601 | Ga0501069_0120892 | 3300049585 | Bacteria | 1495 |
| 602 | Ga0501070_0001595 | 3300049586 | Bacteria | 20107 |
| 603 | Ga0501070_0004875 | 3300049586 | Bacteria | 11465 |
| 604 | Ga0501070_0155696 | 3300049586 | Bacteria | 1884 |
| 605 | Ga0501070_0295656 | 3300049586 | Bacteria | 1320 |
| 606 | Ga0501070_0315003 | 3300049586 | Bacteria | 1273 |
| 607 | Ga0501073_0015774 | 3300049589 | Bacteria | 5475 |
| 608 | Ga0501073_0211285 | 3300049589 | Bacteria | 1341 |
| 609 | Ga0501080_0059561 | 3300049742 | Bacteria | 3553 |
| 610 | Ga0501083_0058552 | 3300049744 | Bacteria | 2578 |
| 611 | Ga0501035_0001453 | 3300049822 | Bacteria | 24288 |
| 612 | Ga0501035_0007175 | 3300049822 | Bacteria | 10425 |
| 613 | Ga0501035_0451710 | 3300049822 | Bacteria | 1063 |
| 614 | Ga0501044_0005246 | 3300049823 | Bacteria | 14415 |
| 615 | Ga0501044_0006818 | 3300049823 | Bacteria | 12585 |
| 616 | Ga0501044_0015265 | 3300049823 | Bacteria | 8274 |
| 617 | Ga0501044_0032548 | 3300049823 | Bacteria | 5481 |
| 618 | nmdc:mga03683_36754_c1 | 3300050489 | Bacteria | 1993 |
| 619 | nmdc:mga03n38_125600_c1 | 3300050490 | Bacteria | 1266 |
| 620 | nmdc:mga03n38_160447_c1 | 3300050490 | Bacteria | 1138 |
| 621 | nmdc:mga03n38_46711_c1 | 3300050490 | Bacteria | 1913 |
| 622 | nmdc:mga03n38_60765_c1 | 3300050490 | Bacteria | 1719 |
| 623 | nmdc:mga03n38_762_c1 | 3300050490 | Bacteria | 8528 |
| 624 | nmdc:mga00v17_175124_c1 | 3300050491 | Bacteria | 1384 |
| 625 | nmdc:mga00v17_28468_c1 | 3300050491 | Bacteria | 3272 |
| 626 | nmdc:mga00v17_30039_c1 | 3300050491 | Bacteria | 3194 |
| 627 | nmdc:mga00v17_323012_c1 | 3300050491 | Bacteria | 1003 |
| 628 | nmdc:mga00v17_47200_c1 | 3300050491 | Bacteria | 2608 |
| 629 | nmdc:mga00v17_59077_c1 | 3300050491 | Bacteria | 2351 |
| 630 | nmdc:mga00v17_6797_c1 | 3300050491 | Bacteria | 6078 |
| 631 | nmdc:mga00v17_68045_c1 | 3300050491 | Bacteria | 2201 |
| 632 | nmdc:mga00v17_71537_c1 | 3300050491 | Bacteria | 2150 |
| 633 | nmdc:mga00v17_8645_c1 | 3300050491 | Bacteria | 5485 |
| 634 | nmdc:mga0yw44_243488_c1 | 3300050492 | Bacteria | 1196 |
| 635 | nmdc:mga0yw44_31556_c1 | 3300050492 | Bacteria | 3082 |
| 636 | nmdc:mga0yw44_365443_c1 | 3300050492 | Bacteria | 973 |
| 637 | nmdc:mga0yw44_474275_c1 | 3300050492 | Bacteria | 848 |
| 638 | nmdc:mga0yw44_97769_c1 | 3300050492 | Bacteria | 1865 |
| 639 | nmdc:mga06z11_158782_c1 | 3300050494 | Bacteria | 1291 |
| 640 | nmdc:mga04h51_197472_c1 | 3300050495 | Bacteria | 789 |
| 641 | nmdc:mga07m45_107843_c1 | 3300050496 | Bacteria | 1602 |
| 642 | nmdc:mga07m45_19085_c1 | 3300050496 | Bacteria | 3712 |
| 643 | nmdc:mga07m45_345083_c1 | 3300050496 | Bacteria | 865 |
| 644 | nmdc:mga07m45_497565_c1 | 3300050496 | Bacteria | 706 |
| 645 | nmdc:mga05p37_1273384_c1 | 3300050507 | Bacteria | 752 |
| 646 | nmdc:mga05p37_495773_c1 | 3300050507 | Bacteria | 1403 |
| 647 | nmdc:mga0qj67_35032_c1 | 3300050509 | Bacteria | 3923 |
| 648 | nmdc:mga0qj67_36961_c1 | 3300050509 | Bacteria | 3823 |
| 649 | nmdc:mga08y16_458640_c1 | 3300050511 | Bacteria | 1299 |
| 650 | nmdc:mga0sz30_14117_c1 | 3300050516 | Bacteria | 3138 |
| 651 | nmdc:mga0sz30_143314_c1 | 3300050516 | Bacteria | 1055 |
| 652 | nmdc:mga0sz30_202281_c1 | 3300050516 | Bacteria | 882 |
| 653 | nmdc:mga0sz30_243652_c1 | 3300050516 | Bacteria | 800 |
| 654 | nmdc:mga0sz30_254319_c1 | 3300050516 | Bacteria | 782 |
| 655 | nmdc:mga0sz30_3880_c1 | 3300050516 | Bacteria | 5391 |
| 656 | nmdc:mga0sz30_5156_c1 | 3300050516 | Bacteria | 4781 |
| 657 | nmdc:mga0sz30_6380_c1 | 3300050516 | Bacteria | 4378 |
| 658 | Ga0495601_0493089 | 3300053077 | Bacteria | 791 |
| 659 | Ga0500610_0287457 | 3300053079 | Bacteria | 733 |
| 660 | Ga0500635_0006693 | 3300053080 | Bacteria | 3087 |
| 661 | Ga0495655_0010778 | 3300053083 | Bacteria | 1816 |
| 662 | Ga0495619_0108988 | 3300053085 | Bacteria | 1890 |
| 663 | Ga0500643_002989 | 3300053087 | Bacteria | 8377 |
| 664 | Ga0500644_0282919 | 3300053088 | Bacteria | 706 |
| 665 | Ga0500641_0035588 | 3300053096 | Bacteria | 1988 |
| 666 | Ga0500556_0129994 | 3300053104 | Bacteria | 986 |
| 667 | Ga0500562_044887 | 3300053108 | Bacteria | 1177 |
| 668 | Ga0500628_010050 | 3300053129 | Bacteria | 1684 |
| 669 | Ga0500652_073270 | 3300053131 | Bacteria | 1421 |
| 670 | Ga0500658_0089534 | 3300053134 | Bacteria | 1329 |
| 671 | Ga0500559_0053630 | 3300053136 | Bacteria | 1785 |
| 672 | Ga0500568_0179370 | 3300053139 | Bacteria | 779 |
| 673 | Ga0500616_0079914 | 3300053153 | Bacteria | 1645 |
| 674 | Ga0500627_0083447 | 3300053158 | Bacteria | 1426 |
| 675 | Ga0500645_000057 | 3300053730 | Bacteria | 92092 |
| 676 | Ga0500645_071821 | 3300053730 | Bacteria | 993 |
| 677 | Ga0500645_081689 | 3300053730 | Bacteria | 922 |
| 678 | Ga0501084_0236001 | 3300054114 | Bacteria | 1544 |
| 679 | Ga0466962_0014337 | 3300061719 | Bacteria | 3820 |
| 680 | Ga0466962_0265577 | 3300061719 | Bacteria | 845 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048917 | Ga0496114_0338716 | Ga0496114_0338716_626_1156 | 158 |
| 2 | 3300005435 | Ga0070714_100055620 | Ga0070714_1000556205 | 168 |
| 3 | 3300025929 | Ga0207664_10530419 | Ga0207664_105304192 | 168 |
| 4 | 3300037853 | Ga0436364_1070124 | Ga0436364_1070124_630_1151 | 168 |
| 5 | 3300041411 | Ga0439466_0011813 | Ga0439466_0011813_85_645 | 168 |
| 6 | 3300042435 | Ga0439434_0011229 | Ga0439434_0011229_87_647 | 168 |
| 7 | 3300006051 | Ga0075364_10059885 | Ga0075364_100598853 | 170 |
| 8 | 3300006051 | Ga0075364_10586724 | Ga0075364_105867241 | 170 |
| 9 | 3300031731 | Ga0307405_10267140 | Ga0307405_102671402 | 170 |
| 10 | 3300031824 | Ga0307413_10110174 | Ga0307413_101101742 | 170 |
| 11 | 3300031901 | Ga0307406_10186365 | Ga0307406_101863652 | 170 |
| 12 | 3300041413 | Ga0439465_0007762 | Ga0439465_0007762_1489_2049 | 170 |
| 13 | 3300050491 | nmdc:mga00v17_175124_c1 | nmdc:mga00v17_175124_c1_513_1073 | 170 |
| 14 | 3300009093 | Ga0105240_10277901 | Ga0105240_102779012 | 171 |
| 15 | 3300037418 | Ga0395900_1164664 | Ga0395900_1164664_159_674 | 171 |
| 16 | 3300044694 | Ga0466963_0043835 | Ga0466963_0043835_1558_2088 | 171 |
| 17 | 3300044694 | Ga0466963_0202563 | Ga0466963_0202563_572_1102 | 171 |
| 18 | 3300044694 | Ga0466963_0327393 | Ga0466963_0327393_377_907 | 171 |
| 19 | 3300044842 | Ga0466957_0002330 | Ga0466957_0002330_7062_7592 | 171 |
| 20 | 3300044901 | Ga0466960_0001766 | Ga0466960_0001766_3248_3778 | 171 |
| 21 | 3300045836 | Ga0466958_0038213 | Ga0466958_0038213_1302_1832 | 171 |
| 22 | 3300045976 | Ga0466967_0041722 | Ga0466967_0041722_1910_2440 | 171 |
| 23 | 3300048929 | Ga0496126_0026840 | Ga0496126_0026840_2449_2979 | 171 |
| 24 | 3300049568 | Ga0501031_0213661 | Ga0501031_0213661_151_681 | 171 |
| 25 | 3300049569 | Ga0501032_0007006 | Ga0501032_0007006_617_1147 | 171 |
| 26 | 3300049571 | Ga0501034_0006780 | Ga0501034_0006780_9156_9686 | 171 |
| 27 | 3300049579 | Ga0501043_0043622 | Ga0501043_0043622_277_807 | 171 |
| 28 | 3300049580 | Ga0501046_0000660 | Ga0501046_0000660_2877_3407 | 171 |
| 29 | 3300049582 | Ga0501048_0006465 | Ga0501048_0006465_8108_8638 | 171 |
| 30 | 3300049585 | Ga0501069_0120892 | Ga0501069_0120892_297_827 | 171 |
| 31 | 3300049586 | Ga0501070_0001595 | Ga0501070_0001595_2884_3414 | 171 |
