F475656

General Info

Members Datasets Scaffolds Average Seq Length
693 277 1386 352

Family's Representative Sequence

Representative Sequence 3300025986|Ga0207658_10084399|Ga0207658_100843992
Length 419
Sequence MADFYEVLGVERTSSDDEIKKSYRKLAMTYHPDRNNGSKEAEERFKEITEAYDVLRDPQKRAAYDRYGEAGLRGGGGGFHHVDLSEALGIFMRDFGGFGGLDELFGGGRGSGGPRSGPEVKINVPLTLAEVATGVERKITAKLLEPCDRCDGMGSEPGSGSHVCSTCGGQGEVRRAQRSFFGQFVTVGPCPTCHGEGRIVQRSEREITVHIPPGVATGQYMTLRGVGNAGTRGGPKGDIHVLFEVADDPRFERDGEDLYTEMLVTYSQLVLGAELSVPTVSGHTSMIMPAATQSGALFHLRGRGLPRVNASGTGDLHVRVQLWTPERLTDEERQLVARLGELQPGVPTDGQNLAVIDNADAVTKFFGFIHAVGGEQYRFLLRLGLQNKIVHGLGGEHIETGGRFVQDHQFGIVNDRPGD

Samples

Sample ID Description Type Environment
1 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
68 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
69 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
93 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
94 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
104 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
107 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
108 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
111 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
169 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
170 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
171 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
172 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
173 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
174 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
175 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
176 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
177 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
178 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
179 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
180 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
181 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
182 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
183 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
184 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
185 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
186 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
187 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
188 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
189 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
190 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
191 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
192 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
193 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
194 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
195 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
196 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
197 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
198 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
199 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
200 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
201 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
202 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
203 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
204 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
205 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
206 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
207 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
208 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
209 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
210 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
211 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
212 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
213 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
214 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
215 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
216 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
217 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
218 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
219 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
220 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
221 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
222 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
223 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
224 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
225 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
226 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
227 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
228 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
229 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
230 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
231 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
232 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
233 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
234 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
235 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
236 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
237 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
238 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
239 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
240 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
241 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
242 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
243 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
244 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
245 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
246 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
247 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
248 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
249 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
250 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
251 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
252 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
253 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
254 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
255 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
256 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
257 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
263 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
264 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
265 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
266 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
267 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
268 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
269 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
270 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
271 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
272 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
273 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
274 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
275 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
276 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
277 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.71
Metatranscriptomes 0.29
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.14
Nodule 0
Rhizoplane 1.59
Rhizosphere 97.69
Stem 0
Stem Tuber 0
Unclassified 3.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207658_10084399 3300025986 Bacteria 2444
2 JGI25406J46586_10014537 3300003203 Bacteria 3343
3 Ga0065712_10074141 3300005290 Bacteria 4174
4 Ga0065707_10092182 3300005295 Bacteria 3810
5 Ga0070658_10004996 3300005327 Bacteria 10800
6 Ga0070658_10005423 3300005327 Bacteria 10348
7 Ga0070658_10013422 3300005327 Bacteria 6573
8 Ga0070658_10062655 3300005327 Bacteria 3030
9 Ga0070658_10078366 3300005327 Bacteria 2712
10 Ga0070676_10004324 3300005328 Bacteria 7463
11 Ga0070683_100000233 3300005329 Bacteria 38043
12 Ga0070683_100000514 3300005329 Bacteria 27185
13 Ga0070683_100000681 3300005329 Bacteria 24634
14 Ga0070683_100001177 3300005329 Bacteria 19836
15 Ga0070683_100010079 3300005329 Bacteria 8106
16 Ga0070683_100012618 3300005329 Bacteria 7346