| 32 | 3300049589 | Ga0501073_0211285 | Ga0501073_0211285_628_1158 | 171 |
| 33 | 3300049742 | Ga0501080_0059561 | Ga0501080_0059561_2584_3114 | 171 |
| 34 | 3300049822 | Ga0501035_0007175 | Ga0501035_0007175_9748_10278 | 171 |
| 35 | 3300049823 | Ga0501044_0015265 | Ga0501044_0015265_1190_1720 | 171 |
| 36 | 3300054114 | Ga0501084_0236001 | Ga0501084_0236001_166_696 | 171 |
| 37 | 3300013308 | Ga0157375_10799292 | Ga0157375_107992922 | 172 |
| 38 | 3300037312 | Ga0395899_0034523 | Ga0395899_0034523_1758_2342 | 172 |
| 39 | 3300037466 | Ga0395898_0008900 | Ga0395898_0008900_5037_5621 | 172 |
| 40 | 3300037853 | Ga0436364_0033630 | Ga0436364_0033630_1833_2366 | 172 |
| 41 | 3300039437 | Ga0436365_0666432 | Ga0436365_0666432_2182_2715 | 172 |
| 42 | 3300041411 | Ga0439466_0006183 | Ga0439466_0006183_2372_2914 | 172 |
| 43 | 3300041413 | Ga0439465_0022012 | Ga0439465_0022012_694_1236 | 172 |
| 44 | 3300042002 | Ga0439442_003455 | Ga0439442_003455_2170_2712 | 172 |
| 45 | 3300035725 | Ga0373947_0297791 | Ga0373947_0297791_90_614 | 174 |
| 46 | 3300044656 | Ga0466969_0141788 | Ga0466969_0141788_245_769 | 174 |
| 47 | 3300044684 | Ga0466966_0000270 | Ga0466966_0000270_10050_10574 | 174 |
| 48 | 3300044694 | Ga0466963_0017219 | Ga0466963_0017219_2542_3066 | 174 |
| 49 | 3300044735 | Ga0466968_0002759 | Ga0466968_0002759_4112_4636 | 174 |
| 50 | 3300044765 | Ga0466970_0023280 | Ga0466970_0023280_1898_2422 | 174 |
| 51 | 3300045049 | Ga0466959_0003159 | Ga0466959_0003159_5468_5992 | 174 |
| 52 | 3300061719 | Ga0466962_0265577 | Ga0466962_0265577_191_715 | 174 |
| 53 | iso_pu_bacteria | 2919051321 | 2919051807 | 174 |
| 54 | iso_pu_bacteria | 2738541264 | 2738665250 | 175 |
| 55 | iso_pu_bacteria | 2738541356 | 2739144384 | 175 |
| 56 | 3300005578 | Ga0068854_101051561 | Ga0068854_1010515611 | 176 |
| 57 | iso_pu_bacteria | 2643221687 | 2644486619 | 176 |
| 58 | iso_pu_bacteria | 2738541274 | 2738705503 | 176 |
| 59 | iso_pu_bacteria | 2738543028 | 2739332292 | 176 |
| 60 | iso_pu_bacteria | 2842134933 | 2842138637 | 176 |
| 61 | iso_pu_bacteria | 2902792274 | 2902798225 | 176 |
| 62 | iso_pu_bacteria | 2902799365 | 2902801866 | 176 |
| 63 | iso_pu_bacteria | 2902837492 | 2902838967 | 176 |
| 64 | iso_pu_bacteria | 2929212328 | 2929214657 | 176 |
| 65 | 3300021384 | Ga0213876_10467669 | Ga0213876_104676691 | 177 |
| 66 | 3300025981 | Ga0207640_10381062 | Ga0207640_103810622 | 177 |
| 67 | 3300039437 | Ga0436365_0555334 | Ga0436365_0555334_275_835 | 177 |
| 68 | 3300045976 | Ga0466967_0771242 | Ga0466967_0771242_229_789 | 177 |
| 69 | 3300005356 | Ga0070674_100948979 | Ga0070674_1009489791 | 178 |
| 70 | 3300005618 | Ga0068864_100259422 | Ga0068864_1002594222 | 178 |
| 71 | 3300025927 | Ga0207687_10567644 | Ga0207687_105676441 | 178 |
| 72 | 3300025986 | Ga0207658_10285796 | Ga0207658_102857963 | 178 |
| 73 | 3300026095 | Ga0207676_10661230 | Ga0207676_106612302 | 178 |
| 74 | 3300037466 | Ga0395898_0921908 | Ga0395898_0921908_125_712 | 178 |
| 75 | 3300003320 | rootH2_10074387 | rootH2_100743873 | 179 |
| 76 | 3300003792 | Ga0055540_1000003 | Ga0055540_1000003300 | 179 |
| 77 | 3300005329 | Ga0070683_100102323 | Ga0070683_1001023231 | 179 |
| 78 | 3300005347 | Ga0070668_100073839 | Ga0070668_1000738394 | 179 |
| 79 | 3300005367 | Ga0070667_100001120 | Ga0070667_10000112013 | 179 |
| 80 | 3300005435 | Ga0070714_100193485 | Ga0070714_1001934851 | 179 |
| 81 | 3300005435 | Ga0070714_100818078 | Ga0070714_1008180781 | 179 |
| 82 | 3300005436 | Ga0070713_100164711 | Ga0070713_1001647115 | 179 |
| 83 | 3300005439 | Ga0070711_100438613 | Ga0070711_1004386131 | 179 |
| 84 | 3300005937 | Ga0081455_10043344 | Ga0081455_100433445 | 179 |
| 85 | 3300006028 | Ga0070717_10584541 | Ga0070717_105845412 | 179 |
| 86 | 3300006042 | Ga0075368_10141345 | Ga0075368_101413452 | 179 |
| 87 | 3300006175 | Ga0070712_100255619 | Ga0070712_1002556194 | 179 |
| 88 | 3300009148 | Ga0105243_10858959 | Ga0105243_108589591 | 179 |
| 89 | 3300010375 | Ga0105239_10032634 | Ga0105239_100326342 | 179 |
| 90 | 3300013105 | Ga0157369_10048427 | Ga0157369_100484273 | 179 |
| 91 | 3300013306 | Ga0163162_10056300 | Ga0163162_100563003 | 179 |
| 92 | 3300014325 | Ga0163163_10677977 | Ga0163163_106779771 | 179 |
| 93 | 3300021384 | Ga0213876_10012776 | Ga0213876_100127765 | 179 |
| 94 | 3300021388 | Ga0213875_10012599 | Ga0213875_100125994 | 179 |
| 95 | 3300021388 | Ga0213875_10259009 | Ga0213875_102590091 | 179 |
| 96 | 3300025303 | Ga0209051_1000011 | Ga0209051_1000011296 | 179 |
| 97 | 3300025913 | Ga0207695_10201798 | Ga0207695_102017982 | 179 |
| 98 | 3300025921 | Ga0207652_10481353 | Ga0207652_104813531 | 179 |
| 99 | 3300025929 | Ga0207664_10034467 | Ga0207664_100344675 | 179 |
| 100 | 3300025929 | Ga0207664_10097283 | Ga0207664_100972834 | 179 |
| 101 | 3300025933 | Ga0207706_10782312 | Ga0207706_107823122 | 179 |
| 102 | 3300025944 | Ga0207661_10083325 | Ga0207661_100833251 | 179 |
| 103 | 3300025986 | Ga0207658_10000911 | Ga0207658_1000091112 | 179 |
| 104 | 3300026035 | Ga0207703_10981890 | Ga0207703_109818902 | 179 |
| 105 | 3300026118 | Ga0207675_100358379 | Ga0207675_1003583792 | 179 |
| 106 | 3300031251 | Ga0265327_10011780 | Ga0265327_100117803 | 179 |
| 107 | 3300037853 | Ga0436364_1389257 | Ga0436364_1389257_2893_3435 | 179 |
| 108 | 3300039438 | Ga0436360_0029208 | Ga0436360_0029208_54_608 | 179 |
| 109 | 3300045976 | Ga0466967_0037557 | Ga0466967_0037557_1975_2514 | 179 |
| 110 | 3300048903 | Ga0496100_0000076 | Ga0496100_0000076_7702_8241 | 179 |
| 111 | 3300048903 | Ga0496100_0238164 | Ga0496100_0238164_728_1267 | 179 |
| 112 | 3300048904 | Ga0496101_0000084 | Ga0496101_0000084_51402_51941 | 179 |
| 113 | 3300048904 | Ga0496101_0456448 | Ga0496101_0456448_194_733 | 179 |
| 114 | 3300048905 | Ga0496102_0260044 | Ga0496102_0260044_64_603 | 179 |
| 115 | 3300048906 | Ga0496103_0002282 | Ga0496103_0002282_3216_3755 | 179 |
| 116 | 3300048909 | Ga0496106_0002300 | Ga0496106_0002300_13678_14217 | 179 |
| 117 | 3300048910 | Ga0496107_0001067 | Ga0496107_0001067_6994_7533 | 179 |
| 118 | 3300048911 | Ga0496108_0453423 | Ga0496108_0453423_75_614 | 179 |
| 119 | 3300048912 | Ga0496109_0000098 | Ga0496109_0000098_87002_87541 | 179 |
| 120 | 3300048913 | Ga0496110_0002401 | Ga0496110_0002401_5896_6435 | 179 |
| 121 | 3300048914 | Ga0496111_0011927 | Ga0496111_0011927_4397_4936 | 179 |
| 122 | 3300048915 | Ga0496112_0074708 | Ga0496112_0074708_195_734 | 179 |
| 123 | 3300048916 | Ga0496113_0103416 | Ga0496113_0103416_943_1482 | 179 |
| 124 | 3300048917 | Ga0496114_0000647 | Ga0496114_0000647_21396_21935 | 179 |
| 125 | 3300048918 | Ga0496115_0003548 | Ga0496115_0003548_7431_7970 | 179 |
| 126 | 3300048919 | Ga0496116_0006505 | Ga0496116_0006505_5742_6281 | 179 |
| 127 | 3300048922 | Ga0496119_0010866 | Ga0496119_0010866_78_617 | 179 |
| 128 | 3300048923 | Ga0496120_0019168 | Ga0496120_0019168_3778_4317 | 179 |
| 129 | 3300048923 | Ga0496120_0220817 | Ga0496120_0220817_49_588 | 179 |
| 130 | 3300048924 | Ga0496121_0000016 | Ga0496121_0000016_213129_213668 | 179 |
| 131 | 3300048925 | Ga0496122_0000526 | Ga0496122_0000526_32107_32646 | 179 |
| 132 | 3300048926 | Ga0496123_0003559 | Ga0496123_0003559_3846_4385 | 179 |
| 133 | 3300048927 | Ga0496124_0000015 | Ga0496124_0000015_164722_165261 | 179 |
| 134 | 3300048928 | Ga0496125_0000021 | Ga0496125_0000021_295440_295979 | 179 |
| 135 | 3300048928 | Ga0496125_0158370 | Ga0496125_0158370_257_796 | 179 |
| 136 | 3300048929 | Ga0496126_0000015 | Ga0496126_0000015_295440_295979 | 179 |
| 137 | 3300048929 | Ga0496126_0003991 | Ga0496126_0003991_4624_5163 | 179 |
| 138 | 3300049570 | Ga0501033_0035813 | Ga0501033_0035813_729_1286 | 179 |
| 139 | 3300049570 | Ga0501033_0073853 | Ga0501033_0073853_307_864 | 179 |
| 140 | 3300049586 | Ga0501070_0295656 | Ga0501070_0295656_600_1157 | 179 |
| 141 | 3300049822 | Ga0501035_0001453 | Ga0501035_0001453_10860_11417 | 179 |
| 142 | 3300049823 | Ga0501044_0005246 | Ga0501044_0005246_8017_8574 | 179 |
| 143 | 3300050490 | nmdc:mga03n38_762_c1 | nmdc:mga03n38_762_c1_4454_5014 | 179 |
| 144 | 3300050491 | nmdc:mga00v17_8645_c1 | nmdc:mga00v17_8645_c1_2721_3281 | 179 |
| 145 | 3300050492 | nmdc:mga0yw44_474275_c1 | nmdc:mga0yw44_474275_c1_184_735 | 179 |
| 146 | 3300050496 | nmdc:mga07m45_19085_c1 | nmdc:mga07m45_19085_c1_2433_2993 | 179 |
| 147 | 3300050516 | nmdc:mga0sz30_6380_c1 | nmdc:mga0sz30_6380_c1_657_1217 | 179 |
| 148 | iso_pu_bacteria | 2643221715 | 2644634820 | 179 |
| 149 | iso_pu_bacteria | 2902810491 | 2902817147 | 179 |
| 150 | iso_pu_bacteria | 2939582691 | 2939586536 | 179 |
| 151 | 3300002459 | JGI24751J29686_10004847 | JGI24751J29686_100048472 | 180 |
| 152 | 3300003792 | Ga0055540_1000261 | Ga0055540_10002614 | 180 |
| 153 | 3300003792 | Ga0055540_1002350 | Ga0055540_10023508 | 180 |
| 154 | 3300003792 | Ga0055540_1005458 | Ga0055540_10054586 | 180 |
| 155 | 3300005328 | Ga0070676_10216317 | Ga0070676_102163172 | 180 |
| 156 | 3300005330 | Ga0070690_100100480 | Ga0070690_1001004802 | 180 |
| 157 | 3300005333 | Ga0070677_10059707 | Ga0070677_100597072 | 180 |
| 158 | 3300005337 | Ga0070682_100033517 | Ga0070682_1000335172 | 180 |
| 159 | 3300005338 | Ga0068868_100077317 | Ga0068868_1000773172 | 180 |
| 160 | 3300005339 | Ga0070660_100210292 | Ga0070660_1002102921 | 180 |
| 161 | 3300005340 | Ga0070689_100239280 | Ga0070689_1002392802 | 180 |
| 162 | 3300005341 | Ga0070691_10008199 | Ga0070691_100081992 | 180 |
| 163 | 3300005341 | Ga0070691_10094527 | Ga0070691_100945272 | 180 |
| 164 | 3300005343 | Ga0070687_100062901 | Ga0070687_1000629012 | 180 |
| 165 | 3300005345 | Ga0070692_10079201 | Ga0070692_100792012 | 180 |
| 166 | 3300005347 | Ga0070668_100003544 | Ga0070668_1000035448 | 180 |
| 167 | 3300005347 | Ga0070668_100148285 | Ga0070668_1001482853 | 180 |
| 168 | 3300005354 | Ga0070675_100459877 | Ga0070675_1004598772 | 180 |
| 169 | 3300005355 | Ga0070671_100006991 | Ga0070671_10000699110 | 180 |
| 170 | 3300005355 | Ga0070671_100603192 | Ga0070671_1006031921 | 180 |
| 171 | 3300005367 | Ga0070667_100051541 | Ga0070667_1000515412 | 180 |
| 172 | 3300005367 | Ga0070667_100201490 | Ga0070667_1002014903 | 180 |
| 173 | 3300005367 | Ga0070667_100324141 | Ga0070667_1003241411 | 180 |
| 174 | 3300005367 | Ga0070667_100953488 | Ga0070667_1009534881 | 180 |
| 175 | 3300005406 | Ga0070703_10137064 | Ga0070703_101370642 | 180 |
| 176 | 3300005434 | Ga0070709_10031344 | Ga0070709_100313442 | 180 |
| 177 | 3300005437 | Ga0070710_10000360 | Ga0070710_1000036020 | 180 |
| 178 | 3300005438 | Ga0070701_10005732 | Ga0070701_100057324 | 180 |
| 179 | 3300005439 | Ga0070711_100000487 | Ga0070711_10000048718 | 180 |
| 180 | 3300005440 | Ga0070705_100009225 | Ga0070705_1000092255 | 180 |
| 181 | 3300005440 | Ga0070705_100033171 | Ga0070705_1000331712 | 180 |
| 182 | 3300005441 | Ga0070700_100001945 | Ga0070700_1000019458 | 180 |
| 183 | 3300005441 | Ga0070700_100315949 | Ga0070700_1003159492 | 180 |
| 184 | 3300005444 | Ga0070694_100041160 | Ga0070694_1000411603 | 180 |
| 185 | 3300005455 | Ga0070663_100006881 | Ga0070663_1000068813 | 180 |
| 186 | 3300005455 | Ga0070663_100273321 | Ga0070663_1002733213 | 180 |
| 187 | 3300005455 | Ga0070663_100401737 | Ga0070663_1004017372 | 180 |
| 188 | 3300005455 | Ga0070663_101270761 | Ga0070663_1012707611 | 180 |
| 189 | 3300005456 | Ga0070678_100000111 | Ga0070678_1000001118 | 180 |
| 190 | 3300005456 | Ga0070678_100025788 | Ga0070678_1000257885 | 180 |
| 191 | 3300005456 | Ga0070678_100196399 | Ga0070678_1001963991 | 180 |
| 192 | 3300005457 | Ga0070662_100012627 | Ga0070662_1000126277 | 180 |
| 193 | 3300005457 | Ga0070662_101157120 | Ga0070662_1011571201 | 180 |
| 194 | 3300005459 | Ga0068867_100004844 | Ga0068867_10000484410 | 180 |
| 195 | 3300005466 | Ga0070685_10563589 | Ga0070685_105635892 | 180 |
| 196 | 3300005535 | Ga0070684_100111816 | Ga0070684_1001118164 | 180 |
| 197 | 3300005539 | Ga0068853_100125562 | Ga0068853_1001255622 | 180 |
| 198 | 3300005539 | Ga0068853_100300457 | Ga0068853_1003004571 | 180 |
| 199 | 3300005543 | Ga0070672_100071222 | Ga0070672_1000712223 | 180 |
| 200 | 3300005546 | Ga0070696_100001142 | Ga0070696_1000011422 | 180 |
| 201 | 3300005546 | Ga0070696_100078905 | Ga0070696_1000789053 | 180 |
| 202 | 3300005548 | Ga0070665_100002727 | Ga0070665_1000027274 | 180 |
| 203 | 3300005548 | Ga0070665_100193633 | Ga0070665_1001936334 | 180 |
| 204 | 3300005548 | Ga0070665_100746029 | Ga0070665_1007460291 | 180 |
| 205 | 3300005549 | Ga0070704_100002785 | Ga0070704_1000027854 | 180 |
| 206 | 3300005563 | Ga0068855_100462303 | Ga0068855_1004623032 | 180 |
| 207 | 3300005578 | Ga0068854_100000417 | Ga0068854_10000041720 | 180 |
| 208 | 3300005614 | Ga0068856_100114896 | Ga0068856_1001148963 | 180 |
| 209 | 3300005616 | Ga0068852_100038965 | Ga0068852_1000389652 | 180 |
| 210 | 3300005617 | Ga0068859_100015088 | Ga0068859_1000150889 | 180 |
| 211 | 3300005618 | Ga0068864_100289109 | Ga0068864_1002891092 | 180 |
| 212 | 3300005718 | Ga0068866_10000413 | Ga0068866_100004134 | 180 |
| 213 | 3300005719 | Ga0068861_100000439 | Ga0068861_10000043913 | 180 |
| 214 | 3300005841 | Ga0068863_100027777 | Ga0068863_1000277776 | 180 |
| 215 | 3300005841 | Ga0068863_100592385 | Ga0068863_1005923852 | 180 |
| 216 | 3300005841 | Ga0068863_100650849 | Ga0068863_1006508492 | 180 |
| 217 | 3300005842 | Ga0068858_100002903 | Ga0068858_1000029032 | 180 |
| 218 | 3300005842 | Ga0068858_100260083 | Ga0068858_1002600832 | 180 |
| 219 | 3300005843 | Ga0068860_100283737 | Ga0068860_1002837372 | 180 |
| 220 | 3300005844 | Ga0068862_100002547 | Ga0068862_1000025476 | 180 |
| 221 | 3300005937 | Ga0081455_10012114 | Ga0081455_100121145 | 180 |
| 222 | 3300005981 | Ga0081538_10013922 | Ga0081538_100139223 | 180 |
| 223 | 3300006038 | Ga0075365_10025176 | Ga0075365_100251765 | 180 |
| 224 | 3300006038 | Ga0075365_10037749 | Ga0075365_100377496 | 180 |
| 225 | 3300006038 | Ga0075365_10044029 | Ga0075365_100440295 | 180 |
| 226 | 3300006038 | Ga0075365_10398594 | Ga0075365_103985941 | 180 |
| 227 | 3300006042 | Ga0075368_10247730 | Ga0075368_102477301 | 180 |
| 228 | 3300006048 | Ga0075363_100020694 | Ga0075363_1000206942 | 180 |
| 229 | 3300006048 | Ga0075363_100098663 | Ga0075363_1000986633 | 180 |
| 230 | 3300006048 | Ga0075363_100151689 | Ga0075363_1001516892 | 180 |
| 231 | 3300006048 | Ga0075363_100155383 | Ga0075363_1001553831 | 180 |
| 232 | 3300006048 | Ga0075363_100157736 | Ga0075363_1001577362 | 180 |