17 Ga0070683_100022357 3300005329 Bacteria 5651
18 Ga0070683_100028687 3300005329 Bacteria 5031
19 Ga0070683_100064125 3300005329 Bacteria 3419
20 Ga0070683_100117617 3300005329 Bacteria 2510
21 Ga0070683_100182595 3300005329 Bacteria 1991
22 Ga0070683_100191167 3300005329 Bacteria 1943
23 Ga0070690_100035706 3300005330 Bacteria 3120
24 Ga0070670_100008651 3300005331 Bacteria 8690
25 Ga0070670_100069486 3300005331 Bacteria 3023
26 Ga0070670_100305306 3300005331 Bacteria 1392
27 Ga0070677_10071915 3300005333 Bacteria 1457
28 Ga0068869_100000336 3300005334 Bacteria 25057
29 Ga0068869_100003185 3300005334 Bacteria 10023
30 Ga0070680_100000247 3300005336 Bacteria 35633
31 Ga0070680_100016854 3300005336 Bacteria 5751
32 Ga0070680_100024606 3300005336 Bacteria 4812
33 Ga0070680_100051855 3300005336 Bacteria 3349
34 Ga0070680_100054451 3300005336 Bacteria 3267
35 Ga0070680_100056039 3300005336 Bacteria 3221
36 Ga0070680_100071403 3300005336 Bacteria 2852
37 Ga0070680_100085150 3300005336 Bacteria 2611
38 Ga0070680_100183123 3300005336 Unclassified 1764
39 Ga0070682_100001941 3300005337 Bacteria 11536
40 Ga0070682_100010198 3300005337 Bacteria 5327
41 Ga0070682_100026246 3300005337 Unclassified 3485
42 Ga0068868_100011520 3300005338 Bacteria 6441
43 Ga0068868_100120896 3300005338 Bacteria 2136
44 Ga0070660_100008200 3300005339 Bacteria 7301
45 Ga0070660_100247296 3300005339 Bacteria 1454
46 Ga0070689_100003792 3300005340 Bacteria 10123
47 Ga0070689_100088983 3300005340 Bacteria 2431
48 Ga0070687_100003132 3300005343 Bacteria 6375
49 Ga0070687_100008700 3300005343 Bacteria 4311
50 Ga0070661_100001897 3300005344 Bacteria 14475
51 Ga0070661_100002382 3300005344 Bacteria 12899
52 Ga0070661_100013296 3300005344 Bacteria 5777
53 Ga0070661_100058604 3300005344 Bacteria 2822
54 Ga0070661_100134119 3300005344 Bacteria 1862
55 Ga0070692_10024886 3300005345 Bacteria 2946
56 Ga0070692_10037072 3300005345 Bacteria 2477
57 Ga0070692_10060877 3300005345 Bacteria 1989
58 Ga0070668_100004050 3300005347 Bacteria 10850
59 Ga0070668_100024456 3300005347 Bacteria 4578
60 Ga0070668_100114748 3300005347 Bacteria 2147
61 Ga0070668_100120996 3300005347 Bacteria 2092
62 Ga0070669_100002374 3300005353 Bacteria 13618
63 Ga0070669_100042271 3300005353 Bacteria 3316
64 Ga0070669_100068474 3300005353 Bacteria 2620
65 Ga0070669_100077758 3300005353 Bacteria 2465
66 Ga0070675_100000547 3300005354 Bacteria 25799
67 Ga0070675_100024098 3300005354 Bacteria 4872
68 Ga0070675_100103224 3300005354 Bacteria 2403
69 Ga0070671_100049109 3300005355 Bacteria 3511
70 Ga0070671_100186859 3300005355 Bacteria 1756
71 Ga0070671_100189193 3300005355 Bacteria 1744
72 Ga0070673_100013820 3300005364 Bacteria 5602
73 Ga0070673_100015564 3300005364 Bacteria 5348
74 Ga0070688_100045029 3300005365 Bacteria 2724
75 Ga0070659_100002963 3300005366 Bacteria 12102
76 Ga0070659_100006784 3300005366 Bacteria 8286
77 Ga0070659_100013320 3300005366 Bacteria 6119
78 Ga0070659_100135873 3300005366 Bacteria 1999
79 Ga0070659_100179653 3300005366 Bacteria 1736
80 Ga0070667_100004361 3300005367 Bacteria 11938
81 Ga0070709_10005909 3300005434 Bacteria 6640
82 Ga0070714_100002427 3300005435 Bacteria 13728
83 Ga0070714_100031866 3300005435 Bacteria 4400
84 Ga0070714_100102561 3300005435 Bacteria 2523
85 Ga0070714_100104152 3300005435 Bacteria 2504
86 Ga0070713_100040821 3300005436 Bacteria 3775
87 Ga0070713_100101756 3300005436 Bacteria 2490
88 Ga0070713_100374645 3300005436 Bacteria 1325
89 Ga0070701_10004902 3300005438 Bacteria 5476
90 Ga0070711_100204715 3300005439 Unclassified 1525
91 Ga0070694_100031602 3300005444 Unclassified 3472
92 Ga0070694_100033076 3300005444 Bacteria 3399
93 Ga0070694_100052941 3300005444 Bacteria 2745
94 Ga0070708_100000198 3300005445 Bacteria 44012
95 Ga0070708_100001891 3300005445 Bacteria 16085
96 Ga0070663_100035048 3300005455 Bacteria 3479
97 Ga0070663_100050711 3300005455 Bacteria 2953
98 Ga0070662_100093576 3300005457 Bacteria 2261
99 Ga0070681_10002832 3300005458 Bacteria 16029
100 Ga0070681_10005293 3300005458 Bacteria 12458
101 Ga0070681_10009589 3300005458 Bacteria 9518
102 Ga0070681_10015723 3300005458 Bacteria 7542
103 Ga0070681_10015818 3300005458 Bacteria 7520
104 Ga0070681_10016105 3300005458 Bacteria 7452
105 Ga0070681_10020486 3300005458 Bacteria 6628
106 Ga0070681_10028341 3300005458 Bacteria 5629
107 Ga0070681_10084923 3300005458 Unclassified 3118
108 Ga0070681_10134037 3300005458 Bacteria 2408
109 Ga0068867_100006641 3300005459 Bacteria 8180
110 Ga0068867_100037140 3300005459 Bacteria 3540
111 Ga0068867_100199504 3300005459 Unclassified 1601
112 Ga0070685_10005071 3300005466 Bacteria 6679
113 Ga0070685_10094490 3300005466 Bacteria 1816
114 Ga0070706_100043371 3300005467 Unclassified 4156
115 Ga0070706_100052636 3300005467 Bacteria 3757
116 Ga0070707_100001652 3300005468 Bacteria 21586
117 Ga0070707_100041672 3300005468 Bacteria 4395
118 Ga0070698_100014818 3300005471 Bacteria 8242
119 Ga0070698_100103699 3300005471 Unclassified 2814
120 Ga0070698_100170602 3300005471 Bacteria 2117
121 Ga0070699_100027917 3300005518 Unclassified 4868
122 Ga0070699_100162663 3300005518 Unclassified 1976
123 Ga0070699_100180756 3300005518 Bacteria 1872
124 Ga0070699_100191883 3300005518 Bacteria 1815
125 Ga0070679_100000919 3300005530 Bacteria 25597
126 Ga0070679_100001084 3300005530 Bacteria 23776
127 Ga0070679_100005710 3300005530 Bacteria 11536
128 Ga0070679_100012109 3300005530 Bacteria 8239
129 Ga0070679_100013730 3300005530 Bacteria 7758
130 Ga0070679_100013800 3300005530 Bacteria 7741
131 Ga0070679_100017101 3300005530 Bacteria 7011
132 Ga0070679_100022028 3300005530 Bacteria 6225
133 Ga0070679_100022708 3300005530 Bacteria 6134
134 Ga0070679_100028983 3300005530 Bacteria 5461
135 Ga0070679_100085135 3300005530 Bacteria 3148
136 Ga0070679_100088685 3300005530 Bacteria 3080
137 Ga0070679_100089861 3300005530 Bacteria 3059
138 Ga0070679_100090193 3300005530 Bacteria 3053
139 Ga0070679_100109239 3300005530 Bacteria 2752
140 Ga0070679_100113964 3300005530 Bacteria 2689
141 Ga0070679_100119351 3300005530 Bacteria 2622
142 Ga0070684_100003476 3300005535 Bacteria 11821
143 Ga0070684_100032431 3300005535 Bacteria 4452
144 Ga0070684_100038600 3300005535 Bacteria 4103
145 Ga0070684_100040297 3300005535 Bacteria 4021
146 Ga0070684_100048167 3300005535 Bacteria 3697
147 Ga0070684_100074290 3300005535 Bacteria 2997
148 Ga0070684_100129403 3300005535 Bacteria 2276
149 Ga0070684_100135899 3300005535 Bacteria 2221
150 Ga0070684_100277451 3300005535 Bacteria 1535
151 Ga0068853_100017714 3300005539 Bacteria 5879
152 Ga0068853_100047354 3300005539 Bacteria 3689
153 Ga0068853_100119660 3300005539 Bacteria 2348
154 Ga0068853_100211796 3300005539 Bacteria 1766
155 Ga0070672_100007248 3300005543 Bacteria 7513
156 Ga0070672_100064455 3300005543 Bacteria 2895
157 Ga0070672_100102860 3300005543 Bacteria 2319
158 Ga0070672_100140621 3300005543 Bacteria 1991
159 Ga0070686_100039046 3300005544 Bacteria 2956
160 Ga0070686_100046711 3300005544 Bacteria 2734
161 Ga0070686_100115823 3300005544 Bacteria 1833
162 Ga0070695_100088088 3300005545 Unclassified 2066
163 Ga0070696_100000551 3300005546 Bacteria 23823
164 Ga0070696_100002054 3300005546 Bacteria 13194
165 Ga0070696_100125040 3300005546 Bacteria 1865
166 Ga0070693_100005997 3300005547 Bacteria 5876
167 Ga0070693_100014748 3300005547 Bacteria 4011
168 Ga0070665_100100436 3300005548 Bacteria 2897
169 Ga0070665_100170374 3300005548 Bacteria 2178
170 Ga0070665_100457749 3300005548 Bacteria 1286
171 Ga0070704_100036169 3300005549 Bacteria 3362
172 Ga0068855_100002169 3300005563 Bacteria 24243
173 Ga0068855_100071996 3300005563 Bacteria 4018
174 Ga0068855_100084662 3300005563 Bacteria 3670
175 Ga0068855_100120858 3300005563 Bacteria 2998
176 Ga0068855_100144311 3300005563 Bacteria 2711
177 Ga0068855_100229978 3300005563 Bacteria 2077
178 Ga0070664_100005037 3300005564 Bacteria 10588
179 Ga0070664_100005450 3300005564 Bacteria 10216
180 Ga0070664_100005697 3300005564 Bacteria 10028
181 Ga0070664_100013631 3300005564 Bacteria 6625
182 Ga0070664_100024347 3300005564 Bacteria 5006
183 Ga0070664_100030994 3300005564 Bacteria 4464
184 Ga0068857_100003188 3300005577 Bacteria 13600