| 233 | 3300006051 | Ga0075364_10005435 | Ga0075364_100054356 | 180 |
| 234 | 3300006051 | Ga0075364_10024033 | Ga0075364_100240333 | 180 |
| 235 | 3300006051 | Ga0075364_10051701 | Ga0075364_100517013 | 180 |
| 236 | 3300006051 | Ga0075364_10060750 | Ga0075364_100607501 | 180 |
| 237 | 3300006051 | Ga0075364_10065124 | Ga0075364_100651243 | 180 |
| 238 | 3300006051 | Ga0075364_10082366 | Ga0075364_100823663 | 180 |
| 239 | 3300006051 | Ga0075364_10493790 | Ga0075364_104937901 | 180 |
| 240 | 3300006051 | Ga0075364_10522846 | Ga0075364_105228461 | 180 |
| 241 | 3300006163 | Ga0070715_10000371 | Ga0070715_100003718 | 180 |
| 242 | 3300006173 | Ga0070716_100002231 | Ga0070716_1000022315 | 180 |
| 243 | 3300006173 | Ga0070716_100575793 | Ga0070716_1005757931 | 180 |
| 244 | 3300006175 | Ga0070712_100000301 | Ga0070712_10000030121 | 180 |
| 245 | 3300006177 | Ga0075362_10028235 | Ga0075362_100282354 | 180 |
| 246 | 3300006177 | Ga0075362_10175234 | Ga0075362_101752341 | 180 |
| 247 | 3300006178 | Ga0075367_10001573 | Ga0075367_1000157310 | 180 |
| 248 | 3300006178 | Ga0075367_10110801 | Ga0075367_101108012 | 180 |
| 249 | 3300006186 | Ga0075369_10004625 | Ga0075369_100046253 | 180 |
| 250 | 3300006186 | Ga0075369_10012871 | Ga0075369_100128715 | 180 |
| 251 | 3300006186 | Ga0075369_10014385 | Ga0075369_100143853 | 180 |
| 252 | 3300006186 | Ga0075369_10016929 | Ga0075369_100169295 | 180 |
| 253 | 3300006186 | Ga0075369_10350998 | Ga0075369_103509981 | 180 |
| 254 | 3300006186 | Ga0075369_10353427 | Ga0075369_103534271 | 180 |
| 255 | 3300006353 | Ga0075370_10009954 | Ga0075370_100099543 | 180 |
| 256 | 3300006353 | Ga0075370_10098507 | Ga0075370_100985072 | 180 |
| 257 | 3300006358 | Ga0068871_100007901 | Ga0068871_1000079014 | 180 |
| 258 | 3300006844 | Ga0075428_100069394 | Ga0075428_1000693946 | 180 |
| 259 | 3300006844 | Ga0075428_101171832 | Ga0075428_1011718322 | 180 |
| 260 | 3300006846 | Ga0075430_100042525 | Ga0075430_1000425252 | 180 |
| 261 | 3300006846 | Ga0075430_100119887 | Ga0075430_1001198872 | 180 |
| 262 | 3300006881 | Ga0068865_100015576 | Ga0068865_1000155764 | 180 |
| 263 | 3300006931 | Ga0097620_100015089 | Ga0097620_1000150899 | 180 |
| 264 | 3300009092 | Ga0105250_10106293 | Ga0105250_101062932 | 180 |
| 265 | 3300009094 | Ga0111539_10445761 | Ga0111539_104457612 | 180 |
| 266 | 3300009098 | Ga0105245_10007624 | Ga0105245_100076249 | 180 |
| 267 | 3300009098 | Ga0105245_11483380 | Ga0105245_114833801 | 180 |
| 268 | 3300009101 | Ga0105247_10002522 | Ga0105247_100025227 | 180 |
| 269 | 3300009101 | Ga0105247_10167702 | Ga0105247_101677022 | 180 |
| 270 | 3300009101 | Ga0105247_10237874 | Ga0105247_102378742 | 180 |
| 271 | 3300009147 | Ga0114129_10572881 | Ga0114129_105728812 | 180 |
| 272 | 3300009147 | Ga0114129_10608468 | Ga0114129_106084682 | 180 |
| 273 | 3300009148 | Ga0105243_10004430 | Ga0105243_1000443010 | 180 |
| 274 | 3300009176 | Ga0105242_10000106 | Ga0105242_1000010616 | 180 |
| 275 | 3300009177 | Ga0105248_10010396 | Ga0105248_100103962 | 180 |
| 276 | 3300009177 | Ga0105248_10035396 | Ga0105248_100353964 | 180 |
| 277 | 3300009177 | Ga0105248_10912345 | Ga0105248_109123452 | 180 |
| 278 | 3300009545 | Ga0105237_10003454 | Ga0105237_1000345417 | 180 |
| 279 | 3300009553 | Ga0105249_10002095 | Ga0105249_1000209518 | 180 |
| 280 | 3300009553 | Ga0105249_10031693 | Ga0105249_100316934 | 180 |
| 281 | 3300009553 | Ga0105249_10127933 | Ga0105249_101279333 | 180 |
| 282 | 3300010375 | Ga0105239_10003754 | Ga0105239_1000375416 | 180 |
| 283 | 3300010375 | Ga0105239_10012567 | Ga0105239_100125677 | 180 |
| 284 | 3300010375 | Ga0105239_10752564 | Ga0105239_107525641 | 180 |
| 285 | 3300010375 | Ga0105239_11461098 | Ga0105239_114610981 | 180 |
| 286 | 3300013100 | Ga0157373_10321734 | Ga0157373_103217341 | 180 |
| 287 | 3300013105 | Ga0157369_10187107 | Ga0157369_101871073 | 180 |
| 288 | 3300013297 | Ga0157378_10023502 | Ga0157378_100235023 | 180 |
| 289 | 3300013297 | Ga0157378_10232927 | Ga0157378_102329272 | 180 |
| 290 | 3300013307 | Ga0157372_10021676 | Ga0157372_100216767 | 180 |
| 291 | 3300014325 | Ga0163163_10312656 | Ga0163163_103126562 | 180 |
| 292 | 3300014326 | Ga0157380_10000450 | Ga0157380_1000045021 | 180 |
| 293 | 3300014497 | Ga0182008_10307940 | Ga0182008_103079402 | 180 |
| 294 | 3300014968 | Ga0157379_10012525 | Ga0157379_100125251 | 180 |
| 295 | 3300014968 | Ga0157379_10605115 | Ga0157379_106051152 | 180 |
| 296 | 3300014968 | Ga0157379_10637313 | Ga0157379_106373131 | 180 |
| 297 | 3300014969 | Ga0157376_10080507 | Ga0157376_100805072 | 180 |
| 298 | 3300017792 | Ga0163161_10000992 | Ga0163161_100009922 | 180 |
| 299 | 3300025303 | Ga0209051_1000659 | Ga0209051_10006597 | 180 |
| 300 | 3300025303 | Ga0209051_1001255 | Ga0209051_10012551 | 180 |
| 301 | 3300025303 | Ga0209051_1002943 | Ga0209051_10029432 | 180 |
| 302 | 3300025303 | Ga0209051_1022605 | Ga0209051_10226053 | 180 |
| 303 | 3300025303 | Ga0209051_1049106 | Ga0209051_10491061 | 180 |
| 304 | 3300025711 | Ga0207696_1067320 | Ga0207696_10673202 | 180 |
| 305 | 3300025898 | Ga0207692_10038315 | Ga0207692_100383153 | 180 |
| 306 | 3300025899 | Ga0207642_10005614 | Ga0207642_100056142 | 180 |
| 307 | 3300025900 | Ga0207710_10015701 | Ga0207710_100157014 | 180 |
| 308 | 3300025901 | Ga0207688_10000522 | Ga0207688_100005229 | 180 |
| 309 | 3300025904 | Ga0207647_10058117 | Ga0207647_100581171 | 180 |
| 310 | 3300025905 | Ga0207685_10007577 | Ga0207685_100075772 | 180 |
| 311 | 3300025906 | Ga0207699_10176429 | Ga0207699_101764291 | 180 |
| 312 | 3300025907 | Ga0207645_10008738 | Ga0207645_100087387 | 180 |
| 313 | 3300025914 | Ga0207671_10016098 | Ga0207671_100160983 | 180 |
| 314 | 3300025914 | Ga0207671_10158470 | Ga0207671_101584702 | 180 |
| 315 | 3300025915 | Ga0207693_10000181 | Ga0207693_1000018113 | 180 |
| 316 | 3300025915 | Ga0207693_10143190 | Ga0207693_101431903 | 180 |
| 317 | 3300025916 | Ga0207663_10408902 | Ga0207663_104089021 | 180 |
| 318 | 3300025917 | Ga0207660_10955437 | Ga0207660_109554371 | 180 |
| 319 | 3300025918 | Ga0207662_10079878 | Ga0207662_100798782 | 180 |
| 320 | 3300025919 | Ga0207657_10049807 | Ga0207657_100498074 | 180 |
| 321 | 3300025919 | Ga0207657_10221820 | Ga0207657_102218202 | 180 |
| 322 | 3300025923 | Ga0207681_10014124 | Ga0207681_100141245 | 180 |
| 323 | 3300025926 | Ga0207659_10373515 | Ga0207659_103735152 | 180 |
| 324 | 3300025927 | Ga0207687_10008495 | Ga0207687_100084958 | 180 |
| 325 | 3300025931 | Ga0207644_10001385 | Ga0207644_1000138519 | 180 |
| 326 | 3300025931 | Ga0207644_10730595 | Ga0207644_107305951 | 180 |
| 327 | 3300025933 | Ga0207706_10003507 | Ga0207706_1000350714 | 180 |
| 328 | 3300025933 | Ga0207706_10183638 | Ga0207706_101836382 | 180 |
| 329 | 3300025934 | Ga0207686_10012968 | Ga0207686_100129684 | 180 |
| 330 | 3300025935 | Ga0207709_10002689 | Ga0207709_100026899 | 180 |
| 331 | 3300025936 | Ga0207670_10114443 | Ga0207670_101144432 | 180 |
| 332 | 3300025936 | Ga0207670_10122532 | Ga0207670_101225321 | 180 |
| 333 | 3300025938 | Ga0207704_10001846 | Ga0207704_100018468 | 180 |
| 334 | 3300025939 | Ga0207665_10000813 | Ga0207665_100008138 | 180 |
| 335 | 3300025939 | Ga0207665_10371646 | Ga0207665_103716461 | 180 |
| 336 | 3300025941 | Ga0207711_10007348 | Ga0207711_100073489 | 180 |
| 337 | 3300025941 | Ga0207711_10014104 | Ga0207711_100141044 | 180 |
| 338 | 3300025941 | Ga0207711_10249246 | Ga0207711_102492463 | 180 |
| 339 | 3300025949 | Ga0207667_10371846 | Ga0207667_103718462 | 180 |
| 340 | 3300025972 | Ga0207668_10001801 | Ga0207668_1000180110 | 180 |
| 341 | 3300025972 | Ga0207668_10031761 | Ga0207668_100317614 | 180 |
| 342 | 3300025972 | Ga0207668_10259120 | Ga0207668_102591202 | 180 |
| 343 | 3300025981 | Ga0207640_10067449 | Ga0207640_100674492 | 180 |
| 344 | 3300025986 | Ga0207658_10018379 | Ga0207658_100183792 | 180 |
| 345 | 3300025986 | Ga0207658_10140676 | Ga0207658_101406764 | 180 |
| 346 | 3300025986 | Ga0207658_10168160 | Ga0207658_101681603 | 180 |
| 347 | 3300025986 | Ga0207658_10169008 | Ga0207658_101690082 | 180 |
| 348 | 3300026023 | Ga0207677_10113233 | Ga0207677_101132333 | 180 |
| 349 | 3300026035 | Ga0207703_10008408 | Ga0207703_100084085 | 180 |
| 350 | 3300026041 | Ga0207639_10041710 | Ga0207639_100417103 | 180 |
| 351 | 3300026041 | Ga0207639_10063759 | Ga0207639_100637593 | 180 |
| 352 | 3300026067 | Ga0207678_10081985 | Ga0207678_100819853 | 180 |
| 353 | 3300026067 | Ga0207678_10290611 | Ga0207678_102906113 | 180 |
| 354 | 3300026075 | Ga0207708_10003449 | Ga0207708_100034498 | 180 |
| 355 | 3300026078 | Ga0207702_10556340 | Ga0207702_105563402 | 180 |
| 356 | 3300026088 | Ga0207641_10012030 | Ga0207641_100120302 | 180 |
| 357 | 3300026088 | Ga0207641_10435499 | Ga0207641_104354992 | 180 |
| 358 | 3300026088 | Ga0207641_11002256 | Ga0207641_110022561 | 180 |
| 359 | 3300026089 | Ga0207648_10000268 | Ga0207648_1000026816 | 180 |
| 360 | 3300026095 | Ga0207676_10345569 | Ga0207676_103455692 | 180 |
| 361 | 3300026118 | Ga0207675_100000702 | Ga0207675_10000070226 | 180 |
| 362 | 3300026118 | Ga0207675_100157161 | Ga0207675_1001571613 | 180 |
| 363 | 3300026121 | Ga0207683_10000132 | Ga0207683_1000013215 | 180 |
| 364 | 3300026142 | Ga0207698_10157612 | Ga0207698_101576122 | 180 |
| 365 | 3300028379 | Ga0268266_10007011 | Ga0268266_100070116 | 180 |
| 366 | 3300028379 | Ga0268266_10289182 | Ga0268266_102891822 | 180 |
| 367 | 3300028380 | Ga0268265_10020654 | Ga0268265_100206545 | 180 |
| 368 | 3300028381 | Ga0268264_10000758 | Ga0268264_100007588 | 180 |
| 369 | 3300028381 | Ga0268264_10115828 | Ga0268264_101158284 | 180 |
| 370 | 3300031728 | Ga0316578_10049430 | Ga0316578_100494301 | 180 |
| 371 | 3300031852 | Ga0307410_10200787 | Ga0307410_102007872 | 180 |
| 372 | 3300031852 | Ga0307410_10206299 | Ga0307410_102062992 | 180 |
| 373 | 3300031852 | Ga0307410_10464508 | Ga0307410_104645081 | 180 |
| 374 | 3300031903 | Ga0307407_10011747 | Ga0307407_100117472 | 180 |
| 375 | 3300031903 | Ga0307407_10516110 | Ga0307407_105161101 | 180 |
| 376 | 3300031903 | Ga0307407_10679329 | Ga0307407_106793291 | 180 |
| 377 | 3300031995 | Ga0307409_100149313 | Ga0307409_1001493132 | 180 |
| 378 | 3300031995 | Ga0307409_100351442 | Ga0307409_1003514423 | 180 |
| 379 | 3300031995 | Ga0307409_100463169 | Ga0307409_1004631692 | 180 |
| 380 | 3300031995 | Ga0307409_100591902 | Ga0307409_1005919021 | 180 |
| 381 | 3300032002 | Ga0307416_100248521 | Ga0307416_1002485213 | 180 |
| 382 | 3300032002 | Ga0307416_101156561 | Ga0307416_1011565612 | 180 |
| 383 | 3300032004 | Ga0307414_10719971 | Ga0307414_107199712 | 180 |
| 384 | 3300032005 | Ga0307411_11200326 | Ga0307411_112003261 | 180 |
| 385 | 3300032126 | Ga0307415_100106228 | Ga0307415_1001062282 | 180 |
| 386 | 3300035691 | Ga0373931_0047970 | Ga0373931_0047970_501_1043 | 180 |
| 387 | 3300036647 | Ga0316582_0211792 | Ga0316582_0211792_24_566 | 180 |
| 388 | 3300037312 | Ga0395899_0063201 | Ga0395899_0063201_121_690 | 180 |
| 389 | 3300037466 | Ga0395898_0355234 | Ga0395898_0355234_809_1378 | 180 |
| 390 | 3300037471 | Ga0395905_0706803 | Ga0395905_0706803_117_686 | 180 |
| 391 | 3300039437 | Ga0436365_0152461 | Ga0436365_0152461_2425_3000 | 180 |
| 392 | 3300039450 | Ga0436363_0573861 | Ga0436363_0573861_243_800 | 180 |
| 393 | 3300041411 | Ga0439466_0021990 | Ga0439466_0021990_307_849 | 180 |
| 394 | 3300041413 | Ga0439465_0000929 | Ga0439465_0000929_1086_1628 | 180 |
| 395 | 3300041452 | Ga0451793_0734024 | Ga0451793_0734024_916_1458 | 180 |
| 396 | 3300041456 | Ga0451795_0605100 | Ga0451795_0605100_79_621 | 180 |
| 397 | 3300041460 | Ga0451802_0757034 | Ga0451802_0757034_55_597 | 180 |
| 398 | 3300041491 | Ga0451833_0118692 | Ga0451833_0118692_115_657 | 180 |
| 399 | 3300042002 | Ga0439442_104186 | Ga0439442_104186_31_573 | 180 |
| 400 | 3300042004 | Ga0439445_0012035 | Ga0439445_0012035_1390_1932 | 180 |
| 401 | 3300042008 | Ga0439450_054106 | Ga0439450_054106_14_556 | 180 |
| 402 | 3300042435 | Ga0439434_0056057 | Ga0439434_0056057_105_647 | 180 |
| 403 | 3300044658 | Ga0466972_0011149 | Ga0466972_0011149_1459_2001 | 180 |
| 404 | 3300044658 | Ga0466972_0112014 | Ga0466972_0112014_286_828 | 180 |
| 405 | 3300044658 | Ga0466972_0246703 | Ga0466972_0246703_171_713 | 180 |
| 406 | 3300044683 | Ga0466965_0020291 | Ga0466965_0020291_2511_3053 | 180 |
| 407 | 3300044683 | Ga0466965_0029020 | Ga0466965_0029020_2019_2561 | 180 |
| 408 | 3300044684 | Ga0466966_0029719 | Ga0466966_0029719_967_1521 | 180 |
| 409 | 3300044684 | Ga0466966_0472968 | Ga0466966_0472968_181_723 | 180 |
| 410 | 3300044693 | Ga0466961_0001791 | Ga0466961_0001791_4143_4685 | 180 |
| 411 | 3300044693 | Ga0466961_0013283 | Ga0466961_0013283_2978_3532 | 180 |
| 412 | 3300044765 | Ga0466970_0050522 | Ga0466970_0050522_1193_1735 | 180 |
| 413 | 3300044765 | Ga0466970_0057455 | Ga0466970_0057455_1401_1943 | 180 |
| 414 | 3300044765 | Ga0466970_0073891 | Ga0466970_0073891_426_968 | 180 |
| 415 | 3300044765 | Ga0466970_0132600 | Ga0466970_0132600_320_862 | 180 |
| 416 | 3300044842 | Ga0466957_0003746 | Ga0466957_0003746_19_573 | 180 |
| 417 | 3300044901 | Ga0466960_0183230 | Ga0466960_0183230_507_1049 | 180 |
| 418 | 3300044901 | Ga0466960_0218092 | Ga0466960_0218092_458_1000 | 180 |
| 419 | 3300045049 | Ga0466959_0020403 | Ga0466959_0020403_1385_1939 | 180 |
| 420 | 3300045836 | Ga0466958_0015008 | Ga0466958_0015008_228_770 | 180 |
| 421 | 3300045836 | Ga0466958_0030240 | Ga0466958_0030240_1585_2139 | 180 |
| 422 | 3300045836 | Ga0466958_0439829 | Ga0466958_0439829_44_586 | 180 |
| 423 | 3300045976 | Ga0466967_0109962 | Ga0466967_0109962_1801_2343 | 180 |
| 424 | 3300045976 | Ga0466967_0256414 | Ga0466967_0256414_38_625 | 180 |
| 425 | 3300045976 | Ga0466967_0422777 | Ga0466967_0422777_417_986 | 180 |
| 426 | 3300046460 | Ga0495638_0025434 | Ga0495638_0025434_1593_2135 | 180 |
| 427 | 3300046461 | Ga0495641_0067200 | Ga0495641_0067200_761_1303 | 180 |
| 428 | 3300046473 | Ga0495582_0525074 | Ga0495582_0525074_90_632 | 180 |
| 429 | 3300046475 | Ga0495639_0114319 | Ga0495639_0114319_75_617 | 180 |
| 430 | 3300046524 | Ga0495648_0002295 | Ga0495648_0002295_3708_4250 | 180 |
| 431 | 3300046526 | Ga0495666_0078831 | Ga0495666_0078831_282_824 | 180 |
| 432 | 3300046530 | Ga0495654_0041848 | Ga0495654_0041848_393_935 | 180 |
| 433 | 3300046648 | Ga0495611_0128291 | Ga0495611_0128291_32_574 | 180 |
| 434 | 3300046660 | Ga0495625_0085371 | Ga0495625_0085371_176_718 | 180 |