185 Ga0068857_100003673 3300005577 Bacteria 12858
186 Ga0068854_100006806 3300005578 Bacteria 7287
187 Ga0068854_100036544 3300005578 Bacteria 3444
188 Ga0068856_100116131 3300005614 Bacteria 2676
189 Ga0068856_100196378 3300005614 Bacteria 2032
190 Ga0068852_100006303 3300005616 Bacteria 8560
191 Ga0068852_100026069 3300005616 Bacteria 4746
192 Ga0068852_100059569 3300005616 Bacteria 3311
193 Ga0068859_100001968 3300005617 Bacteria 20974
194 Ga0068864_100003498 3300005618 Bacteria 12984
195 Ga0068864_100079926 3300005618 Bacteria 2864
196 Ga0068864_100244999 3300005618 Bacteria 1662
197 Ga0068864_100298960 3300005618 Bacteria 1506
198 Ga0068861_100054984 3300005719 Bacteria 3034
199 Ga0068863_100035359 3300005841 Bacteria 4759
200 Ga0068863_100035623 3300005841 Bacteria 4739
201 Ga0068858_100023097 3300005842 Bacteria 5801
202 Ga0068860_100006907 3300005843 Bacteria 11382
203 Ga0068860_100014614 3300005843 Bacteria 7682
204 Ga0068862_100008006 3300005844 Bacteria 8745
205 Ga0068862_100035187 3300005844 Bacteria 4240
206 Ga0068862_100101661 3300005844 Bacteria 2515
207 Ga0081539_10000104 3300005985 Bacteria 197478
208 Ga0081539_10007610 3300005985 Bacteria 9785
209 Ga0070716_100115161 3300006173 Unclassified 1673
210 Ga0070712_100034406 3300006175 Bacteria 3433
211 Ga0070712_100119018 3300006175 Bacteria 1984
212 Ga0068871_100082816 3300006358 Bacteria 2661
213 Ga0075428_100011627 3300006844 Bacteria 9794
214 Ga0075428_100296614 3300006844 Bacteria 1738
215 Ga0075428_100356309 3300006844 Bacteria 1570
216 Ga0075430_100019456 3300006846 Bacteria 5774
217 Ga0075430_100048505 3300006846 Unclassified 3585
218 Ga0075430_100095148 3300006846 Bacteria 2490
219 Ga0075431_100028784 3300006847 Bacteria 5712
220 Ga0075431_100053253 3300006847 Bacteria 4173
221 Ga0075433_10173526 3300006852 Bacteria 1918
222 Ga0075434_100003813 3300006871 Bacteria 13478
223 Ga0075434_100008741 3300006871 Bacteria 9423
224 Ga0075434_100010289 3300006871 Bacteria 8766
225 Ga0075434_100052266 3300006871 Bacteria 4060
226 Ga0075429_100137126 3300006880 Bacteria 2141
227 Ga0068865_100007656 3300006881 Bacteria 6653
228 Ga0068865_100017573 3300006881 Bacteria 4601
229 Ga0075436_100092496 3300006914 Unclassified 2102
230 Ga0097620_100001968 3300006931 Bacteria 20974
231 Ga0075435_100151028 3300007076 Bacteria 1953
232 Ga0105240_10006020 3300009093 Bacteria 17933
233 Ga0105240_10008178 3300009093 Bacteria 15002
234 Ga0105240_10066790 3300009093 Bacteria 4460
235 Ga0105240_10070949 3300009093 Bacteria 4308
236 Ga0105240_10160833 3300009093 Unclassified 2667
237 Ga0105240_10206879 3300009093 Bacteria 2296
238 Ga0111539_10015785 3300009094 Bacteria 9382
239 Ga0105245_10004762 3300009098 Bacteria 11978
240 Ga0105245_10044478 3300009098 Bacteria 3963
241 Ga0114129_10084927 3300009147 Bacteria 4393
242 Ga0114129_10177879 3300009147 Bacteria 2897
243 Ga0114129_10179528 3300009147 Unclassified 2882
244 Ga0114129_10380175 3300009147 Bacteria 1865
245 Ga0114129_10531002 3300009147 Bacteria 1533
246 Ga0105243_10061354 3300009148 Bacteria 3007
247 Ga0105243_10067559 3300009148 Bacteria 2878
248 Ga0105241_10003558 3300009174 Bacteria 11587
249 Ga0105241_10092847 3300009174 Unclassified 2384
250 Ga0105242_10015933 3300009176 Bacteria 5840
251 Ga0105242_10164979 3300009176 Bacteria 1942
252 Ga0105242_10284869 3300009176 Bacteria 1502
253 Ga0105248_10015710 3300009177 Bacteria 8344
254 Ga0105248_10037355 3300009177 Bacteria 5434
255 Ga0105248_10047905 3300009177 Bacteria 4794
256 Ga0105248_10064042 3300009177 Bacteria 4127
257 Ga0105238_10014395 3300009551 Bacteria 7995
258 Ga0105238_10064165 3300009551 Bacteria 3673
259 Ga0105249_10000115 3300009553 Bacteria 108581
260 Ga0105249_10000401 3300009553 Bacteria 41704
261 Ga0105249_10008138 3300009553 Bacteria 9142
262 Ga0105246_10000533 3300011119 Bacteria 20789
263 Ga0105246_10227921 3300011119 Bacteria 1465
264 Ga0157373_10009388 3300013100 Bacteria 7225
265 Ga0157373_10022302 3300013100 Bacteria 4594
266 Ga0157373_10056829 3300013100 Bacteria 2777
267 Ga0157373_10090003 3300013100 Bacteria 2161
268 Ga0157371_10008714 3300013102 Bacteria 8053
269 Ga0157371_10011797 3300013102 Bacteria 6709
270 Ga0157371_10024297 3300013102 Bacteria 4427
271 Ga0157371_10029364 3300013102 Bacteria 3977
272 Ga0157371_10080965 3300013102 Bacteria 2299
273 Ga0157370_10003194 3300013104 Bacteria 19381
274 Ga0157370_10011107 3300013104 Bacteria 9441
275 Ga0157370_10016614 3300013104 Bacteria 7446
276 Ga0157370_10038072 3300013104 Unclassified 4655
277 Ga0157370_10066035 3300013104 Bacteria 3422
278 Ga0157370_10178918 3300013104 Bacteria 1971
279 Ga0157370_10220274 3300013104 Bacteria 1758
280 Ga0157370_10282877 3300013104 Bacteria 1532
281 Ga0157369_10014454 3300013105 Bacteria 8912
282 Ga0157369_10050957 3300013105 Bacteria 4481
283 Ga0157369_10109351 3300013105 Bacteria 2939
284 Ga0157369_10110337 3300013105 Bacteria 2925
285 Ga0157369_10117438 3300013105 Bacteria 2824
286 Ga0157369_10175421 3300013105 Bacteria 2257
287 Ga0157369_10195657 3300013105 Bacteria 2123
288 Ga0157369_10345829 3300013105 Bacteria 1545
289 Ga0157374_10007525 3300013296 Bacteria 9292
290 Ga0157374_10035307 3300013296 Bacteria 4574
291 Ga0157374_10196383 3300013296 Bacteria 1975
292 Ga0157378_10052302 3300013297 Bacteria 3635
293 Ga0157378_10095535 3300013297 Bacteria 2707
294 Ga0157378_10110317 3300013297 Bacteria 2521
295 Ga0163162_10006251 3300013306 Bacteria 11547
296 Ga0163162_10223977 3300013306 Bacteria 2010
297 Ga0163162_10263025 3300013306 Bacteria 1857
298 Ga0157372_10004359 3300013307 Bacteria 15110
299 Ga0157372_10007785 3300013307 Bacteria 11380
300 Ga0157372_10015537 3300013307 Bacteria 8158
301 Ga0157372_10041599 3300013307 Bacteria 5082
302 Ga0157372_10043906 3300013307 Bacteria 4952
303 Ga0157372_10046069 3300013307 Bacteria 4840
304 Ga0157372_10048726 3300013307 Bacteria 4709
305 Ga0157372_10053003 3300013307 Bacteria 4520
306 Ga0157372_10081638 3300013307 Bacteria 3660
307 Ga0157372_10107399 3300013307 Bacteria 3194
308 Ga0157372_10146616 3300013307 Bacteria 2722
309 Ga0157372_10397866 3300013307 Bacteria 1605
310 Ga0157375_10007703 3300013308 Bacteria 9424
311 Ga0157375_10038310 3300013308 Bacteria 4603
312 Ga0157375_10041030 3300013308 Bacteria 4466
313 Ga0157375_10051494 3300013308 Bacteria 4044
314 Ga0157375_10264842 3300013308 Bacteria 1880
315 Ga0163163_10018416 3300014325 Bacteria 6537
316 Ga0163163_10079023 3300014325 Bacteria 3287
317 Ga0163163_10115851 3300014325 Bacteria 2711
318 Ga0163163_10226981 3300014325 Bacteria 1916
319 Ga0157380_10002943 3300014326 Bacteria 11579
320 Ga0157380_10049850 3300014326 Bacteria 3304
321 Ga0157380_10084621 3300014326 Bacteria 2601
322 Ga0182008_10008049 3300014497 Bacteria 5777
323 Ga0157377_10021353 3300014745 Bacteria 3405
324 Ga0157377_10023237 3300014745 Bacteria 3284
325 Ga0157379_10002779 3300014968 Bacteria 14754
326 Ga0157379_10059347 3300014968 Bacteria 3420
327 Ga0157376_10039825 3300014969 Bacteria 3836
328 Ga0157376_10069366 3300014969 Bacteria 2988
329 Ga0157376_10237368 3300014969 Bacteria 1697
330 Ga0182007_10032244 3300015262 Bacteria 1780
331 Ga0206356_11186412 3300020070 Bacteria 1253
332 Ga0206353_11619150 3300020082 Bacteria 1858
333 Ga0213876_10019759 3300021384 Bacteria 3558
334 Ga0213876_10049095 3300021384 Bacteria 2229
335 Ga0207682_10014448 3300025893 Bacteria 3076
336 Ga0207688_10014918 3300025901 Bacteria 4216
337 Ga0207699_10058902 3300025906 Bacteria 2299
338 Ga0207645_10000246 3300025907 Bacteria 44995
339 Ga0207645_10067686 3300025907 Bacteria 2283
340 Ga0207643_10017232 3300025908 Bacteria 3947
341 Ga0207643_10092803 3300025908 Bacteria 1762
342 Ga0207705_10006743 3300025909 Bacteria 8485
343 Ga0207705_10007107 3300025909 Bacteria 8254
344 Ga0207705_10008483 3300025909 Bacteria 7499
345 Ga0207684_10043263 3300025910 Bacteria 3818
346 Ga0207654_10012141 3300025911 Bacteria 4409
347 Ga0207707_10000876 3300025912 Bacteria 29431
348 Ga0207707_10002146 3300025912 Bacteria 17846
349 Ga0207707_10005339 3300025912 Bacteria 11230
350 Ga0207707_10005860 3300025912 Bacteria 10743
351 Ga0207707_10008528 3300025912 Bacteria 8885
352 Ga0207707_10018258 3300025912 Bacteria 6114
353 Ga0207707_10031769 3300025912 Bacteria 4621