| 435 | 3300046690 | Ga0495624_0095181 | Ga0495624_0095181_20_562 | 180 |
| 436 | 3300047315 | Ga0495581_0188224 | Ga0495581_0188224_254_796 | 180 |
| 437 | 3300047320 | Ga0495672_0002577 | Ga0495672_0002577_2498_3040 | 180 |
| 438 | 3300047320 | Ga0495672_0030744 | Ga0495672_0030744_681_1223 | 180 |
| 439 | 3300047469 | Ga0495673_0000681 | Ga0495673_0000681_13316_13858 | 180 |
| 440 | 3300047472 | Ga0495686_0001156 | Ga0495686_0001156_17076_17618 | 180 |
| 441 | 3300047673 | Ga0495593_0005139 | Ga0495593_0005139_4723_5265 | 180 |
| 442 | 3300048903 | Ga0496100_0001111 | Ga0496100_0001111_6273_6815 | 180 |
| 443 | 3300048903 | Ga0496100_0031399 | Ga0496100_0031399_1186_1731 | 180 |
| 444 | 3300048903 | Ga0496100_0038939 | Ga0496100_0038939_1937_2479 | 180 |
| 445 | 3300048904 | Ga0496101_0000094 | Ga0496101_0000094_44823_45365 | 180 |
| 446 | 3300048904 | Ga0496101_0001150 | Ga0496101_0001150_12263_12805 | 180 |
| 447 | 3300048904 | Ga0496101_0026952 | Ga0496101_0026952_1416_1958 | 180 |
| 448 | 3300048904 | Ga0496101_0840694 | Ga0496101_0840694_79_624 | 180 |
| 449 | 3300048905 | Ga0496102_0000014 | Ga0496102_0000014_163994_164536 | 180 |
| 450 | 3300048905 | Ga0496102_0003943 | Ga0496102_0003943_5309_5851 | 180 |
| 451 | 3300048905 | Ga0496102_0011841 | Ga0496102_0011841_555_1097 | 180 |
| 452 | 3300048905 | Ga0496102_0063575 | Ga0496102_0063575_1510_2052 | 180 |
| 453 | 3300048905 | Ga0496102_0082846 | Ga0496102_0082846_1874_2440 | 180 |
| 454 | 3300048906 | Ga0496103_0000004 | Ga0496103_0000004_164500_165042 | 180 |
| 455 | 3300048907 | Ga0496104_0019292 | Ga0496104_0019292_352_894 | 180 |
| 456 | 3300048908 | Ga0496105_0005330 | Ga0496105_0005330_1178_1720 | 180 |
| 457 | 3300048908 | Ga0496105_0074506 | Ga0496105_0074506_1640_2182 | 180 |
| 458 | 3300048909 | Ga0496106_0003609 | Ga0496106_0003609_9744_10286 | 180 |
| 459 | 3300048909 | Ga0496106_0013804 | Ga0496106_0013804_3718_4260 | 180 |
| 460 | 3300048909 | Ga0496106_0034193 | Ga0496106_0034193_1871_2413 | 180 |
| 461 | 3300048910 | Ga0496107_0002101 | Ga0496107_0002101_9986_10528 | 180 |
| 462 | 3300048910 | Ga0496107_0028862 | Ga0496107_0028862_3156_3698 | 180 |
| 463 | 3300048910 | Ga0496107_0039662 | Ga0496107_0039662_1129_1671 | 180 |
| 464 | 3300048911 | Ga0496108_0392105 | Ga0496108_0392105_560_1102 | 180 |
| 465 | 3300048911 | Ga0496108_0450611 | Ga0496108_0450611_321_863 | 180 |
| 466 | 3300048913 | Ga0496110_0140117 | Ga0496110_0140117_907_1449 | 180 |
| 467 | 3300048913 | Ga0496110_1249006 | Ga0496110_1249006_26_568 | 180 |
| 468 | 3300048914 | Ga0496111_0082498 | Ga0496111_0082498_537_1079 | 180 |
| 469 | 3300048914 | Ga0496111_0443252 | Ga0496111_0443252_270_812 | 180 |
| 470 | 3300048915 | Ga0496112_0008418 | Ga0496112_0008418_5009_5551 | 180 |
| 471 | 3300048915 | Ga0496112_0141417 | Ga0496112_0141417_481_1023 | 180 |
| 472 | 3300048916 | Ga0496113_0081588 | Ga0496113_0081588_1106_1648 | 180 |
| 473 | 3300048916 | Ga0496113_0426567 | Ga0496113_0426567_488_1030 | 180 |
| 474 | 3300048917 | Ga0496114_0018600 | Ga0496114_0018600_1705_2247 | 180 |
| 475 | 3300048918 | Ga0496115_0002697 | Ga0496115_0002697_8116_8658 | 180 |
| 476 | 3300048918 | Ga0496115_0010746 | Ga0496115_0010746_5953_6495 | 180 |
| 477 | 3300048919 | Ga0496116_0000069 | Ga0496116_0000069_165451_165993 | 180 |
| 478 | 3300048920 | Ga0496117_0000003 | Ga0496117_0000003_1362903_1363445 | 180 |
| 479 | 3300048920 | Ga0496117_0175494 | Ga0496117_0175494_226_792 | 180 |
| 480 | 3300048921 | Ga0496118_0000001 | Ga0496118_0000001_1362906_1363448 | 180 |
| 481 | 3300048921 | Ga0496118_0000538 | Ga0496118_0000538_4419_4985 | 180 |
| 482 | 3300048922 | Ga0496119_0045000 | Ga0496119_0045000_2086_2628 | 180 |
| 483 | 3300048924 | Ga0496121_0000032 | Ga0496121_0000032_253292_253834 | 180 |
| 484 | 3300048925 | Ga0496122_0359550 | Ga0496122_0359550_36_578 | 180 |
| 485 | 3300048929 | Ga0496126_0000067 | Ga0496126_0000067_147963_148505 | 180 |
| 486 | 3300049571 | Ga0501034_0216353 | Ga0501034_0216353_225_812 | 180 |
| 487 | 3300049581 | Ga0501047_0046321 | Ga0501047_0046321_1925_2512 | 180 |
| 488 | 3300049586 | Ga0501070_0315003 | Ga0501070_0315003_135_722 | 180 |
| 489 | 3300049744 | Ga0501083_0058552 | Ga0501083_0058552_1979_2530 | 180 |
| 490 | 3300049822 | Ga0501035_0451710 | Ga0501035_0451710_64_651 | 180 |
| 491 | 3300049823 | Ga0501044_0032548 | Ga0501044_0032548_69_611 | 180 |
| 492 | 3300050489 | nmdc:mga03683_36754_c1 | nmdc:mga03683_36754_c1_925_1467 | 180 |
| 493 | 3300050490 | nmdc:mga03n38_46711_c1 | nmdc:mga03n38_46711_c1_509_1051 | 180 |
| 494 | 3300050490 | nmdc:mga03n38_60765_c1 | nmdc:mga03n38_60765_c1_1089_1631 | 180 |
| 495 | 3300050491 | nmdc:mga00v17_28468_c1 | nmdc:mga00v17_28468_c1_1510_2052 | 180 |
| 496 | 3300050491 | nmdc:mga00v17_30039_c1 | nmdc:mga00v17_30039_c1_2531_3073 | 180 |
| 497 | 3300050491 | nmdc:mga00v17_323012_c1 | nmdc:mga00v17_323012_c1_151_693 | 180 |
| 498 | 3300050491 | nmdc:mga00v17_47200_c1 | nmdc:mga00v17_47200_c1_1155_1697 | 180 |
| 499 | 3300050491 | nmdc:mga00v17_59077_c1 | nmdc:mga00v17_59077_c1_277_834 | 180 |
| 500 | 3300050491 | nmdc:mga00v17_6797_c1 | nmdc:mga00v17_6797_c1_843_1385 | 180 |
| 501 | 3300050491 | nmdc:mga00v17_71537_c1 | nmdc:mga00v17_71537_c1_918_1460 | 180 |
| 502 | 3300050492 | nmdc:mga0yw44_31556_c1 | nmdc:mga0yw44_31556_c1_1322_1864 | 180 |
| 503 | 3300050492 | nmdc:mga0yw44_365443_c1 | nmdc:mga0yw44_365443_c1_286_828 | 180 |
| 504 | 3300050494 | nmdc:mga06z11_158782_c1 | nmdc:mga06z11_158782_c1_655_1197 | 180 |
| 505 | 3300050495 | nmdc:mga04h51_197472_c1 | nmdc:mga04h51_197472_c1_132_674 | 180 |
| 506 | 3300050507 | nmdc:mga05p37_1273384_c1 | nmdc:mga05p37_1273384_c1_168_710 | 180 |
| 507 | 3300050507 | nmdc:mga05p37_495773_c1 | nmdc:mga05p37_495773_c1_742_1284 | 180 |
| 508 | 3300050509 | nmdc:mga0qj67_35032_c1 | nmdc:mga0qj67_35032_c1_2207_2749 | 180 |
| 509 | 3300050509 | nmdc:mga0qj67_36961_c1 | nmdc:mga0qj67_36961_c1_2563_3105 | 180 |
| 510 | 3300050516 | nmdc:mga0sz30_143314_c1 | nmdc:mga0sz30_143314_c1_478_1020 | 180 |
| 511 | 3300050516 | nmdc:mga0sz30_202281_c1 | nmdc:mga0sz30_202281_c1_307_849 | 180 |
| 512 | 3300050516 | nmdc:mga0sz30_243652_c1 | nmdc:mga0sz30_243652_c1_128_670 | 180 |
| 513 | 3300050516 | nmdc:mga0sz30_254319_c1 | nmdc:mga0sz30_254319_c1_129_671 | 180 |
| 514 | 3300050516 | nmdc:mga0sz30_3880_c1 | nmdc:mga0sz30_3880_c1_1679_2221 | 180 |
| 515 | 3300050516 | nmdc:mga0sz30_5156_c1 | nmdc:mga0sz30_5156_c1_195_737 | 180 |
| 516 | 3300053077 | Ga0495601_0493089 | Ga0495601_0493089_10_552 | 180 |
| 517 | 3300053079 | Ga0500610_0287457 | Ga0500610_0287457_60_602 | 180 |
| 518 | 3300053080 | Ga0500635_0006693 | Ga0500635_0006693_1149_1691 | 180 |
| 519 | 3300053085 | Ga0495619_0108988 | Ga0495619_0108988_692_1234 | 180 |
| 520 | 3300053087 | Ga0500643_002989 | Ga0500643_002989_3158_3700 | 180 |
| 521 | 3300053088 | Ga0500644_0282919 | Ga0500644_0282919_96_638 | 180 |
| 522 | 3300053096 | Ga0500641_0035588 | Ga0500641_0035588_1249_1791 | 180 |
| 523 | 3300053104 | Ga0500556_0129994 | Ga0500556_0129994_81_623 | 180 |
| 524 | 3300053108 | Ga0500562_044887 | Ga0500562_044887_89_631 | 180 |
| 525 | 3300053131 | Ga0500652_073270 | Ga0500652_073270_322_864 | 180 |
| 526 | 3300053134 | Ga0500658_0089534 | Ga0500658_0089534_89_631 | 180 |
| 527 | 3300053139 | Ga0500568_0179370 | Ga0500568_0179370_12_554 | 180 |
| 528 | 3300053153 | Ga0500616_0079914 | Ga0500616_0079914_310_852 | 180 |
| 529 | 3300053158 | Ga0500627_0083447 | Ga0500627_0083447_774_1316 | 180 |
| 530 | 3300053730 | Ga0500645_000057 | Ga0500645_000057_55360_55902 | 180 |
| 531 | 3300053730 | Ga0500645_071821 | Ga0500645_071821_340_882 | 180 |
| 532 | 3300053730 | Ga0500645_081689 | Ga0500645_081689_42_584 | 180 |
| 533 | 3300005334 | Ga0068869_100081214 | Ga0068869_1000812142 | 182 |
| 534 | 3300005345 | Ga0070692_10091668 | Ga0070692_100916682 | 182 |
| 535 | 3300005347 | Ga0070668_100102202 | Ga0070668_1001022023 | 182 |
| 536 | 3300005353 | Ga0070669_100048093 | Ga0070669_1000480932 | 182 |
| 537 | 3300005365 | Ga0070688_100100436 | Ga0070688_1001004363 | 182 |
| 538 | 3300005366 | Ga0070659_100105672 | Ga0070659_1001056722 | 182 |
| 539 | 3300005367 | Ga0070667_100161513 | Ga0070667_1001615132 | 182 |
| 540 | 3300005437 | Ga0070710_10002406 | Ga0070710_100024067 | 182 |
| 541 | 3300005455 | Ga0070663_100154605 | Ga0070663_1001546052 | 182 |
| 542 | 3300005615 | Ga0070702_100006249 | Ga0070702_1000062494 | 182 |
| 543 | 3300005616 | Ga0068852_100237036 | Ga0068852_1002370362 | 182 |
| 544 | 3300005617 | Ga0068859_100130496 | Ga0068859_1001304963 | 182 |
| 545 | 3300006173 | Ga0070716_100001209 | Ga0070716_1000012098 | 182 |
| 546 | 3300006175 | Ga0070712_100005808 | Ga0070712_1000058088 | 182 |
| 547 | 3300006237 | Ga0097621_100237672 | Ga0097621_1002376721 | 182 |
| 548 | 3300006931 | Ga0097620_100130482 | Ga0097620_1001304823 | 182 |
| 549 | 3300017792 | Ga0163161_10178942 | Ga0163161_101789422 | 182 |
| 550 | 3300025885 | Ga0207653_10055209 | Ga0207653_100552092 | 182 |
| 551 | 3300025905 | Ga0207685_10009797 | Ga0207685_100097972 | 182 |
| 552 | 3300025915 | Ga0207693_10003053 | Ga0207693_100030538 | 182 |
| 553 | 3300025916 | Ga0207663_10008276 | Ga0207663_100082763 | 182 |
| 554 | 3300025932 | Ga0207690_10068485 | Ga0207690_100684853 | 182 |
| 555 | 3300025935 | Ga0207709_10401005 | Ga0207709_104010052 | 182 |
| 556 | 3300025939 | Ga0207665_10005043 | Ga0207665_100050434 | 182 |
| 557 | 3300026075 | Ga0207708_10032998 | Ga0207708_100329983 | 182 |
| 558 | 3300041413 | Ga0439465_0098281 | Ga0439465_0098281_366_914 | 182 |
| 559 | 3300044719 | Ga0466971_0025244 | Ga0466971_0025244_961_1548 | 182 |
| 560 | 3300049569 | Ga0501032_0033580 | Ga0501032_0033580_572_1120 | 182 |
| 561 | 3300049571 | Ga0501034_0002951 | Ga0501034_0002951_14810_15358 | 182 |
| 562 | 3300049572 | Ga0501036_0178052 | Ga0501036_0178052_544_1092 | 182 |
| 563 | 3300049573 | Ga0501037_0009367 | Ga0501037_0009367_3688_4236 | 182 |
| 564 | 3300049574 | Ga0501038_0013969 | Ga0501038_0013969_3689_4237 | 182 |
| 565 | 3300049575 | Ga0501039_0013109 | Ga0501039_0013109_4552_5100 | 182 |
| 566 | 3300049576 | Ga0501040_0336202 | Ga0501040_0336202_334_882 | 182 |
| 567 | 3300049579 | Ga0501043_0002544 | Ga0501043_0002544_4565_5113 | 182 |
| 568 | 3300049581 | Ga0501047_0178902 | Ga0501047_0178902_1396_1944 | 182 |
| 569 | 3300049583 | Ga0501067_0094286 | Ga0501067_0094286_209_757 | 182 |
| 570 | 3300049586 | Ga0501070_0004875 | Ga0501070_0004875_1595_2143 | 182 |
| 571 | 3300049589 | Ga0501073_0015774 | Ga0501073_0015774_2957_3505 | 182 |
| 572 | 3300049823 | Ga0501044_0006818 | Ga0501044_0006818_11504_12052 | 182 |
| 573 | 3300050490 | nmdc:mga03n38_125600_c1 | nmdc:mga03n38_125600_c1_69_617 | 182 |
| 574 | 3300050490 | nmdc:mga03n38_160447_c1 | nmdc:mga03n38_160447_c1_226_774 | 182 |
| 575 | 3300050492 | nmdc:mga0yw44_243488_c1 | nmdc:mga0yw44_243488_c1_627_1175 | 182 |
| 576 | 3300050496 | nmdc:mga07m45_345083_c1 | nmdc:mga07m45_345083_c1_113_661 | 182 |
| 577 | 3300050496 | nmdc:mga07m45_497565_c1 | nmdc:mga07m45_497565_c1_31_579 | 182 |
| 578 | 3300061719 | Ga0466962_0014337 | Ga0466962_0014337_246_833 | 182 |
| 579 | 3300005436 | Ga0070713_100158980 | Ga0070713_1001589803 | 183 |
| 580 | 3300021384 | Ga0213876_10014315 | Ga0213876_100143153 | 183 |
| 581 | 3300044765 | Ga0466970_0082622 | Ga0466970_0082622_1154_1708 | 183 |
| 582 | 3300045976 | Ga0466967_0019311 | Ga0466967_0019311_4397_4984 | 183 |
| 583 | 3300046507 | Ga0495606_0030112 | Ga0495606_0030112_1501_2052 | 183 |
| 584 | 3300053136 | Ga0500559_0053630 | Ga0500559_0053630_969_1520 | 183 |
| 585 | 3300005353 | Ga0070669_100013949 | Ga0070669_1000139492 | 184 |
| 586 | 3300005367 | Ga0070667_100000087 | Ga0070667_1000000875 | 184 |
| 587 | 3300005841 | Ga0068863_100004572 | Ga0068863_10000457210 | 184 |
| 588 | 3300005842 | Ga0068858_100120360 | Ga0068858_1001203603 | 184 |
| 589 | 3300005843 | Ga0068860_100000020 | Ga0068860_100000020160 | 184 |
| 590 | 3300005844 | Ga0068862_100000013 | Ga0068862_100000013142 | 184 |
| 591 | 3300009101 | Ga0105247_10000009 | Ga0105247_10000009262 | 184 |
| 592 | 3300009177 | Ga0105248_10000197 | Ga0105248_1000019743 | 184 |
| 593 | 3300009553 | Ga0105249_10000057 | Ga0105249_1000005746 | 184 |
| 594 | 3300014968 | Ga0157379_10215053 | Ga0157379_102150533 | 184 |
| 595 | 3300025900 | Ga0207710_10000014 | Ga0207710_10000014278 | 184 |
| 596 | 3300025923 | Ga0207681_10001854 | Ga0207681_100018544 | 184 |
| 597 | 3300025941 | Ga0207711_10000146 | Ga0207711_1000014629 | 184 |
| 598 | 3300025961 | Ga0207712_10000050 | Ga0207712_10000050111 | 184 |
| 599 | 3300025986 | Ga0207658_10000065 | Ga0207658_100000654 | 184 |
| 600 | 3300026035 | Ga0207703_10642780 | Ga0207703_106427801 | 184 |
| 601 | 3300026088 | Ga0207641_10006204 | Ga0207641_1000620411 | 184 |
| 602 | 3300028380 | Ga0268265_10000004 | Ga0268265_10000004111 | 184 |
| 603 | 3300028381 | Ga0268264_10000024 | Ga0268264_10000024110 | 184 |
| 604 | 3300048904 | Ga0496101_0199299 | Ga0496101_0199299_648_1202 | 184 |
| 605 | 3300048905 | Ga0496102_0000691 | Ga0496102_0000691_16086_16640 | 184 |
| 606 | 3300048906 | Ga0496103_0000652 | Ga0496103_0000652_22399_22953 | 184 |
| 607 | 3300048910 | Ga0496107_0020240 | Ga0496107_0020240_3945_4499 | 184 |
| 608 | 3300048919 | Ga0496116_0088669 | Ga0496116_0088669_1079_1633 | 184 |
| 609 | 3300048920 | Ga0496117_0004834 | Ga0496117_0004834_2414_2968 | 184 |
| 610 | 3300048921 | Ga0496118_0000324 | Ga0496118_0000324_63813_64367 | 184 |
| 611 | 3300048921 | Ga0496118_0173725 | Ga0496118_0173725_107_661 | 184 |
| 612 | 3300048922 | Ga0496119_0004768 | Ga0496119_0004768_11171_11725 | 184 |
| 613 | 3300048923 | Ga0496120_0048585 | Ga0496120_0048585_18_572 | 184 |
| 614 | 3300048924 | Ga0496121_0002438 | Ga0496121_0002438_11473_12027 | 184 |
| 615 | 3300048927 | Ga0496124_0155404 | Ga0496124_0155404_758_1312 | 184 |
| 616 | 3300048927 | Ga0496124_0192782 | Ga0496124_0192782_286_840 | 184 |
| 617 | 3300048928 | Ga0496125_0021788 | Ga0496125_0021788_3068_3622 | 184 |
| 618 | 3300009148 | Ga0105243_10605431 | Ga0105243_106054312 | 187 |
| 619 | 3300009176 | Ga0105242_10030963 | Ga0105242_100309632 | 187 |
| 620 | 3300009551 | Ga0105238_10597014 | Ga0105238_105970141 | 187 |
| 621 | 3300013308 | Ga0157375_10093213 | Ga0157375_100932133 | 187 |
| 622 | 3300048908 | Ga0496105_0116600 | Ga0496105_0116600_68_631 | 187 |