354 Ga0207707_10040615 3300025912 Unclassified 4063
355 Ga0207707_10093736 3300025912 Bacteria 2623
356 Ga0207695_10001441 3300025913 Bacteria 39845
357 Ga0207695_10008377 3300025913 Bacteria 12951
358 Ga0207695_10022335 3300025913 Bacteria 7185
359 Ga0207695_10035123 3300025913 Bacteria 5441
360 Ga0207695_10068826 3300025913 Bacteria 3626
361 Ga0207695_10143291 3300025913 Bacteria 2336
362 Ga0207695_10188514 3300025913 Bacteria 1981
363 Ga0207693_10059507 3300025915 Bacteria 2993
364 Ga0207693_10092300 3300025915 Bacteria 2373
365 Ga0207663_10175365 3300025916 Unclassified 1526
366 Ga0207660_10000668 3300025917 Bacteria 22904
367 Ga0207660_10004932 3300025917 Bacteria 8694
368 Ga0207660_10006151 3300025917 Bacteria 7791
369 Ga0207660_10027528 3300025917 Bacteria 3880
370 Ga0207662_10001341 3300025918 Bacteria 11871
371 Ga0207662_10004709 3300025918 Bacteria 7200
372 Ga0207662_10135555 3300025918 Bacteria 1556
373 Ga0207657_10005262 3300025919 Bacteria 13552
374 Ga0207657_10006241 3300025919 Bacteria 12390
375 Ga0207657_10103320 3300025919 Bacteria 2362
376 Ga0207657_10103964 3300025919 Bacteria 2354
377 Ga0207657_10196338 3300025919 Bacteria 1626
378 Ga0207657_10210111 3300025919 Bacteria 1562
379 Ga0207649_10001792 3300025920 Bacteria 12287
380 Ga0207649_10064071 3300025920 Bacteria 2323
381 Ga0207649_10064899 3300025920 Bacteria 2310
382 Ga0207652_10000470 3300025921 Bacteria 41380
383 Ga0207652_10001653 3300025921 Bacteria 19560
384 Ga0207652_10004024 3300025921 Bacteria 12004
385 Ga0207652_10016760 3300025921 Bacteria 5988
386 Ga0207652_10025277 3300025921 Bacteria 4935
387 Ga0207652_10072098 3300025921 Bacteria 3003
388 Ga0207652_10073456 3300025921 Bacteria 2975
389 Ga0207652_10083420 3300025921 Bacteria 2798
390 Ga0207652_10101958 3300025921 Bacteria 2536
391 Ga0207652_10106841 3300025921 Bacteria 2478
392 Ga0207652_10172424 3300025921 Bacteria 1941
393 Ga0207652_10263080 3300025921 Bacteria 1556
394 Ga0207646_10004872 3300025922 Bacteria 14384
395 Ga0207646_10032931 3300025922 Bacteria 4688
396 Ga0207681_10026439 3300025923 Bacteria 3743
397 Ga0207681_10040852 3300025923 Bacteria 3088
398 Ga0207681_10042307 3300025923 Bacteria 3043
399 Ga0207650_10005580 3300025925 Bacteria 8591
400 Ga0207659_10013350 3300025926 Bacteria 5257
401 Ga0207659_10015531 3300025926 Bacteria 4937
402 Ga0207659_10059792 3300025926 Bacteria 2740
403 Ga0207659_10133037 3300025926 Bacteria 1922
404 Ga0207687_10114776 3300025927 Bacteria 2005
405 Ga0207687_10176234 3300025927 Bacteria 1653
406 Ga0207700_10186370 3300025928 Bacteria 1741
407 Ga0207664_10032293 3300025929 Bacteria 4011
408 Ga0207644_10038355 3300025931 Bacteria 3375
409 Ga0207644_10128653 3300025931 Bacteria 1936
410 Ga0207644_10144944 3300025931 Bacteria 1833
411 Ga0207644_10197267 3300025931 Bacteria 1586
412 Ga0207690_10003494 3300025932 Bacteria 9371
413 Ga0207690_10050602 3300025932 Bacteria 2774
414 Ga0207690_10160812 3300025932 Bacteria 1674
415 Ga0207690_10182760 3300025932 Bacteria 1580
416 Ga0207690_10212685 3300025932 Bacteria 1475
417 Ga0207706_10000357 3300025933 Bacteria 49369
418 Ga0207706_10003260 3300025933 Bacteria 15543
419 Ga0207706_10004509 3300025933 Bacteria 13079
420 Ga0207686_10013975 3300025934 Bacteria 4457
421 Ga0207686_10081629 3300025934 Bacteria 2111
422 Ga0207670_10222669 3300025936 Bacteria 1445
423 Ga0207704_10009122 3300025938 Bacteria 4772
424 Ga0207665_10005757 3300025939 Bacteria 8248
425 Ga0207691_10001314 3300025940 Bacteria 24795
426 Ga0207691_10001355 3300025940 Bacteria 24425
427 Ga0207691_10002440 3300025940 Bacteria 18181
428 Ga0207691_10045697 3300025940 Bacteria 4024
429 Ga0207691_10052495 3300025940 Bacteria 3723
430 Ga0207691_10105255 3300025940 Bacteria 2513
431 Ga0207711_10039169 3300025941 Bacteria 4032
432 Ga0207711_10257910 3300025941 Bacteria 1602
433 Ga0207689_10000838 3300025942 Bacteria 29648
434 Ga0207689_10001360 3300025942 Bacteria 23476
435 Ga0207661_10002707 3300025944 Bacteria 12194
436 Ga0207661_10008394 3300025944 Bacteria 7381
437 Ga0207661_10044374 3300025944 Unclassified 3513
438 Ga0207661_10044663 3300025944 Bacteria 3503
439 Ga0207661_10047245 3300025944 Bacteria 3416
440 Ga0207661_10047915 3300025944 Bacteria 3394
441 Ga0207661_10077981 3300025944 Bacteria 2726
442 Ga0207661_10105046 3300025944 Bacteria 2379
443 Ga0207679_10000484 3300025945 Bacteria 27676
444 Ga0207679_10001293 3300025945 Bacteria 15800
445 Ga0207679_10018504 3300025945 Bacteria 4668
446 Ga0207679_10019244 3300025945 Bacteria 4584
447 Ga0207679_10107419 3300025945 Bacteria 2196
448 Ga0207679_10113393 3300025945 Bacteria 2144
449 Ga0207679_10159398 3300025945 Bacteria 1846
450 Ga0207679_10208856 3300025945 Bacteria 1636
451 Ga0207667_10053390 3300025949 Bacteria 4253
452 Ga0207667_10060596 3300025949 Bacteria 3961
453 Ga0207667_10064918 3300025949 Bacteria 3809
454 Ga0207667_10086080 3300025949 Bacteria 3253
455 Ga0207667_10163089 3300025949 Bacteria 2292
456 Ga0207651_10008005 3300025960 Bacteria 5674
457 Ga0207651_10075620 3300025960 Bacteria 2404
458 Ga0207712_10000261 3300025961 Bacteria 51172
459 Ga0207712_10023446 3300025961 Bacteria 4072
460 Ga0207712_10081407 3300025961 Bacteria 2358
461 Ga0207712_10127846 3300025961 Bacteria 1932
462 Ga0207668_10025923 3300025972 Bacteria 3801
463 Ga0207668_10028200 3300025972 Bacteria 3668
464 Ga0207668_10124931 3300025972 Bacteria 1955
465 Ga0207640_10001447 3300025981 Bacteria 12838
466 Ga0207677_10085945 3300026023 Bacteria 2272
467 Ga0207677_10098909 3300026023 Bacteria 2141
468 Ga0207703_10005549 3300026035 Bacteria 10126
469 Ga0207703_10018395 3300026035 Bacteria 5456
470 Ga0207639_10056244 3300026041 Bacteria 3014
471 Ga0207678_10043360 3300026067 Bacteria 3893
472 Ga0207678_10064852 3300026067 Bacteria 3138
473 Ga0207678_10352355 3300026067 Bacteria 1269
474 Ga0207708_10009137 3300026075 Bacteria 7335
475 Ga0207708_10147316 3300026075 Bacteria 1851
476 Ga0207702_10021489 3300026078 Bacteria 5343
477 Ga0207702_10177157 3300026078 Unclassified 1960
478 Ga0207641_10027060 3300026088 Bacteria 4735
479 Ga0207648_10020613 3300026089 Bacteria 5935
480 Ga0207648_10103217 3300026089 Bacteria 2500
481 Ga0207676_10019403 3300026095 Bacteria 4960
482 Ga0207676_10033765 3300026095 Bacteria 3869
483 Ga0207674_10001189 3300026116 Bacteria 33857
484 Ga0207674_10002932 3300026116 Bacteria 21199
485 Ga0207674_10003135 3300026116 Bacteria 20383
486 Ga0207674_10005220 3300026116 Bacteria 15462
487 Ga0207674_10012363 3300026116 Bacteria 9541
488 Ga0207675_100000320 3300026118 Bacteria 45668
489 Ga0207675_100013219 3300026118 Bacteria 7705
490 Ga0207683_10136578 3300026121 Bacteria 2207
491 Ga0207698_10034085 3300026142 Bacteria 3708
492 Ga0207698_10061309 3300026142 Bacteria 2930
493 Ga0207698_10103138 3300026142 Bacteria 2370
494 Ga0207698_10117738 3300026142 Bacteria 2242
495 Ga0207698_10137784 3300026142 Bacteria 2097
496 Ga0268266_10264078 3300028379 Bacteria 1596
497 Ga0268265_10002328 3300028380 Bacteria 14426
498 Ga0268265_10002878 3300028380 Bacteria 12639
499 Ga0268265_10058847 3300028380 Bacteria 2937
500 Ga0268264_10062003 3300028381 Bacteria 3138
501 Ga0307408_100007391 3300031548 Bacteria 7267
502 Ga0307408_100013358 3300031548 Bacteria 5448
503 Ga0307408_100066818 3300031548 Bacteria 2642
504 Ga0307408_100210703 3300031548 Bacteria 1579
505 Ga0265314_10096746 3300031711 Bacteria 1909
506 Ga0265342_10112420 3300031712 Bacteria 1540
507 Ga0307405_10010875 3300031731 Bacteria 4742
508 Ga0307405_10243964 3300031731 Bacteria 1332
509 Ga0307405_10249552 3300031731 Bacteria 1320
510 Ga0307413_10131026 3300031824 Bacteria 1716
511 Ga0307413_10175874 3300031824 Bacteria 1520
512 Ga0307410_10017368 3300031852 Bacteria 4320
513 Ga0307410_10058134 3300031852 Bacteria 2635
514 Ga0307406_10075302 3300031901 Bacteria 2226
515 Ga0307407_10024310 3300031903 Bacteria 3175
516 Ga0307412_10036611 3300031911 Bacteria 3146
517 Ga0307412_10043150 3300031911 Bacteria 2935
518 Ga0307409_100031385 3300031995 Bacteria 3834
519 Ga0307409_100061229 3300031995 Bacteria 2940
520 Ga0307416_100079125 3300032002 Bacteria 2769
521 Ga0307414_10041776 3300032004 Bacteria 3110
522 Ga0307411_10019320 3300032005 Bacteria 3933
523 Ga0307415_100051969 3300032126 Bacteria 2784
524 Ga0307415_100152746 3300032126 Unclassified 1779
525 Ga0307415_100203427 3300032126 Bacteria 1573
526 Ga0307415_100318637 3300032126 Unclassified 1295
527 Ga0373926_0011735 3300035083 Bacteria 2954
528 Ga0373934_0000634 3300035086 Bacteria 12395
529 Ga0373923_0025011 3300035111 Bacteria 2362
530 Ga0373953_0003513 3300035117 Bacteria 4894
531 Ga0373956_0001499 3300035119 Bacteria 9653
532 Ga0373956_0020714 3300035119 Bacteria 2801
533 Ga0373957_0003604 3300035120 Bacteria 4607
534 Ga0373957_0019864 3300035120 Bacteria 2368
535 Ga0373943_0014118 3300035170 Bacteria 3612
536 Ga0373946_0009378 3300035171 Bacteria 3605
537 Ga0373955_0002318 3300035172 Bacteria 8282
538 Ga0373955_0005518 3300035172 Bacteria 5687
539 Ga0373955_0025532 3300035172 Bacteria 3035
540 Ga0373924_0003270 3300035410 Bacteria 5547
541 Ga0373931_0004289 3300035691 Bacteria 6494
542 Ga0373935_0009344 3300035692 Bacteria 5871
543 Ga0373935_0035384 3300035692 Bacteria 3117
544 Ga0373927_0009006 3300035695 Bacteria 6701
545 Ga0373933_0003442 3300035724 Bacteria 8813
546 Ga0373933_0008374 3300035724 Bacteria 5647
547 Ga0373947_0023043 3300035725 Bacteria 3618
548 Ga0373947_0182364 3300035725 Bacteria 1367
549 Ga0373937_0002914 3300036401 Bacteria 14299
550 Ga0373937_0018683 3300036401 Bacteria 6194
551 Ga0373937_0068884 3300036401 Bacteria 3262
552 Ga0373925_0023547 3300037068 Bacteria 4493
553 Ga0395899_0003367 3300037312 Bacteria 12685
554 Ga0395900_0127813 3300037418 Bacteria 2605
555 Ga0395901_0003407 3300038443 Bacteria 16018
556 Ga0436365_1250967 3300039437 Bacteria 3720
557 Ga0436365_1912646 3300039437 Bacteria 7151
558 Ga0466966_0044033 3300044684 Bacteria 2859
559 Ga0466966_0060997 3300044684 Bacteria 2379
560 Ga0466961_0128320 3300044693 Bacteria 1590
561 Ga0466963_0165873 3300044694 Bacteria 1538
562 Ga0466957_0022468 3300044842 Bacteria 3722
563 Ga0451576_0047797 3300045051 Bacteria 4497
564 Ga0466967_0174892 3300045976 Bacteria 2022
565 Ga0466967_0177166 3300045976 Bacteria 2009
566 Ga0466967_0281833 3300045976 Bacteria 1595
567 Ga0495603_0020339 3300046455 Bacteria 4022
568 Ga0495629_0013239 3300046459 Bacteria 5956
569 Ga0495629_0020203 3300046459 Bacteria 4757
570 Ga0495651_0001301 3300046462 Bacteria 19332
571 Ga0495651_0030637 3300046462 Bacteria 4195
572 Ga0495653_0003982 3300046463 Bacteria 11925
573 Ga0495653_0094023 3300046463 Bacteria 2185
574 Ga0495580_0092084 3300046472 Bacteria 2110
575 Ga0495580_0252263 3300046472 Bacteria 1208
576 Ga0495582_0039385 3300046473 Bacteria 2602
577 Ga0495582_0126876 3300046473 Bacteria 1440
578 Ga0495582_0166455 3300046473 Bacteria 1254
579 Ga0495639_0011476 3300046475 Bacteria 3820
580 Ga0495662_0052635 3300046476 Bacteria 1966
581 Ga0495664_0013948 3300046477 Bacteria 4554
582 Ga0495664_0102424 3300046477 Bacteria 1726
583 Ga0495594_0004366 3300046499 Bacteria 7271
584 Ga0495594_0008638 3300046499 Bacteria 5248
585 Ga0495596_0023851 3300046500 Bacteria 2481
586 Ga0495608_0005135 3300046511 Bacteria 9356
587 Ga0495608_0030278 3300046511 Bacteria 3665
588 Ga0495618_0166788 3300046514 Bacteria 1402
589 Ga0495628_0000494 3300046516 Bacteria 36135
590 Ga0495628_0099889 3300046516 Bacteria 2240
591 Ga0495630_0017982 3300046517 Bacteria 5187
592 Ga0495630_0052906 3300046517 Bacteria 3040
593 Ga0495666_0043592 3300046526 Bacteria 2167
594 Ga0495652_0007351 3300046529 Bacteria 10157
595 Ga0495652_0097544 3300046529 Bacteria 2391
596 Ga0495665_0001279 3300046531 Bacteria 13420
597 Ga0495665_0002007 3300046531 Bacteria 11006
598 Ga0495640_0056056 3300046533 Bacteria 2694
599 Ga0495587_0000269 3300046536 Bacteria 37262
600 Ga0495587_0000334 3300046536 Bacteria 33589
601 Ga0495645_0000918 3300046543 Bacteria 20080
602 Ga0495645_0001039 3300046543 Bacteria 18908
603 Ga0495645_0006424 3300046543 Bacteria 8159
604 Ga0495645_0035434 3300046543 Bacteria 3638
605 Ga0495667_0003294 3300046559 Bacteria 10826
606 Ga0495667_0049763 3300046559 Bacteria 2766
607 Ga0495635_0000200 3300046663 Bacteria 37911
608 Ga0495588_0008801 3300046674 Bacteria 4640
609 Ga0495657_0001237 3300046675 Bacteria 22362
610 Ga0495657_0063234 3300046675 Bacteria 2442
611 Ga0495599_0000385 3300046678 Bacteria 25410
612 Ga0495599_0001207 3300046678 Bacteria 14651
613 Ga0495599_0011790 3300046678 Bacteria 5374
614 Ga0495599_0013493 3300046678 Bacteria 5048
615 Ga0495623_0000156 3300046679 Bacteria 42279
616 Ga0495623_0005693 3300046679 Bacteria 8137
617 Ga0495623_0011192 3300046679 Bacteria 5803
618 Ga0495646_0006285 3300046680 Bacteria 7536
619 Ga0495646_0078710 3300046680 Bacteria 1926
620 Ga0495658_0012670 3300046683 Bacteria 4277
621 Ga0495658_0028872 3300046683 Bacteria 2998
622 Ga0495658_0124750 3300046683 Bacteria 1561
623 Ga0495613_0089498 3300046689 Bacteria 2230
624 Ga0495613_0114617 3300046689 Bacteria 1940
625 Ga0495670_0035726 3300046691 Bacteria 2476
626 Ga0495600_0001690 3300046809 Bacteria 12334
627 Ga0495581_0005093 3300047315 Bacteria 7613
628 Ga0495581_0047156 3300047315 Bacteria 2490
629 Ga0495581_0107567 3300047315 Bacteria 1621
630 Ga0495604_0004394 3300047317 Bacteria 11161
631 Ga0495604_0006752 3300047317 Bacteria 9102
632 Ga0495604_0046306 3300047317 Bacteria 3391
633 Ga0495672_0031676 3300047320 Bacteria 3299
634 Ga0495680_0166784 3300047322 Bacteria 1596
635 Ga0495675_0003343 3300047444 Bacteria 9656
636 Ga0495675_0029223 3300047444 Unclassified 3515
637 Ga0495684_0002113 3300047471 Bacteria 15945
638 Ga0495684_0003435 3300047471 Bacteria 12412
639 Ga0495684_0056038 3300047471 Bacteria 3006
640 Ga0495593_0083928 3300047673 Bacteria 1645
641 Ga0495602_0005326 3300048088 Bacteria 13502
642 Ga0495602_0023888 3300048088 Bacteria 5944
643 Ga0495614_0013032 3300048089 Bacteria 3644
644 Ga0496107_0034919 3300048910 Bacteria 3604
645 Ga0496108_0065054 3300048911 Bacteria 3073
646 Ga0496108_0142631 3300048911 Bacteria 2064
647 Ga0496109_0237827 3300048912 Bacteria 1714
648 Ga0496109_0291223 3300048912 Bacteria 1539
649 Ga0496110_0215459 3300048913 Bacteria 1746
650 Ga0496112_0000196 3300048915 Bacteria 39516
651 Ga0496112_0097749 3300048915 Bacteria 2906
652 Ga0496112_0122529 3300048915 Bacteria 2570
653 Ga0496113_0157478 3300048916 Bacteria 1794
654 Ga0496115_0062295 3300048918 Bacteria 3009
655 Ga0501033_0014545 3300049570 Bacteria 5974
656 Ga0501033_0069617 3300049570 Bacteria 2586
657 Ga0501034_0025845 3300049571 Bacteria 5981
658 Ga0501034_0045863 3300049571 Bacteria 4416
659 Ga0501034_0159382 3300049571 Bacteria 2229
660 Ga0501038_0138789 3300049574 Bacteria 1990
661 Ga0501046_0182635 3300049580 Bacteria 1568
662 Ga0501047_0018189 3300049581 Bacteria 6735
663 Ga0501070_0023395 3300049586 Bacteria 5176
664 Ga0501044_0060869 3300049823 Bacteria 3864
665 nmdc:mga05p37_139666_c1 3300050507 Bacteria 2969
666 nmdc:mga05p37_15509_c1 3300050507 Bacteria 9160
667 nmdc:mga05p37_408487_c1 3300050507 Bacteria 1583
668 nmdc:mga09592_187011_c1 3300050508 Bacteria 1792
669 nmdc:mga09592_84444_c1 3300050508 Bacteria 2707
670 nmdc:mga0qj67_36403_c1 3300050509 Bacteria 3849
671 nmdc:mga0qj67_53309_c1 3300050509 Bacteria 3202
672 nmdc:mga0qj67_6635_c1 3300050509 Bacteria 8501
673 nmdc:mga06r32_23881_c1 3300050510 Bacteria 5666
674 nmdc:mga06r32_273748_c1 3300050510 Bacteria 1676
675 nmdc:mga06r32_334667_c1 3300050510 Bacteria 1499
676 nmdc:mga06r32_34464_c1 3300050510 Bacteria 4773
677 nmdc:mga06r32_51510_c1 3300050510 Bacteria 3940
678 nmdc:mga08y16_132874_c1 3300050511 Bacteria 2587
679 nmdc:mga0n895_103646_c1 3300050512 Bacteria 2856
680 nmdc:mga0n895_113990_c1 3300050512 Bacteria 2721
681 nmdc:mga0n895_28140_c1 3300050512 Bacteria 5346
682 nmdc:mga0n895_9801_c1 3300050512 Bacteria 8414
683 nmdc:mga0rr50_161056_c1 3300050513 Bacteria 1821
684 nmdc:mga0a205_5380_c1 3300050515 Bacteria 11543
685 Ga0495601_0021665 3300053077 Bacteria 3937
686 Ga0495612_0005224 3300053078 Bacteria 5363
687 Ga0495612_0007563 3300053078 Bacteria 4440
688 Ga0495595_0018140 3300053084 Bacteria 3038
689 Ga0495595_0051462 3300053084 Bacteria 1909
690 Ga0495619_0018427 3300053085 Bacteria 4429
691 Ga0495619_0029596 3300053085 Bacteria 3539
692 Ga0500583_0086717 3300053092 Bacteria 1519
693 Ga0501082_0328785 3300060353 Bacteria 1332
694 Ga0207658_10084399
695 JGI25406J46586_10014537
696 Ga0065712_10074141
697 Ga0065707_10092182
698 Ga0070658_10004996
699 Ga0070658_10005423
700 Ga0070658_10013422
701 Ga0070658_10062655
702 Ga0070658_10078366
703 Ga0070676_10004324
704 Ga0070683_100000233
705 Ga0070683_100000514
706 Ga0070683_100000681
707 Ga0070683_100001177
708 Ga0070683_100010079
709 Ga0070683_100012618
710 Ga0070683_100022357
711 Ga0070683_100028687
712 Ga0070683_100064125
713 Ga0070683_100117617
714 Ga0070683_100182595
715 Ga0070683_100191167
716 Ga0070690_100035706
717 Ga0070670_100008651
718 Ga0070670_100069486
719 Ga0070670_100305306
720 Ga0070677_10071915
721 Ga0068869_100000336
722 Ga0068869_100003185
723 Ga0070680_100000247
724 Ga0070680_100016854
725 Ga0070680_100024606
726 Ga0070680_100051855
727 Ga0070680_100054451
728 Ga0070680_100056039
729 Ga0070680_100071403
730 Ga0070680_100085150
731 Ga0070680_100183123
732 Ga0070682_100001941
733 Ga0070682_100010198
734 Ga0070682_100026246
735 Ga0068868_100011520
736 Ga0068868_100120896
737 Ga0070660_100008200
738 Ga0070660_100247296
739 Ga0070689_100003792
740 Ga0070689_100088983
741 Ga0070687_100003132
742 Ga0070687_100008700
743 Ga0070661_100001897
744 Ga0070661_100002382
745 Ga0070661_100013296
746 Ga0070661_100058604
747 Ga0070661_100134119
748 Ga0070692_10024886
749 Ga0070692_10037072
750 Ga0070692_10060877
751 Ga0070668_100004050
752 Ga0070668_100024456
753 Ga0070668_100114748
754 Ga0070668_100120996
755 Ga0070669_100002374
756 Ga0070669_100042271
757 Ga0070669_100068474
758 Ga0070669_100077758
759 Ga0070675_100000547
760 Ga0070675_100024098
761 Ga0070675_100103224
762 Ga0070671_100049109
763 Ga0070671_100186859
764 Ga0070671_100189193
765 Ga0070673_100013820
766 Ga0070673_100015564
767 Ga0070688_100045029
768 Ga0070659_100002963
769 Ga0070659_100006784
770 Ga0070659_100013320
771 Ga0070659_100135873
772 Ga0070659_100179653
773 Ga0070667_100004361
774 Ga0070709_10005909
775 Ga0070714_100002427
776 Ga0070714_100031866
777 Ga0070714_100102561
778 Ga0070714_100104152
779 Ga0070713_100040821
780 Ga0070713_100101756
781 Ga0070713_100374645
782 Ga0070701_10004902
783 Ga0070711_100204715
784 Ga0070694_100031602
785 Ga0070694_100033076
786 Ga0070694_100052941
787 Ga0070708_100000198
788 Ga0070708_100001891
789 Ga0070663_100035048
790 Ga0070663_100050711
791 Ga0070662_100093576
792 Ga0070681_10002832
793 Ga0070681_10005293
794 Ga0070681_10009589
795 Ga0070681_10015723
796 Ga0070681_10015818
797 Ga0070681_10016105
798 Ga0070681_10020486
799 Ga0070681_10028341
800 Ga0070681_10084923
801 Ga0070681_10134037
802 Ga0068867_100006641
803 Ga0068867_100037140
804 Ga0068867_100199504
805 Ga0070685_10005071
806 Ga0070685_10094490
807 Ga0070706_100043371
808 Ga0070706_100052636
809 Ga0070707_100001652
810 Ga0070707_100041672
811 Ga0070698_100014818
812 Ga0070698_100103699
813 Ga0070698_100170602
814 Ga0070699_100027917
815 Ga0070699_100162663
816 Ga0070699_100180756
817 Ga0070699_100191883
818 Ga0070679_100000919
819 Ga0070679_100001084
820 Ga0070679_100005710
821 Ga0070679_100012109
822 Ga0070679_100013730
823 Ga0070679_100013800
824 Ga0070679_100017101
825 Ga0070679_100022028
826 Ga0070679_100022708
827 Ga0070679_100028983
828 Ga0070679_100085135
829 Ga0070679_100088685
830 Ga0070679_100089861
831 Ga0070679_100090193
832 Ga0070679_100109239
833 Ga0070679_100113964
834 Ga0070679_100119351
835 Ga0070684_100003476
836 Ga0070684_100032431
837 Ga0070684_100038600
838 Ga0070684_100040297
839 Ga0070684_100048167
840 Ga0070684_100074290
841 Ga0070684_100129403
842 Ga0070684_100135899
843 Ga0070684_100277451
844 Ga0068853_100017714
845 Ga0068853_100047354
846 Ga0068853_100119660
847 Ga0068853_100211796
848 Ga0070672_100007248
849 Ga0070672_100064455
850 Ga0070672_100102860
851 Ga0070672_100140621
852 Ga0070686_100039046
853 Ga0070686_100046711
854 Ga0070686_100115823
855 Ga0070695_100088088
856 Ga0070696_100000551
857 Ga0070696_100002054
858 Ga0070696_100125040
859 Ga0070693_100005997
860 Ga0070693_100014748
861 Ga0070665_100100436
862 Ga0070665_100170374
863 Ga0070665_100457749
864 Ga0070704_100036169
865 Ga0068855_100002169
866 Ga0068855_100071996
867 Ga0068855_100084662
868 Ga0068855_100120858
869 Ga0068855_100144311
870 Ga0068855_100229978
871 Ga0070664_100005037
872 Ga0070664_100005450
873 Ga0070664_100005697
874 Ga0070664_100013631
875 Ga0070664_100024347
876 Ga0070664_100030994
877 Ga0068857_100003188
878 Ga0068857_100003673
879 Ga0068854_100006806
880 Ga0068854_100036544
881 Ga0068856_100116131
882 Ga0068856_100196378
883 Ga0068852_100006303
884 Ga0068852_100026069
885 Ga0068852_100059569
886 Ga0068859_100001968
887 Ga0068864_100003498
888 Ga0068864_100079926
889 Ga0068864_100244999
890 Ga0068864_100298960
891 Ga0068861_100054984
892 Ga0068863_100035359
893 Ga0068863_100035623
894 Ga0068858_100023097
895 Ga0068860_100006907
896 Ga0068860_100014614
897 Ga0068862_100008006
898 Ga0068862_100035187
899 Ga0068862_100101661
900 Ga0081539_10000104
901 Ga0081539_10007610
902 Ga0070716_100115161
903 Ga0070712_100034406
904 Ga0070712_100119018
905 Ga0068871_100082816
906 Ga0075428_100011627
907 Ga0075428_100296614
908 Ga0075428_100356309
909 Ga0075430_100019456
910 Ga0075430_100048505
911 Ga0075430_100095148
912 Ga0075431_100028784
913 Ga0075431_100053253
914 Ga0075433_10173526
915 Ga0075434_100003813
916 Ga0075434_100008741
917 Ga0075434_100010289
918 Ga0075434_100052266
919 Ga0075429_100137126
920 Ga0068865_100007656
921 Ga0068865_100017573
922 Ga0075436_100092496
923 Ga0097620_100001968
924 Ga0075435_100151028
925 Ga0105240_10006020
926 Ga0105240_10008178
927 Ga0105240_10066790
928 Ga0105240_10070949
929 Ga0105240_10160833
930 Ga0105240_10206879
931 Ga0111539_10015785
932 Ga0105245_10004762
933 Ga0105245_10044478
934 Ga0114129_10084927
935 Ga0114129_10177879
936 Ga0114129_10179528
937 Ga0114129_10380175
938 Ga0114129_10531002
939 Ga0105243_10061354
940 Ga0105243_10067559
941 Ga0105241_10003558
942 Ga0105241_10092847
943 Ga0105242_10015933
944 Ga0105242_10164979
945 Ga0105242_10284869
946 Ga0105248_10015710
947 Ga0105248_10037355
948 Ga0105248_10047905
949 Ga0105248_10064042
950 Ga0105238_10014395
951 Ga0105238_10064165
952 Ga0105249_10000115
953 Ga0105249_10000401
954 Ga0105249_10008138
955 Ga0105246_10000533
956 Ga0105246_10227921
957 Ga0157373_10009388
958 Ga0157373_10022302
959 Ga0157373_10056829
960 Ga0157373_10090003
961 Ga0157371_10008714
962 Ga0157371_10011797
963 Ga0157371_10024297
964 Ga0157371_10029364
965 Ga0157371_10080965
966 Ga0157370_10003194
967 Ga0157370_10011107
968 Ga0157370_10016614
969 Ga0157370_10038072
970 Ga0157370_10066035
971 Ga0157370_10178918
972 Ga0157370_10220274
973 Ga0157370_10282877
974 Ga0157369_10014454
975 Ga0157369_10050957
976 Ga0157369_10109351
977 Ga0157369_10110337
978 Ga0157369_10117438
979 Ga0157369_10175421
980 Ga0157369_10195657
981 Ga0157369_10345829
982 Ga0157374_10007525
983 Ga0157374_10035307
984 Ga0157374_10196383
985 Ga0157378_10052302
986 Ga0157378_10095535
987 Ga0157378_10110317
988 Ga0163162_10006251
989 Ga0163162_10223977
990 Ga0163162_10263025
991 Ga0157372_10004359
992 Ga0157372_10007785
993 Ga0157372_10015537
994 Ga0157372_10041599
995 Ga0157372_10043906
996 Ga0157372_10046069
997 Ga0157372_10048726
998 Ga0157372_10053003
999 Ga0157372_10081638
1000 Ga0157372_10107399
1001 Ga0157372_10146616
1002 Ga0157372_10397866
1003 Ga0157375_10007703
1004 Ga0157375_10038310
1005 Ga0157375_10041030
1006 Ga0157375_10051494
1007 Ga0157375_10264842
1008 Ga0163163_10018416
1009 Ga0163163_10079023
1010 Ga0163163_10115851
1011 Ga0163163_10226981
1012 Ga0157380_10002943
1013 Ga0157380_10049850
1014 Ga0157380_10084621
1015 Ga0182008_10008049
1016 Ga0157377_10021353
1017 Ga0157377_10023237
1018 Ga0157379_10002779
1019 Ga0157379_10059347
1020 Ga0157376_10039825
1021 Ga0157376_10069366
1022 Ga0157376_10237368
1023 Ga0182007_10032244
1024 Ga0206356_11186412
1025 Ga0206353_11619150
1026 Ga0213876_10019759
1027 Ga0213876_10049095
1028 Ga0207682_10014448
1029 Ga0207688_10014918
1030 Ga0207699_10058902
1031 Ga0207645_10000246
1032 Ga0207645_10067686
1033 Ga0207643_10017232
1034 Ga0207643_10092803
1035 Ga0207705_10006743
1036 Ga0207705_10007107
1037 Ga0207705_10008483
1038 Ga0207684_10043263
1039 Ga0207654_10012141
1040 Ga0207707_10000876
1041 Ga0207707_10002146
1042 Ga0207707_10005339
1043 Ga0207707_10005860
1044 Ga0207707_10008528
1045 Ga0207707_10018258
1046 Ga0207707_10031769
1047 Ga0207707_10040615
1048 Ga0207707_10093736
1049 Ga0207695_10001441
1050 Ga0207695_10008377
1051 Ga0207695_10022335
1052 Ga0207695_10035123
1053 Ga0207695_10068826
1054 Ga0207695_10143291
1055 Ga0207695_10188514
1056 Ga0207693_10059507
1057 Ga0207693_10092300
1058 Ga0207663_10175365
1059 Ga0207660_10000668
1060 Ga0207660_10004932
1061 Ga0207660_10006151
1062 Ga0207660_10027528
1063 Ga0207662_10001341
1064 Ga0207662_10004709
1065 Ga0207662_10135555
1066 Ga0207657_10005262
1067 Ga0207657_10006241
1068 Ga0207657_10103320
1069 Ga0207657_10103964
1070 Ga0207657_10196338
1071 Ga0207657_10210111
1072 Ga0207649_10001792
1073 Ga0207649_10064071
1074 Ga0207649_10064899
1075 Ga0207652_10000470
1076 Ga0207652_10001653
1077 Ga0207652_10004024
1078 Ga0207652_10016760
1079 Ga0207652_10025277
1080 Ga0207652_10072098
1081 Ga0207652_10073456
1082 Ga0207652_10083420
1083 Ga0207652_10101958
1084 Ga0207652_10106841
1085 Ga0207652_10172424
1086 Ga0207652_10263080
1087 Ga0207646_10004872
1088 Ga0207646_10032931
1089 Ga0207681_10026439
1090 Ga0207681_10040852
1091 Ga0207681_10042307
1092 Ga0207650_10005580
1093 Ga0207659_10013350
1094 Ga0207659_10015531
1095 Ga0207659_10059792
1096 Ga0207659_10133037
1097 Ga0207687_10114776
1098 Ga0207687_10176234
1099 Ga0207700_10186370
1100 Ga0207664_10032293
1101 Ga0207644_10038355
1102 Ga0207644_10128653
1103 Ga0207644_10144944
1104 Ga0207644_10197267
1105 Ga0207690_10003494
1106 Ga0207690_10050602
1107 Ga0207690_10160812
1108 Ga0207690_10182760
1109 Ga0207690_10212685
1110 Ga0207706_10000357
1111 Ga0207706_10003260
1112 Ga0207706_10004509
1113 Ga0207686_10013975
1114 Ga0207686_10081629
1115 Ga0207670_10222669
1116 Ga0207704_10009122
1117 Ga0207665_10005757
1118 Ga0207691_10001314
1119 Ga0207691_10001355
1120 Ga0207691_10002440
1121 Ga0207691_10045697
1122 Ga0207691_10052495
1123 Ga0207691_10105255
1124 Ga0207711_10039169
1125 Ga0207711_10257910
1126 Ga0207689_10000838
1127 Ga0207689_10001360
1128 Ga0207661_10002707
1129 Ga0207661_10008394
1130 Ga0207661_10044374
1131 Ga0207661_10044663
1132 Ga0207661_10047245
1133 Ga0207661_10047915
1134 Ga0207661_10077981
1135 Ga0207661_10105046
1136 Ga0207679_10000484
1137 Ga0207679_10001293
1138 Ga0207679_10018504
1139 Ga0207679_10019244
1140 Ga0207679_10107419
1141 Ga0207679_10113393
1142 Ga0207679_10159398
1143 Ga0207679_10208856
1144 Ga0207667_10053390
1145 Ga0207667_10060596
1146 Ga0207667_10064918
1147 Ga0207667_10086080
1148 Ga0207667_10163089
1149 Ga0207651_10008005
1150 Ga0207651_10075620
1151 Ga0207712_10000261
1152 Ga0207712_10023446
1153 Ga0207712_10081407
1154 Ga0207712_10127846
1155 Ga0207668_10025923
1156 Ga0207668_10028200
1157 Ga0207668_10124931
1158 Ga0207640_10001447
1159 Ga0207677_10085945
1160 Ga0207677_10098909
1161 Ga0207703_10005549
1162 Ga0207703_10018395
1163 Ga0207639_10056244
1164 Ga0207678_10043360
1165 Ga0207678_10064852
1166 Ga0207678_10352355
1167 Ga0207708_10009137
1168 Ga0207708_10147316
1169 Ga0207702_10021489
1170 Ga0207702_10177157
1171 Ga0207641_10027060
1172 Ga0207648_10020613
1173 Ga0207648_10103217
1174 Ga0207676_10019403
1175 Ga0207676_10033765
1176 Ga0207674_10001189
1177 Ga0207674_10002932
1178 Ga0207674_10003135
1179 Ga0207674_10005220
1180 Ga0207674_10012363
1181 Ga0207675_100000320
1182 Ga0207675_100013219
1183 Ga0207683_10136578
1184 Ga0207698_10034085
1185 Ga0207698_10061309
1186 Ga0207698_10103138
1187 Ga0207698_10117738
1188 Ga0207698_10137784
1189 Ga0268266_10264078
1190 Ga0268265_10002328
1191 Ga0268265_10002878
1192 Ga0268265_10058847
1193 Ga0268264_10062003
1194 Ga0307408_100007391
1195 Ga0307408_100013358
1196 Ga0307408_100066818
1197 Ga0307408_100210703
1198 Ga0265314_10096746
1199 Ga0265342_10112420
1200 Ga0307405_10010875
1201 Ga0307405_10243964
1202 Ga0307405_10249552
1203 Ga0307413_10131026
1204 Ga0307413_10175874
1205 Ga0307410_10017368
1206 Ga0307410_10058134
1207 Ga0307406_10075302
1208 Ga0307407_10024310
1209 Ga0307412_10036611
1210 Ga0307412_10043150
1211 Ga0307409_100031385
1212 Ga0307409_100061229
1213 Ga0307416_100079125
1214 Ga0307414_10041776
1215 Ga0307411_10019320
1216 Ga0307415_100051969
1217 Ga0307415_100152746
1218 Ga0307415_100203427
1219 Ga0307415_100318637
1220 Ga0373926_0011735
1221 Ga0373934_0000634
1222 Ga0373923_0025011
1223 Ga0373953_0003513
1224 Ga0373956_0001499
1225 Ga0373956_0020714
1226 Ga0373957_0003604
1227 Ga0373957_0019864
1228 Ga0373943_0014118
1229 Ga0373946_0009378
1230 Ga0373955_0002318
1231 Ga0373955_0005518
1232 Ga0373955_0025532
1233 Ga0373924_0003270
1234 Ga0373931_0004289
1235 Ga0373935_0009344
1236 Ga0373935_0035384
1237 Ga0373927_0009006
1238 Ga0373933_0003442
1239 Ga0373933_0008374
1240 Ga0373947_0023043
1241 Ga0373947_0182364
1242 Ga0373937_0002914
1243 Ga0373937_0018683
1244 Ga0373937_0068884
1245 Ga0373925_0023547
1246 Ga0395899_0003367
1247 Ga0395900_0127813
1248 Ga0395901_0003407
1249 Ga0436365_1250967
1250 Ga0436365_1912646
1251 Ga0466966_0044033
1252 Ga0466966_0060997
1253 Ga0466961_0128320
1254 Ga0466963_0165873
1255 Ga0466957_0022468
1256 Ga0451576_0047797
1257 Ga0466967_0174892
1258 Ga0466967_0177166
1259 Ga0466967_0281833
1260 Ga0495603_0020339
1261 Ga0495629_0013239
1262 Ga0495629_0020203
1263 Ga0495651_0001301
1264 Ga0495651_0030637
1265 Ga0495653_0003982
1266 Ga0495653_0094023
1267 Ga0495580_0092084
1268 Ga0495580_0252263
1269 Ga0495582_0039385
1270 Ga0495582_0126876
1271 Ga0495582_0166455
1272 Ga0495639_0011476
1273 Ga0495662_0052635
1274 Ga0495664_0013948
1275 Ga0495664_0102424
1276 Ga0495594_0004366
1277 Ga0495594_0008638
1278 Ga0495596_0023851
1279 Ga0495608_0005135
1280 Ga0495608_0030278
1281 Ga0495618_0166788
1282 Ga0495628_0000494
1283 Ga0495628_0099889
1284 Ga0495630_0017982
1285 Ga0495630_0052906
1286 Ga0495666_0043592
1287 Ga0495652_0007351
1288 Ga0495652_0097544
1289 Ga0495665_0001279
1290 Ga0495665_0002007
1291 Ga0495640_0056056
1292 Ga0495587_0000269
1293 Ga0495587_0000334
1294 Ga0495645_0000918
1295 Ga0495645_0001039
1296 Ga0495645_0006424
1297 Ga0495645_0035434
1298 Ga0495667_0003294
1299 Ga0495667_0049763
1300 Ga0495635_0000200
1301 Ga0495588_0008801
1302 Ga0495657_0001237
1303 Ga0495657_0063234
1304 Ga0495599_0000385
1305 Ga0495599_0001207
1306 Ga0495599_0011790
1307 Ga0495599_0013493
1308 Ga0495623_0000156
1309 Ga0495623_0005693
1310 Ga0495623_0011192
1311 Ga0495646_0006285
1312 Ga0495646_0078710
1313 Ga0495658_0012670
1314 Ga0495658_0028872
1315 Ga0495658_0124750
1316 Ga0495613_0089498
1317 Ga0495613_0114617
1318 Ga0495670_0035726
1319 Ga0495600_0001690
1320 Ga0495581_0005093
1321 Ga0495581_0047156
1322 Ga0495581_0107567
1323 Ga0495604_0004394
1324 Ga0495604_0006752
1325 Ga0495604_0046306
1326 Ga0495672_0031676
1327 Ga0495680_0166784
1328 Ga0495675_0003343
1329 Ga0495675_0029223
1330 Ga0495684_0002113
1331 Ga0495684_0003435
1332 Ga0495684_0056038
1333 Ga0495593_0083928
1334 Ga0495602_0005326
1335 Ga0495602_0023888
1336 Ga0495614_0013032
1337 Ga0496107_0034919
1338 Ga0496108_0065054
1339 Ga0496108_0142631
1340 Ga0496109_0237827
1341 Ga0496109_0291223
1342 Ga0496110_0215459
1343 Ga0496112_0000196
1344 Ga0496112_0097749
1345 Ga0496112_0122529
1346 Ga0496113_0157478
1347 Ga0496115_0062295
1348 Ga0501033_0014545
1349 Ga0501033_0069617
1350 Ga0501034_0025845
1351 Ga0501034_0045863
1352 Ga0501034_0159382
1353 Ga0501038_0138789
1354 Ga0501046_0182635
1355 Ga0501047_0018189
1356 Ga0501070_0023395
1357 Ga0501044_0060869
1358 nmdc:mga05p37_139666_c1
1359 nmdc:mga05p37_15509_c1
1360 nmdc:mga05p37_408487_c1
1361 nmdc:mga09592_187011_c1
1362 nmdc:mga09592_84444_c1
1363 nmdc:mga0qj67_36403_c1
1364 nmdc:mga0qj67_53309_c1
1365 nmdc:mga0qj67_6635_c1
1366 nmdc:mga06r32_23881_c1
1367 nmdc:mga06r32_273748_c1
1368 nmdc:mga06r32_334667_c1
1369 nmdc:mga06r32_34464_c1
1370 nmdc:mga06r32_51510_c1
1371 nmdc:mga08y16_132874_c1
1372 nmdc:mga0n895_103646_c1
1373 nmdc:mga0n895_113990_c1
1374 nmdc:mga0n895_28140_c1
1375 nmdc:mga0n895_9801_c1
1376 nmdc:mga0rr50_161056_c1
1377 nmdc:mga0a205_5380_c1
1378 Ga0495601_0021665
1379 Ga0495612_0005224
1380 Ga0495612_0007563
1381 Ga0495595_0018140
1382 Ga0495595_0051462
1383 Ga0495619_0018427
1384 Ga0495619_0029596
1385 Ga0500583_0086717
1386 Ga0501082_0328785

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00226

DnaJ

DnaJ domain

3

65

0.99

PF01556

DnaJ_C

DnaJ C terminal domain

120

325

0.97

PF00684

DnaJ_CXXCXGXG

DnaJ central domain

147

205

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ctw-assembly1.cif.gz_A solution structure of j-domain from mouse dnaj subfamily c menber 5 0.9338 4 72
5nro-assembly1.cif.gz_B structure of full-length dnak with bound j-domain 0.9289 3 63
6rzy-assembly2.cif.gz_B plasmodium falciparum pfa0660w hsp40 co-chaperone j-domain 0.9152 3 65
7jtk-assembly1.cif.gz_y radial spoke 1 isolated from chlamydomonas reinhardtii 0.9124 3 67
8glv-assembly1.cif.gz_KA 96-nm repeat unit of doublet microtubules from chlamydomonas reinhardtii flagella 0.9033 3 67
ID Description Score Start End Superfamily
af_Q8CHS2_271_339_1.10.287.110 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;DnaJ domain 0.9603 4 58 1.10.287.110
4wb7A01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;DnaJ domain 0.9562 3 57 1.10.287.110
af_Q8N4W6_269_337_1.10.287.110 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;DnaJ domain 0.9522 4 58 1.10.287.110
af_P46997_4_92_1.10.287.110 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;DnaJ domain 0.9373 4 66 1.10.287.110
af_Q6P3W2_1_86_1.10.287.110 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;DnaJ domain 0.9366 3 66 1.10.287.110
ID Description Score Start End GO Terms
AF-A0A3M0WMB6-F1-model_v4 Molecular chaperone DnaJ 0.9438 238 344 GO:0005737
GO:0042026
GO:0051082
GO:0051085
AF-A0A4Y9J712-F1-model_v4 deleted 0.9374 206 329
AF-R6S5G5-F1-model_v4 deleted 0.9314 206 341
AF-A0A7C7L678-F1-model_v4 J domain-containing protein 0.9215 218 341 GO:0005737
GO:0042026
GO:0051082
GO:0051085
AF-A0A6V8NMM0-F1-model_v4 Molecular chaperone DnaJ 0.9185 230 318 GO:0005737
GO:0042026
GO:0051082
GO:0051085

Map