| 623 | 3300048913 | Ga0496110_0139697 | Ga0496110_0139697_342_905 | 187 |
| 624 | 3300048917 | Ga0496114_0035329 | Ga0496114_0035329_1892_2455 | 187 |
| 625 | 3300048918 | Ga0496115_0481218 | Ga0496115_0481218_364_927 | 187 |
| 626 | 3300005435 | Ga0070714_100203481 | Ga0070714_1002034812 | 190 |
| 627 | 3300044735 | Ga0466968_0021812 | Ga0466968_0021812_1032_1604 | 190 |
| 628 | 3300044765 | Ga0466970_0066995 | Ga0466970_0066995_392_964 | 190 |
| 629 | 3300044842 | Ga0466957_0032109 | Ga0466957_0032109_1806_2378 | 190 |
| 630 | 3300044901 | Ga0466960_0112969 | Ga0466960_0112969_802_1374 | 190 |
| 631 | 3300045049 | Ga0466959_0161245 | Ga0466959_0161245_177_749 | 190 |
| 632 | 3300049586 | Ga0501070_0155696 | Ga0501070_0155696_597_1208 | 190 |
| 633 | 3300005338 | Ga0068868_100112144 | Ga0068868_1001121441 | 191 |
| 634 | 3300009176 | Ga0105242_10383816 | Ga0105242_103838161 | 191 |
| 635 | 3300010375 | Ga0105239_10850862 | Ga0105239_108508621 | 191 |
| 636 | 3300041512 | Ga0451853_3086809 | Ga0451853_3086809_28_603 | 191 |
| 637 | 3300048911 | Ga0496108_0136218 | Ga0496108_0136218_589_1164 | 191 |
| 638 | 3300048912 | Ga0496109_0294348 | Ga0496109_0294348_865_1440 | 191 |
| 639 | 3300048914 | Ga0496111_0166344 | Ga0496111_0166344_427_1002 | 191 |
| 640 | 3300048915 | Ga0496112_0013359 | Ga0496112_0013359_4853_5428 | 191 |
| 641 | 3300050496 | nmdc:mga07m45_107843_c1 | nmdc:mga07m45_107843_c1_164_739 | 191 |
| 642 | 3300050511 | nmdc:mga08y16_458640_c1 | nmdc:mga08y16_458640_c1_429_1007 | 191 |
| 643 | 3300053083 | Ga0495655_0010778 | Ga0495655_0010778_569_1144 | 191 |
| 644 | 3300053129 | Ga0500628_010050 | Ga0500628_010050_566_1141 | 191 |
| 645 | 3300006048 | Ga0075363_100005983 | Ga0075363_1000059835 | 192 |
| 646 | 3300006051 | Ga0075364_10022446 | Ga0075364_100224464 | 192 |
| 647 | 3300006186 | Ga0075369_10010862 | Ga0075369_100108622 | 192 |
| 648 | 3300006353 | Ga0075370_10013914 | Ga0075370_100139144 | 192 |
| 649 | 3300013306 | Ga0163162_10078408 | Ga0163162_100784084 | 193 |
| 650 | 3300044693 | Ga0466961_0174155 | Ga0466961_0174155_213_797 | 193 |
| 651 | 3300025939 | Ga0207665_10457766 | Ga0207665_104577662 | 194 |
| 652 | 3300002075 | JGI24738J21930_10037639 | JGI24738J21930_100376392 | 195 |
| 653 | 3300005335 | Ga0070666_10095521 | Ga0070666_100955212 | 195 |
| 654 | 3300005455 | Ga0070663_100049030 | Ga0070663_1000490302 | 195 |
| 655 | 3300005543 | Ga0070672_100276474 | Ga0070672_1002764742 | 195 |
| 656 | 3300005578 | Ga0068854_100239364 | Ga0068854_1002393642 | 195 |
| 657 | 3300005614 | Ga0068856_100422971 | Ga0068856_1004229712 | 195 |
| 658 | 3300005719 | Ga0068861_100305119 | Ga0068861_1003051192 | 195 |
| 659 | 3300005840 | Ga0068870_10191400 | Ga0068870_101914002 | 195 |
| 660 | 3300005842 | Ga0068858_100094598 | Ga0068858_1000945982 | 195 |
| 661 | 3300005843 | Ga0068860_100195540 | Ga0068860_1001955403 | 195 |
| 662 | 3300005844 | Ga0068862_100132570 | Ga0068862_1001325702 | 195 |
| 663 | 3300005844 | Ga0068862_100326463 | Ga0068862_1003264632 | 195 |
| 664 | 3300006881 | Ga0068865_100040668 | Ga0068865_1000406684 | 195 |
| 665 | 3300009098 | Ga0105245_10072810 | Ga0105245_100728103 | 195 |
| 666 | 3300009101 | Ga0105247_10103953 | Ga0105247_101039533 | 195 |
| 667 | 3300009177 | Ga0105248_10219646 | Ga0105248_102196462 | 195 |
| 668 | 3300010375 | Ga0105239_10187726 | Ga0105239_101877263 | 195 |
| 669 | 3300011119 | Ga0105246_10220404 | Ga0105246_102204042 | 195 |
| 670 | 3300013105 | Ga0157369_11748908 | Ga0157369_117489081 | 195 |
| 671 | 3300013296 | Ga0157374_10132991 | Ga0157374_101329912 | 195 |
| 672 | 3300013306 | Ga0163162_10431718 | Ga0163162_104317182 | 195 |
| 673 | 3300013308 | Ga0157375_10305259 | Ga0157375_103052593 | 195 |
| 674 | 3300014325 | Ga0163163_10035394 | Ga0163163_100353941 | 195 |
| 675 | 3300014969 | Ga0157376_10314972 | Ga0157376_103149722 | 195 |
| 676 | 3300025901 | Ga0207688_10010982 | Ga0207688_100109823 | 195 |
| 677 | 3300025908 | Ga0207643_10104713 | Ga0207643_101047132 | 195 |
| 678 | 3300025927 | Ga0207687_10074935 | Ga0207687_100749353 | 195 |
| 679 | 3300025938 | Ga0207704_10089265 | Ga0207704_100892653 | 195 |
| 680 | 3300025940 | Ga0207691_10145912 | Ga0207691_101459122 | 195 |
| 681 | 3300025941 | Ga0207711_10488253 | Ga0207711_104882532 | 195 |
| 682 | 3300025961 | Ga0207712_10011630 | Ga0207712_100116305 | 195 |
| 683 | 3300026041 | Ga0207639_10095059 | Ga0207639_100950593 | 195 |
| 684 | 3300026067 | Ga0207678_10076166 | Ga0207678_100761662 | 195 |
| 685 | 3300026089 | Ga0207648_10565507 | Ga0207648_105655072 | 195 |
| 686 | 3300048903 | Ga0496100_0970662 | Ga0496100_0970662_25_612 | 195 |
| 687 | 3300048905 | Ga0496102_0036464 | Ga0496102_0036464_1821_2408 | 195 |
| 688 | 3300048905 | Ga0496102_0266808 | Ga0496102_0266808_494_1081 | 195 |
| 689 | 3300048907 | Ga0496104_0218280 | Ga0496104_0218280_352_939 | 195 |
| 690 | 3300048911 | Ga0496108_0000409 | Ga0496108_0000409_4360_4947 | 195 |
| 691 | 3300048912 | Ga0496109_0001452 | Ga0496109_0001452_11964_12551 | 195 |
| 692 | 3300050491 | nmdc:mga00v17_68045_c1 | nmdc:mga00v17_68045_c1_1011_1601 | 195 |
| 693 | 3300050492 | nmdc:mga0yw44_97769_c1 | nmdc:mga0yw44_97769_c1_343_933 | 195 |
| 694 | 3300050516 | nmdc:mga0sz30_14117_c1 | nmdc:mga0sz30_14117_c1_160_750 | 195 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3svl-assembly1.cif.gz_B | structural basis of the improvement of chrr - a multi-purpose enzyme | 0.8896 | 19 | 193 |
| 1x77-assembly1.cif.gz_B | crystal structure of a nad(p)h-dependent fmn reductase complexed with fmn | 0.8757 | 19 | 189 |
| 3s2y-assembly1.cif.gz_A | crystal structure of a chromate/uranium reductase from gluconacetobacter hansenii | 0.8749 | 17 | 194 |
| 3u7r-assembly1.cif.gz_A | ferb - flavoenzyme nad(p)h:(acceptor) oxidoreductase (ferb) from paracoccus denitrificans | 0.8598 | 20 | 193 |
| 1x77-assembly1.cif.gz_B | crystal structure of a nad(p)h-dependent fmn reductase complexed with fmn | 0.8569 | 19 | 189 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P95105_3_183_3.40.50.360 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain | 0.9688 | 16 | 192 | 3.40.50.360 |
| af_P95105_3_183_3.40.50.360 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain | 0.9426 | 16 | 192 | 3.40.50.360 |
| 3svlA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain | 0.8921 | 19 | 194 | 3.40.50.360 |
| 1x77B00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain | 0.8757 | 19 | 189 | 3.40.50.360 |
| 3svlA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain | 0.8645 | 19 | 194 | 3.40.50.360 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0J6WRG8-F1-model_v4 | FMN-dependent NADPH-azoreductase (EC 1.7.-.-) | 0.9804 | 34 | 194 |
GO:0005829
GO:0010181 GO:0016491 |
| AF-A0A2S9FHX1-F1-model_v4 | FMN reductase | 0.9797 | 16 | 173 |
GO:0005829
GO:0010181 GO:0016491 |
| AF-A0A0I9VKA0-F1-model_v4 | FMN reductase | 0.9741 | 38 | 194 |
GO:0005829
GO:0010181 GO:0016491 |
| AF-A0A1G8R8N0-F1-model_v4 | NAD(P)H-dependent FMN reductase | 0.9716 | 17 | 164 |
GO:0005829
GO:0010181 GO:0016491 |
| AF-A0A1V3XZI5-F1-model_v4 | NADPH-dependent FMN reductase family protein | 0.9677 | 60 | 194 |
GO:0005829
GO:0010181 GO:0016491 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar