F475629

General Info

Members Datasets Scaffolds Average Seq Length
693 310 1386 96

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100015900|Ga0070714_1000159006
Length 103
Sequence MTAFALTNHGAWGVALIIIRTVQDIDRSAGELLDVAGKVAANTANIPQLQATAPVLAQIVDEAVIQDGYMNALTDGYGGVPASRTTHDADLQARPDAERRRSA

Samples

Sample ID Description Type Environment
1 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
60 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
61 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
62 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
63 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
87 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
104 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
109 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
110 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
111 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
167 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
171 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
172 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
173 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
174 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
175 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
176 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
177 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
178 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
179 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
180 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
181 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
182 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
183 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
184 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
185 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
186 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
187 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
188 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
189 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
190 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
191 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
192 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
193 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
194 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
195 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
196 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
197 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
198 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
199 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
200 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
201 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
202 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
203 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
204 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
205 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
206 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
207 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
208 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
209 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
210 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
211 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
212 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
213 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
214 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
215 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
216 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
217 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
218 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
219 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
220 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
221 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
222 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
223 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
224 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
225 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
226 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
227 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
228 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
229 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
230 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
231 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
232 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
233 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
234 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
235 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
236 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
237 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
238 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
239 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
240 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
241 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
242 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
243 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
244 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
245 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
246 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
247 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
248 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
249 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
250 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
251 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
252 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
253 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
254 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
255 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
256 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
257 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
258 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
259 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
260 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
261 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
262 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
263 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
264 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
265 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
266 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
267 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
268 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
269 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
270 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
271 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
272 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
273 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
274 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
275 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
276 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
277 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
278 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
279 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
280 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
284 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
285 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
286 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
287 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
288 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
289 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
290 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
291 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
292 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
293 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
294 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
295 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
296 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
297 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
298 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
299 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
300 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
301 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
302 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
303 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
304 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
305 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
306 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
307 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
308 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
309 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
310 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.83
Metatranscriptomes 3.17
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 12.7
Rhizosphere 82.68
Stem 0
Stem Tuber 0
Unclassified 10.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070714_100015900 3300005435 Bacteria 6065
2 JGI25407J50210_10002975 3300003373 Bacteria 4045
3 JGI25407J50210_10162175 3300003373 Bacteria 551
4 Ga0058863_11539949 3300004799 Bacteria 655
5 Ga0058863_11640622 3300004799 Unclassified 807
6 Ga0058863_11850974 3300004799 Unclassified 984
7 Ga0070658_11057494 3300005327 Unclassified 706
8 Ga0070676_10959524 3300005328 Bacteria 640
9 Ga0070683_100038580 3300005329 Bacteria 4380
10 Ga0070683_100044580 3300005329 Bacteria 4090
11 Ga0070683_100182632 3300005329 Unclassified 1991
12 Ga0070683_100609680 3300005329 Bacteria 1045
13 Ga0070690_100157897 3300005330 Bacteria 1552
14 Ga0070690_100517928 3300005330 Bacteria 895
15 Ga0070670_100053618 3300005331 Bacteria 3463
16 Ga0068869_100009771 3300005334 Bacteria 6231
17 Ga0068869_100428959 3300005334 Bacteria 1092
18 Ga0068869_101676726 3300005334 Bacteria 567
19 Ga0070680_100000223 3300005336 Bacteria 37567
20 Ga0070680_100010600 3300005336 Bacteria 7112
21 Ga0070680_100122784 3300005336 Bacteria 2169
22 Ga0070680_100139820 3300005336 Bacteria 2030
23 Ga0070682_100066179 3300005337 Bacteria 2298
24 Ga0070682_100066274 3300005337 Bacteria 2297
25 Ga0070682_100143535 3300005337 Unclassified 1630
26 Ga0068868_100075890 3300005338 Bacteria 2687
27 Ga0068868_100542638 3300005338 Bacteria 1024
28 Ga0070660_100027580 3300005339 Bacteria 4239
29 Ga0070660_100140999 3300005339 Bacteria 1934
30 Ga0070689_100420530 3300005340 Bacteria 1133
31 Ga0070687_100159570 3300005343 Bacteria 1332
32 Ga0070687_100160778 3300005343 Unclassified 1327
33 Ga0070687_100261671 3300005343 Bacteria 1080
34 Ga0070661_100036145 3300005344 Bacteria 3591
35 Ga0070661_101080996 3300005344 Unclassified 668
36 Ga0070668_101289671 3300005347 Bacteria 664
37 Ga0070668_101944261 3300005347 Unclassified 542
38 Ga0070669_100712643 3300005353 Bacteria 848
39 Ga0070675_101792968 3300005354 Bacteria 566
40 Ga0070674_100226010 3300005356 Bacteria 1458
41 Ga0070673_102314076 3300005364 Bacteria 511
42 Ga0070659_100035661 3300005366 Bacteria 3874
43 Ga0070659_100391723 3300005366 Bacteria 1171
44 Ga0070659_100660325 3300005366 Bacteria 902
45 Ga0070709_10404451 3300005434 Bacteria 1020
46 Ga0070709_11140071 3300005434 Bacteria 625
47 Ga0070714_100398812 3300005435 Bacteria 1300
48 Ga0070714_100537606 3300005435 Bacteria 1118
49 Ga0070714_100844817 3300005435 Bacteria 888
50 Ga0070714_102156219 3300005435 Bacteria 543
51 Ga0070713_100863540 3300005436 Bacteria 869
52 Ga0070713_101431835 3300005436 Bacteria 670
53 Ga0070710_10009988 3300005437 Bacteria 4653
54 Ga0070710_10046557 3300005437 Bacteria 2416
55 Ga0070710_10220042 3300005437 Bacteria 1208
56 Ga0070710_10381851 3300005437 Bacteria 940
57 Ga0070701_10328870 3300005438 Bacteria 948
58 Ga0070711_100141126 3300005439 Bacteria 1807
59 Ga0070711_100203243 3300005439 Unclassified 1530
60 Ga0070711_100220252 3300005439 Bacteria 1475
61 Ga0070711_100633840 3300005439 Bacteria 895
62 Ga0070711_100915254 3300005439 Bacteria 749
63 Ga0070711_101158394 3300005439 Bacteria 668
64 Ga0070705_100016895 3300005440 Bacteria 3800
65 Ga0070705_100362669 3300005440 Bacteria 1060
66 Ga0070705_101862733 3300005440 Unclassified 511
67 Ga0070700_100137944 3300005441 Bacteria 1654
68 Ga0070700_100754588 3300005441 Unclassified 779
69 Ga0070700_101407781 3300005441 Unclassified 590
70 Ga0070694_100804121 3300005444 Bacteria 771
71 Ga0070694_101576300 3300005444 Bacteria 557
72 Ga0070663_101036388 3300005455 Bacteria 715
73 Ga0070678_100002361 3300005456 Bacteria 10307
74 Ga0070678_100317352 3300005456 Bacteria 1330
75 Ga0070678_100414526 3300005456 Bacteria 1173
76 Ga0070662_100399347 3300005457 Bacteria 1134
77 Ga0070662_100403957 3300005457 Unclassified 1128
78 Ga0070662_101121154 3300005457 Unclassified 675
79 Ga0070681_10013010 3300005458 Bacteria 8264
80 Ga0070681_10076706 3300005458 Bacteria 3300
81 Ga0070681_11262184 3300005458 Bacteria 661
82 Ga0070685_11491985 3300005466 Bacteria 521
83 Ga0070706_102145951 3300005467 Bacteria 505
84 Ga0070679_100033572 3300005530 Bacteria 5081
85 Ga0070679_100058812 3300005530 Bacteria 3830
86 Ga0070679_100199280 3300005530 Bacteria 1969
87 Ga0070679_100452335 3300005530 Bacteria 1229
88 Ga0070679_101000591 3300005530 Unclassified 780
89 Ga0070684_100033449 3300005535 Bacteria 4389
90 Ga0070684_100126103 3300005535 Bacteria 2306
91 Ga0070684_100194936 3300005535 Unclassified 1844
92 Ga0068853_101569572 3300005539 Bacteria 638
93 Ga0068853_101722290 3300005539 Bacteria 608
94 Ga0070686_100014491 3300005544 Bacteria 4547
95 Ga0070686_101073249 3300005544 Bacteria 664
96 Ga0070696_100283859 3300005546 Unclassified 1263
97 Ga0070693_100031073 3300005547 Bacteria 2925
98 Ga0070693_100807308 3300005547 Unclassified 696
99 Ga0070693_101105398 3300005547 Bacteria 605
100 Ga0070665_100089128 3300005548 Bacteria 3091
101 Ga0070665_100114220 3300005548 Bacteria 2703
102 Ga0068855_100064949 3300005563 Bacteria 4255
103 Ga0068855_101434061 3300005563 Bacteria 711
104 Ga0070664_100162974 3300005564 Bacteria 1974
105 Ga0070664_101193136 3300005564 Unclassified 718
106 Ga0070664_102283730 3300005564 Bacteria 513
107 Ga0068857_100065700 3300005577 Bacteria 3226
108 Ga0068854_100840844 3300005578 Bacteria 803
109 Ga0068856_100012040 3300005614 Bacteria 8380
110 Ga0068856_100014120 3300005614 Bacteria 7723
111 Ga0068856_100056348 3300005614 Bacteria 3878
112 Ga0068856_100085290 3300005614 Bacteria 3137
113 Ga0068856_100315083 3300005614 Bacteria 1582
114 Ga0070702_100003380 3300005615 Bacteria 7127
115 Ga0070702_100092153 3300005615 Bacteria 1840
116 Ga0068852_100836497 3300005616 Bacteria 936
117 Ga0068852_101121607 3300005616 Bacteria 807
118 Ga0068852_101623698 3300005616 Bacteria 669
119 Ga0068859_100057132 3300005617 Bacteria 3931
120 Ga0068859_100410574 3300005617 Bacteria 1450
121 Ga0068859_102230444 3300005617 Bacteria 604
122 Ga0068866_10200248 3300005718 Unclassified 1193
123 Ga0068866_10357607 3300005718 Bacteria 930
124 Ga0068861_100499965 3300005719 Bacteria 1099
125 Ga0068861_100615063 3300005719 Bacteria 999
126 Ga0068870_10263733 3300005840 Bacteria 1073
127 Ga0068863_100491210 3300005841 Bacteria 1208
128 Ga0068863_101353581 3300005841 Bacteria 719
129 Ga0068858_100136788 3300005842 Bacteria 2299
130 Ga0068858_100203985 3300005842 Bacteria 1870
131 Ga0068858_100215419 3300005842 Bacteria 1818
132 Ga0068858_100904641 3300005842 Bacteria 863
133 Ga0068860_100049347 3300005843 Bacteria 4009
134 Ga0068860_100313399 3300005843 Bacteria 1539
135 Ga0068860_100778412 3300005843 Unclassified 970
136 Ga0068862_102109357 3300005844 Bacteria 575
137 Ga0081538_10000309 3300005981 Bacteria 56250
138 Ga0081538_10000542 3300005981 Bacteria 41646
139 Ga0081538_10060187 3300005981 Bacteria 2187
140 Ga0081540_1006182 3300005983 Bacteria 8779
141 Ga0070717_10211259 3300006028 Bacteria 1703
142 Ga0070717_10610365 3300006028 Bacteria 990
143 Ga0070717_10621851 3300006028 Bacteria 980
144 Ga0070717_10903700 3300006028 Bacteria 804
145 Ga0075432_10038611 3300006058 Bacteria 1663
146 Ga0070715_10385679 3300006163 Bacteria 775
147 Ga0070715_10458544 3300006163 Bacteria 721
148 Ga0070716_100474704 3300006173 Bacteria 917
149 Ga0070716_101577372 3300006173 Unclassified 539
150 Ga0070712_100051616 3300006175 Bacteria 2865
151 Ga0070712_100085336 3300006175 Bacteria 2298
152 Ga0070712_100169789 3300006175 Bacteria 1691
153 Ga0070712_100206707 3300006175 Bacteria 1546
154 Ga0070712_100459136 3300006175 Bacteria 1062
155 Ga0097621_100015218 3300006237 Bacteria 5781
156 Ga0097621_101356509 3300006237 Bacteria 673
157 Ga0075433_10148510 3300006852 Unclassified 2085
158 Ga0075433_10214062 3300006852 Bacteria 1712
159 Ga0075433_10655073 3300006852 Bacteria 921
160 Ga0075433_11236078 3300006852 Bacteria 648
161 Ga0075434_100001286 3300006871 Bacteria 20926
162 Ga0075434_100013897 3300006871 Bacteria 7680
163 Ga0075434_100410844 3300006871 Unclassified 1375
164 Ga0075434_100454352 3300006871 Bacteria 1302
165 Ga0068865_100191600 3300006881 Bacteria 1582
166 Ga0075436_100012961 3300006914 Bacteria 5716
167 Ga0097620_100057135 3300006931 Bacteria 3931
168 Ga0097620_100410532 3300006931 Bacteria 1450
169 Ga0097620_102229873 3300006931 Bacteria 604
170 Ga0075435_100024626 3300007076 Bacteria 4674
171 Ga0075435_100154502 3300007076 Unclassified 1930
172 Ga0075435_100539599 3300007076 Bacteria 1010
173 Ga0105240_10036069 3300009093 Bacteria 6366
174 Ga0105240_11199196 3300009093 Bacteria 804
175 Ga0105240_11967890 3300009093 Unclassified 608
176 Ga0105240_11996916 3300009093 Bacteria 603
177 Ga0105240_12582979 3300009093 Bacteria 525
178 Ga0105240_12592697 3300009093 Bacteria 524
179 Ga0111539_10058853 3300009094 Bacteria 4558
180 Ga0111539_13005211 3300009094 Bacteria 545
181 Ga0105245_10002929 3300009098 Bacteria 15319
182 Ga0105245_10116655 3300009098 Bacteria 2489
183 Ga0105245_10139246 3300009098 Bacteria 2284
184 Ga0105245_10887784 3300009098 Bacteria 933
185 Ga0105245_10888026 3300009098 Bacteria 933
186 Ga0105245_10980089 3300009098 Bacteria 889
187 Ga0105245_12512814 3300009098 Bacteria 568
188 Ga0105247_10036327 3300009101 Bacteria 3003
189 Ga0105247_11393405 3300009101 Bacteria 567
190 Ga0105243_10009051 3300009148 Bacteria 7606
191 Ga0105243_10041140 3300009148 Bacteria 3614
192 Ga0105243_10852060 3300009148 Unclassified 903
193 Ga0105243_11838102 3300009148 Bacteria 637
194 Ga0105241_10033002 3300009174 Bacteria 3884
195 Ga0105241_10519744 3300009174 Bacteria 1064
196 Ga0105241_12364950 3300009174 Bacteria 530
197 Ga0105242_10008882 3300009176 Bacteria 7711
198 Ga0105242_10208630 3300009176 Bacteria 1739
199 Ga0105242_10655938 3300009176 Bacteria 1021
200 Ga0105242_10957495 3300009176 Bacteria 860
201 Ga0105248_10071900 3300009177 Bacteria 3887
202 Ga0105248_10242133 3300009177 Bacteria 2030
203 Ga0105248_10411199 3300009177 Bacteria 1523
204 Ga0105237_10033925 3300009545 Bacteria 5170
205 Ga0105237_10042819 3300009545 Bacteria 4563
206 Ga0105237_10211838 3300009545 Unclassified 1938
207 Ga0105237_11466904 3300009545 Bacteria 689
208 Ga0105237_11919109 3300009545 Bacteria 600
209 Ga0105238_10023351 3300009551 Bacteria 6304
210 Ga0105238_10087358 3300009551 Bacteria 3105
211 Ga0105238_10122696 3300009551 Bacteria 2577
212 Ga0105238_10222451 3300009551 Bacteria 1864
213 Ga0105238_11600288 3300009551 Bacteria 681
214 Ga0105249_10061844 3300009553 Bacteria 3436
215 Ga0105249_11588852 3300009553 Bacteria 726
216 Ga0105239_10016303 3300010375 Bacteria 8215
217 Ga0105239_10571263 3300010375 Unclassified 1289
218 Ga0105239_10623444 3300010375 Bacteria 1231
219 Ga0105246_10001080 3300011119 Bacteria 15765
220 Ga0105246_10457812 3300011119 Bacteria 1074
221 Ga0105246_11515622 3300011119 Unclassified 630
222 Ga0157373_11260226 3300013100 Bacteria 559
223 Ga0157371_10153650 3300013102 Bacteria 1642
224 Ga0157370_10023581 3300013104 Bacteria 6107
225 Ga0157369_10003184 3300013105 Bacteria 19579
226 Ga0157369_10040419 3300013105 Bacteria 5091
227 Ga0157369_10151842 3300013105 Bacteria 2448
228 Ga0157369_10540839 3300013105 Bacteria 1204
229 Ga0157374_10083994 3300013296 Bacteria 3026
230 Ga0157374_10451878 3300013296 Bacteria 1286
231 Ga0157374_10500642 3300013296 Bacteria 1219
232 Ga0157378_10003749 3300013297 Bacteria 13469
233 Ga0157378_10148268 3300013297 Bacteria 2184
234 Ga0157378_11191219 3300013297 Unclassified 801
235 Ga0163162_10941812 3300013306 Bacteria 975
236 Ga0163162_11929629 3300013306 Bacteria 676
237 Ga0157372_10025976 3300013307 Bacteria 6370
238 Ga0157372_10197389 3300013307 Bacteria 2331
239 Ga0157372_13477995 3300013307 Bacteria 500
240 Ga0157375_10683032 3300013308 Bacteria 1181
241 Ga0163163_10548526 3300014325 Bacteria 1218
242 Ga0157380_10315592 3300014326 Unclassified 1447
243 Ga0157380_10424420 3300014326 Bacteria 1269
244 Ga0157380_10542239 3300014326 Bacteria 1139
245 Ga0157377_10069246 3300014745 Bacteria 2036
246 Ga0157377_10289284 3300014745 Bacteria 1077
247 Ga0157377_10316806 3300014745 Unclassified 1035
248 Ga0157379_10050453 3300014968 Bacteria 3714
249 Ga0157379_10067341 3300014968 Bacteria 3201
250 Ga0157376_10012529 3300014969 Bacteria 6296
251 Ga0157376_10078014 3300014969 Bacteria 2835
252 Ga0157376_10250557 3300014969 Bacteria 1654
253 Ga0157376_10493941 3300014969 Bacteria 1201
254 Ga0163161_10392859 3300017792 Bacteria 1111
255 Ga0163161_11182631 3300017792 Unclassified 660
256 Ga0197907_10075268 3300020069 Bacteria 773
257 Ga0197907_10311904 3300020069 Bacteria 2096
258 Ga0206356_10556192 3300020070 Unclassified 764
259 Ga0206356_11898381 3300020070 Bacteria 2843
260 Ga0206355_1191147 3300020076 Unclassified 1003
261 Ga0206351_10367484 3300020077 Unclassified 928
262 Ga0206350_11345497 3300020080 Unclassified 916
263 Ga0206354_10260801 3300020081 Unclassified 1319
264 Ga0206354_11642648 3300020081 Bacteria 633
265 Ga0206353_10496518 3300020082 Bacteria 4779
266 Ga0206353_10589919 3300020082 Unclassified 795
267 Ga0213874_10050629 3300021377 Bacteria 1273
268 Ga0213876_10004962 3300021384 Bacteria 7356
269 Ga0213876_10029747 3300021384 Bacteria 2878
270 Ga0213876_10767487 3300021384 Bacteria 513
271 Ga0213875_10009470 3300021388 Bacteria 4934
272 Ga0213875_10271580 3300021388 Bacteria 800
273 Ga0213875_10400424 3300021388 Unclassified 654
274 Ga0224712_10028632 3300022467 Bacteria 1993
275 Ga0224712_10092560 3300022467 Bacteria 1269
276 Ga0224712_10205572 3300022467 Bacteria 896
277 Ga0224712_10408121 3300022467 Unclassified 648
278 Ga0207692_10110317 3300025898 Bacteria 1525
279 Ga0207692_10139074 3300025898 Bacteria 1380
280 Ga0207692_10174957 3300025898 Bacteria 1246
281 Ga0207692_10801824 3300025898 Bacteria 616
282 Ga0207692_11160328 3300025898 Bacteria 512
283 Ga0207642_10080805 3300025899 Unclassified 1578
284 Ga0207642_10159804 3300025899 Bacteria 1208
285 Ga0207710_10027820 3300025900 Bacteria 2452
286 Ga0207688_10097181 3300025901 Bacteria 1697
287 Ga0207680_10276069 3300025903 Bacteria 1167
288 Ga0207685_10212838 3300025905 Bacteria 915
289 Ga0207685_10836660 3300025905 Bacteria 509
290 Ga0207699_10048384 3300025906 Bacteria 2498
291 Ga0207699_10176778 3300025906 Bacteria 1432
292 Ga0207699_10236841 3300025906 Bacteria 1252
293 Ga0207705_10352357 3300025909 Unclassified 1134
294 Ga0207684_10790358 3300025910 Bacteria 803
295 Ga0207654_10296046 3300025911 Bacteria 1099
296 Ga0207654_11286159 3300025911 Bacteria 533
297 Ga0207654_11380861 3300025911 Bacteria 514
298 Ga0207707_10008414 3300025912 Bacteria 8950
299 Ga0207707_10011787 3300025912 Bacteria 7605
300 Ga0207707_10139933 3300025912 Bacteria 2116
301 Ga0207695_10116818 3300025913 Bacteria 2641
302 Ga0207695_10878451 3300025913 Bacteria 776
303 Ga0207671_10020275 3300025914 Bacteria 5064
304 Ga0207671_10100433 3300025914 Bacteria 2191
305 Ga0207671_10595583 3300025914 Bacteria 881
306 Ga0207693_10008739 3300025915 Bacteria 8281
307 Ga0207693_10138391 3300025915 Bacteria 1914
308 Ga0207693_10173342 3300025915 Bacteria 1698
309 Ga0207693_10248285 3300025915 Bacteria 1397
310 Ga0207693_10384983 3300025915 Bacteria 1097
311 Ga0207693_11453400 3300025915 Bacteria 507
312 Ga0207663_10069873 3300025916 Bacteria 2261
313 Ga0207663_10155962 3300025916 Bacteria 1606
314 Ga0207663_10208021 3300025916 Bacteria 1416
315 Ga0207663_10218250 3300025916 Unclassified 1386
316 Ga0207663_10590242 3300025916 Bacteria 872
317 Ga0207663_10716967 3300025916 Bacteria 793
318 Ga0207660_10012614 3300025917 Bacteria 5534
319 Ga0207660_10047355 3300025917 Bacteria 3039
320 Ga0207660_10130344 3300025917 Bacteria 1913
321 Ga0207660_10163986 3300025917 Bacteria 1717
322 Ga0207662_10106742 3300025918 Bacteria 1742
323 Ga0207662_10159629 3300025918 Bacteria 1439
324 Ga0207657_10017316 3300025919 Bacteria 6914
325 Ga0207657_10323578 3300025919 Bacteria 1219
326 Ga0207657_10722597 3300025919 Bacteria 773
327 Ga0207649_10154385 3300025920 Unclassified 1584
328 Ga0207649_10422731 3300025920 Unclassified 1001
329 Ga0207652_10015676 3300025921 Bacteria 6171
330 Ga0207652_10019961 3300025921 Bacteria 5518
331 Ga0207652_10059933 3300025921 Bacteria 3282
332 Ga0207652_10840745 3300025921 Bacteria 813
333 Ga0207652_11773218 3300025921 Bacteria 522
334 Ga0207681_10586581 3300025923 Bacteria 920
335 Ga0207694_10020903 3300025924 Bacteria 4955
336 Ga0207694_10050233 3300025924 Bacteria 3229
337 Ga0207694_10148295 3300025924 Unclassified 1889
338 Ga0207694_11236900 3300025924 Unclassified 632
339 Ga0207650_10203637 3300025925 Bacteria 1586
340 Ga0207687_10008371 3300025927 Bacteria 6767
341 Ga0207687_10012650 3300025927 Bacteria 5513
342 Ga0207687_10056136 3300025927 Bacteria 2761
343 Ga0207687_10390841 3300025927 Bacteria 1142
344 Ga0207687_10455181 3300025927 Bacteria 1062
345 Ga0207700_10264465 3300025928 Bacteria 1474
346 Ga0207700_10659955 3300025928 Bacteria 933
347 Ga0207700_11201335 3300025928 Bacteria 677
348 Ga0207664_10083533 3300025929 Bacteria 2603
349 Ga0207664_10333280 3300025929 Bacteria 1341
350 Ga0207664_10459979 3300025929 Bacteria 1136
351 Ga0207664_10942692 3300025929 Bacteria 774
352 Ga0207664_11587304 3300025929 Bacteria 576
353 Ga0207690_10013023 3300025932 Bacteria 4989
354 Ga0207690_10214688 3300025932 Bacteria 1469
355 Ga0207690_10243651 3300025932 Unclassified 1386
356 Ga0207706_10511116 3300025933 Bacteria 1036
357 Ga0207706_10751093 3300025933 Bacteria 831
358 Ga0207686_10300183 3300025934 Unclassified 1192
359 Ga0207686_10915741 3300025934 Unclassified 708
360 Ga0207686_10965916 3300025934 Bacteria 690
361 Ga0207709_10029946 3300025935 Bacteria 3162
362 Ga0207709_10097273 3300025935 Unclassified 1938
363 Ga0207709_11835621 3300025935 Bacteria 504
364 Ga0207669_10033967 3300025937 Bacteria 2885
365 Ga0207704_10056080 3300025938 Bacteria 2412
366 Ga0207665_10434291 3300025939 Bacteria 1005
367 Ga0207665_10652896 3300025939 Bacteria 825
368 Ga0207711_10102999 3300025941 Bacteria 2527
369 Ga0207711_10161992 3300025941 Bacteria 2026
370 Ga0207689_10016765 3300025942 Bacteria 6200
371 Ga0207661_10004271 3300025944 Bacteria 10002
372 Ga0207661_10028230 3300025944 Bacteria 4295
373 Ga0207661_10031433 3300025944 Bacteria 4101
374 Ga0207679_11036966 3300025945 Bacteria 752
375 Ga0207679_11087493 3300025945 Bacteria 734
376 Ga0207679_11179312 3300025945 Unclassified 703
377 Ga0207667_10010261 3300025949 Bacteria 10963
378 Ga0207667_11402538 3300025949 Bacteria 672
379 Ga0207651_11934073 3300025960 Unclassified 530
380 Ga0207712_10274820 3300025961 Bacteria 1372
381 Ga0207712_11054184 3300025961 Bacteria 723
382 Ga0207712_11074429 3300025961 Bacteria 716
383 Ga0207640_10153282 3300025981 Bacteria 1696
384 Ga0207658_10106728 3300025986 Bacteria 2206
385 Ga0207658_11010377 3300025986 Bacteria 759
386 Ga0207677_10037743 3300026023 Bacteria 3160
387 Ga0207677_10172025 3300026023 Bacteria 1695
388 Ga0207703_10116793 3300026035 Bacteria 2285
389 Ga0207703_10670031 3300026035 Bacteria 985
390 Ga0207703_10868033 3300026035 Bacteria 863
391 Ga0207639_11961153 3300026041 Bacteria 546
392 Ga0207678_10902381 3300026067 Bacteria 781
393 Ga0207678_11083053 3300026067 Bacteria 709
394 Ga0207678_11897169 3300026067 Unclassified 520
395 Ga0207708_10057632 3300026075 Bacteria 2964
396 Ga0207708_10303654 3300026075 Bacteria 1299
397 Ga0207708_10850500 3300026075 Unclassified 788
398 Ga0207708_10944304 3300026075 Unclassified 748
399 Ga0207702_10021410 3300026078 Bacteria 5353
400 Ga0207702_10056896 3300026078 Bacteria 3321
401 Ga0207702_10156818 3300026078 Bacteria 2076
402 Ga0207702_10369607 3300026078 Bacteria 1376
403 Ga0207641_10612448 3300026088 Bacteria 1067
404 Ga0207641_10679596 3300026088 Bacteria 1013
405 Ga0207648_10186124 3300026089 Bacteria 1839
406 Ga0207676_11264356 3300026095 Bacteria 732
407 Ga0207674_10041407 3300026116 Bacteria 4765
408 Ga0207683_10000098 3300026121 Bacteria 71739
409 Ga0207683_10414541 3300026121 Bacteria 1240
410 Ga0207698_10005895 3300026142 Bacteria 7611
411 Ga0207698_10019057 3300026142 Bacteria 4688
412 Ga0207698_10418834 3300026142 Bacteria 1285
413 Ga0207698_11502706 3300026142 Bacteria 689
414 Ga0207428_10106637 3300027907 Bacteria 2160
415 Ga0268266_10131043 3300028379 Bacteria 2243
416 Ga0268265_11688276 3300028380 Bacteria 639
417 Ga0268264_10055429 3300028381 Bacteria 3312
418 Ga0268264_10086504 3300028381 Bacteria 2693
419 Ga0268264_11222725 3300028381 Bacteria 761
420 Ga0265319_1036303 3300028563 Bacteria 1686
421 Ga0265336_10047430 3300028666 Bacteria 1304
422 Ga0265336_10064711 3300028666 Bacteria 1095
423 Ga0265314_10343982 3300031711 Bacteria 823
424 Ga0307406_10072118 3300031901 Bacteria 2266
425 Ga0307409_100068610 3300031995 Bacteria 2805
426 Ga0307411_11868179 3300032005 Bacteria 559
427 Ga0307415_100916731 3300032126 Bacteria 809
428 Ga0373958_0072893 3300034819 Unclassified 765
429 Ga0373959_0146637 3300034820 Bacteria 594
430 Ga0373926_0019611 3300035083 Bacteria 2332
431 Ga0373929_0228323 3300035085 Bacteria 532
432 Ga0373934_0407310 3300035086 Bacteria 569
433 Ga0373944_0056464 3300035089 Bacteria 1249
434 Ga0373952_0041082 3300035092 Bacteria 1069
435 Ga0373923_0599554 3300035111 Bacteria 542
436 Ga0373936_0175537 3300035113 Bacteria 938
437 Ga0373945_0110451 3300035116 Bacteria 1084
438 Ga0373945_0161463 3300035116 Bacteria 913
439 Ga0373956_0100249 3300035119 Bacteria 1343
440 Ga0373960_0050976 3300035121 Bacteria 1228
441 Ga0373960_0333754 3300035121 Bacteria 571
442 Ga0373943_0004341 3300035170 Bacteria 6433
443 Ga0373946_0017007 3300035171 Bacteria 2777
444 Ga0373955_0071396 3300035172 Bacteria 1942
445 Ga0373961_0097159 3300035241 Unclassified 949
446 Ga0373962_0037239 3300035242 Bacteria 1358
447 Ga0316574_0121798 3300035398 Bacteria 1675
448 Ga0373924_0006148 3300035410 Bacteria 4289
449 Ga0373931_0114718 3300035691 Bacteria 1533
450 Ga0373935_0012322 3300035692 Bacteria 5144
451 Ga0373935_1093360 3300035692 Bacteria 593
452 Ga0373927_0017377 3300035695 Bacteria 4734
453 Ga0373933_0135284 3300035724 Bacteria 1552
454 Ga0373947_0011283 3300035725 Bacteria 5128
455 Ga0373937_0104501 3300036401 Bacteria 2631
456 Ga0373925_0002887 3300037068 Bacteria 13580
457 Ga0373925_0036990 3300037068 Bacteria 3602
458 Ga0395898_1140317 3300037466 Unclassified 712
459 Ga0436364_0212197 3300037853 Bacteria 714
460 Ga0436364_0557675 3300037853 Bacteria 20536
461 Ga0436364_0848903 3300037853 Bacteria 4496
462 Ga0436364_1031907 3300037853 Bacteria 102112
463 Ga0436364_1083263 3300037853 Bacteria 1922
464 Ga0436364_1084053 3300037853 Bacteria 746
465 Ga0436364_1103654 3300037853 Unclassified 2124
466 Ga0436364_1424347 3300037853 Bacteria 879
467 Ga0436364_1461162 3300037853 Unclassified 2760
468 Ga0395901_1396911 3300038443 Bacteria 659
469 Ga0436365_0586044 3300039437 Bacteria 9308
470 Ga0436365_0669823 3300039437 Bacteria 1170
471 Ga0436365_0723978 3300039437 Bacteria 4645
472 Ga0436365_0904996 3300039437 Bacteria 14294
473 Ga0436365_0958254 3300039437 Bacteria 2634
474 Ga0436365_1131272 3300039437 Bacteria 3946
475 Ga0436365_1208184 3300039437 Bacteria 19667
476 Ga0436365_1672751 3300039437 Bacteria 548
477 Ga0436360_0564178 3300039438 Unclassified 818
478 Ga0436360_1013825 3300039438 Bacteria 1625
479 Ga0436363_0222022 3300039450 Bacteria 697
480 Ga0436363_0451087 3300039450 Bacteria 7459
481 Ga0436363_0584665 3300039450 Bacteria 3982
482 Ga0436363_1042291 3300039450 Bacteria 1325
483 Ga0436363_1160814 3300039450 Bacteria 1995
484 Ga0436363_1249550 3300039450 Unclassified 1611
485 Ga0436363_1404914 3300039450 Bacteria 5868
486 Ga0451845_0591229 3300041501 Bacteria 634
487 Ga0466966_0298127 3300044684 Bacteria 969
488 Ga0466963_0042606 3300044694 Bacteria 2981
489 Ga0466963_0455332 3300044694 Unclassified 903
490 Ga0466964_0408333 3300044706 Bacteria 711
491 Ga0466968_0659876 3300044735 Bacteria 532
492 Ga0466960_0053894 3300044901 Bacteria 1951
493 Ga0466960_0146647 3300044901 Bacteria 1257
494 Ga0466960_0696870 3300044901 Bacteria 609
495 Ga0466960_1049900 3300044901 Bacteria 502
496 Ga0466959_0298127 3300045049 Bacteria 1104
497 Ga0466959_0432422 3300045049 Bacteria 893
498 Ga0466959_0481063 3300045049 Bacteria 840
499 Ga0466959_0697488 3300045049 Bacteria 680
500 Ga0466958_0886740 3300045836 Bacteria 582
501 Ga0466967_0007882 3300045976 Bacteria 7741
502 Ga0466967_0257901 3300045976 Bacteria 1667
503 Ga0466967_1344158 3300045976 Bacteria 712
504 Ga0466967_1463404 3300045976 Bacteria 680
505 Ga0466967_1673761 3300045976 Bacteria 634
506 Ga0466967_1697315 3300045976 Bacteria 629
507 Ga0495592_0081501 3300046454 Bacteria 2339
508 Ga0495603_0027667 3300046455 Bacteria 3421
509 Ga0495629_0010815 3300046459 Bacteria 6638
510 Ga0495641_0002945 3300046461 Bacteria 13114
511 Ga0495651_0012517 3300046462 Bacteria 6544
512 Ga0495653_0003629 3300046463 Bacteria 12445
513 Ga0495580_0013042 3300046472 Bacteria 6362
514 Ga0495582_0005354 3300046473 Bacteria 7163
515 Ga0495582_0095276 3300046473 Bacteria 1662
516 Ga0495639_0005141 3300046475 Bacteria 5620
517 Ga0495662_0000412 3300046476 Bacteria 19214
518 Ga0495664_0269024 3300046477 Bacteria 1030
519 Ga0495594_0038982 3300046499 Bacteria 2596
520 Ga0495594_0053159 3300046499 Bacteria 2231
521 Ga0495608_0002056 3300046511 Bacteria 14477
522 Ga0495618_0002753 3300046514 Bacteria 11179
523 Ga0495628_0211394 3300046516 Bacteria 1459
524 Ga0495630_0048581 3300046517 Bacteria 3175
525 Ga0495630_0348485 3300046517 Bacteria 1133
526 Ga0495666_0008214 3300046526 Bacteria 5232
527 Ga0495652_0036180 3300046529 Bacteria 4294
528 Ga0495665_0000527 3300046531 Bacteria 19367
529 Ga0495640_0024525 3300046533 Bacteria 4386
530 Ga0495640_0100592 3300046533 Bacteria 1898
531 Ga0495640_0256169 3300046533 Bacteria 1094
532 Ga0495586_0137834 3300046535 Bacteria 1368
533 Ga0495587_0212039 3300046536 Bacteria 1093
534 Ga0495645_0116200 3300046543 Bacteria 1889
535 Ga0495622_0046916 3300046557 Bacteria 2008
536 Ga0495667_0001822 3300046559 Bacteria 14145
537 Ga0495634_0014802 3300046642 Bacteria 5611
538 Ga0495635_0004994 3300046663 Bacteria 9232
539 Ga0495588_0002905 3300046674 Bacteria 7391
540 Ga0495657_0005225 3300046675 Bacteria 10278
541 Ga0495657_0671182 3300046675 Bacteria 597
542 Ga0495623_0039850 3300046679 Bacteria 3001
543 Ga0495646_0120366 3300046680 Bacteria 1486
544 Ga0495647_0006973 3300046681 Bacteria 3765
545 Ga0495647_0012604 3300046681 Bacteria 2914
546 Ga0495658_0003617 3300046683 Bacteria 7652
547 Ga0495613_0004498 3300046689 Bacteria 10445
548 Ga0495613_0473939 3300046689 Unclassified 846
549 Ga0495624_0019615 3300046690 Bacteria 4509
550 Ga0495600_0013003 3300046809 Bacteria 5219
551 Ga0495581_0005975 3300047315 Bacteria 7051
552 Ga0495604_0032767 3300047317 Bacteria 4116
553 Ga0495674_0017807 3300047319 Bacteria 6615
554 Ga0495674_0023349 3300047319 Bacteria 5701
555 Ga0495676_0029722 3300047321 Bacteria 4650
556 Ga0495676_0032063 3300047321 Bacteria 4440
557 Ga0495680_0115841 3300047322 Bacteria 1982
558 Ga0495675_0046142 3300047444 Bacteria 2774
559 Ga0495684_0001792 3300047471 Bacteria 17242
560 Ga0495593_0002686 3300047673 Bacteria 10697
561 Ga0495614_0001922 3300048089 Bacteria 9108
562 Ga0496100_0047955 3300048903 Bacteria 2755
563 Ga0496100_0121982 3300048903 Bacteria 1824
564 Ga0496100_0127573 3300048903 Bacteria 1787
565 Ga0496100_0154012 3300048903 Bacteria 1642
566 Ga0496100_0802971 3300048903 Bacteria 737
567 Ga0496101_0016606 3300048904 Bacteria 4978
568 Ga0496101_0018572 3300048904 Bacteria 4730
569 Ga0496101_0036749 3300048904 Bacteria 3469
570 Ga0496101_0054050 3300048904 Bacteria 2899
571 Ga0496101_0152174 3300048904 Bacteria 1770
572 Ga0496101_0247425 3300048904 Bacteria 1388
573 Ga0496101_0490530 3300048904 Bacteria 970
574 Ga0496102_0002361 3300048905 Bacteria 16111
575 Ga0496102_0002511 3300048905 Bacteria 15657
576 Ga0496102_0015761 3300048905 Bacteria 6586
577 Ga0496102_0048477 3300048905 Bacteria 3862
578 Ga0496102_0115980 3300048905 Bacteria 2499
579 Ga0496102_0184049 3300048905 Bacteria 1968
580 Ga0496103_0000900 3300048906 Bacteria 21361
581 Ga0496103_0027995 3300048906 Bacteria 3419
582 Ga0496103_0029004 3300048906 Bacteria 3361
583 Ga0496103_0557462 3300048906 Bacteria 731
584 Ga0496103_0595286 3300048906 Bacteria 705
585 Ga0496104_0004360 3300048907 Bacteria 12308
586 Ga0496104_0026210 3300048907 Bacteria 5379
587 Ga0496104_0031074 3300048907 Bacteria 4965
588 Ga0496104_0056979 3300048907 Bacteria 3698
589 Ga0496104_0419513 3300048907 Unclassified 1250
590 Ga0496104_0807707 3300048907 Bacteria 844
591 Ga0496104_1367280 3300048907 Bacteria 611
592 Ga0496105_0000346 3300048908 Bacteria 30492
593 Ga0496105_0015778 3300048908 Bacteria 6027
594 Ga0496105_0046435 3300048908 Bacteria 3585
595 Ga0496105_0059721 3300048908 Bacteria 3146
596 Ga0496105_0069163 3300048908 Bacteria 2918
597 Ga0496106_0004359 3300048909 Bacteria 10512
598 Ga0496106_0008276 3300048909 Bacteria 7695
599 Ga0496106_0018071 3300048909 Bacteria 5212
600 Ga0496106_0059407 3300048909 Bacteria 2896
601 Ga0496106_0070203 3300048909 Bacteria 2675
602 Ga0496106_0089690 3300048909 Bacteria 2371
603 Ga0496106_1186609 3300048909 Bacteria 596
604 Ga0496107_0007275 3300048910 Bacteria 7627
605 Ga0496107_0032110 3300048910 Bacteria 3751
606 Ga0496107_0058567 3300048910 Bacteria 2786
607 Ga0496107_0091185 3300048910 Bacteria 2227
608 Ga0496107_0170159 3300048910 Bacteria 1616
609 Ga0496107_0208674 3300048910 Bacteria 1452
610 Ga0496108_0001177 3300048911 Bacteria 20397
611 Ga0496108_0007539 3300048911 Bacteria 8819
612 Ga0496108_0015397 3300048911 Bacteria 6239
613 Ga0496108_0022950 3300048911 Bacteria 5135
614 Ga0496108_1132288 3300048911 Unclassified 664
615 Ga0496109_0000999 3300048912 Bacteria 23362
616 Ga0496109_0005691 3300048912 Bacteria 10433
617 Ga0496109_0006528 3300048912 Bacteria 9820
618 Ga0496109_0033040 3300048912 Bacteria 4654
619 Ga0496109_0035884 3300048912 Bacteria 4476
620 Ga0496109_0078528 3300048912 Bacteria 3040
621 Ga0496110_0001024 3300048913 Bacteria 19667
622 Ga0496110_0099793 3300048913 Bacteria 2602
623 Ga0496110_0128773 3300048913 Bacteria 2285
624 Ga0496110_0378988 3300048913 Bacteria 1289
625 Ga0496111_0000822 3300048914 Bacteria 16685
626 Ga0496111_0037932 3300048914 Bacteria 3450
627 Ga0496112_0025280 3300048915 Bacteria 5701
628 Ga0496112_0033720 3300048915 Bacteria 4978
629 Ga0496112_0262385 3300048915 Bacteria 1677
630 Ga0496112_0527591 3300048915 Bacteria 1115
631 Ga0496112_0764558 3300048915 Bacteria 892
632 Ga0496113_0010520 3300048916 Bacteria 6118
633 Ga0496113_0146885 3300048916 Bacteria 1858
634 Ga0496113_0891821 3300048916 Bacteria 704
635 Ga0496114_0005124 3300048917 Bacteria 10216
636 Ga0496114_0010039 3300048917 Bacteria 7528
637 Ga0496114_0014291 3300048917 Bacteria 6369
638 Ga0496114_0027105 3300048917 Bacteria 4693
639 Ga0496114_0226401 3300048917 Bacteria 1642
640 Ga0496114_0261231 3300048917 Bacteria 1524
641 Ga0496115_0007165 3300048918 Bacteria 8189
642 Ga0496115_0011617 3300048918 Bacteria 6607
643 Ga0496115_0042887 3300048918 Bacteria 3606
644 Ga0496115_0067927 3300048918 Bacteria 2884
645 Ga0496115_0074549 3300048918 Bacteria 2755
646 Ga0496115_0182353 3300048918 Bacteria 1735
647 Ga0496115_0538550 3300048918 Bacteria 934
648 Ga0496115_1402478 3300048918 Bacteria 516
649 Ga0496115_1402929 3300048918 Bacteria 516
650 Ga0501036_0146297 3300049572 Bacteria 1993
651 Ga0501040_0020653 3300049576 Bacteria 4391
652 Ga0501041_0293504 3300049577 Bacteria 1024
653 Ga0501042_0050300 3300049578 Bacteria 2973
654 Ga0501067_0012918 3300049583 Bacteria 4622
655 Ga0501068_0367837 3300049584 Bacteria 925
656 Ga0501069_0116471 3300049585 Unclassified 1524
657 Ga0501069_0212900 3300049585 Bacteria 1122
658 Ga0501072_0136271 3300049588 Bacteria 1957
659 Ga0501074_0240056 3300049590 Bacteria 1289
660 Ga0501075_0256248 3300049591 Bacteria 1333
661 Ga0501076_0080266 3300049592 Bacteria 2618
662 Ga0501079_0040248 3300049741 Bacteria 3605
663 Ga0501080_1081992 3300049742 Bacteria 693
664 Ga0501081_0210133 3300049743 Bacteria 1413
665 Ga0501045_0014049 3300049824 Bacteria 5667
666 nmdc:mga08y16_110800_c1 3300050511 Bacteria 2858
667 nmdc:mga0n895_117257_c1 3300050512 Bacteria 2682
668 nmdc:mga0n895_64166_c1 3300050512 Bacteria 3633
669 nmdc:mga0rr50_233745_c1 3300050513 Bacteria 1522
670 nmdc:mga0rr50_964813_c1 3300050513 Bacteria 727
671 nmdc:mga08x19_168728_c1 3300050514 Unclassified 1490
672 nmdc:mga0a205_431604_c1 3300050515 Bacteria 1179
673 nmdc:mga0a205_498518_c1 3300050515 Bacteria 1075
674 nmdc:mga0a205_670444_c1 3300050515 Bacteria 888
675 nmdc:mga0a205_921296_c1 3300050515 Bacteria 721
676 Ga0495601_0028092 3300053077 Bacteria 3482
677 Ga0495601_0051417 3300053077 Bacteria 2600
678 Ga0495601_0257087 3300053077 Bacteria 1140
679 Ga0495612_0013474 3300053078 Bacteria 3294
680 Ga0495612_0232040 3300053078 Bacteria 818
681 Ga0495655_0321998 3300053083 Bacteria 536
682 Ga0495595_0006299 3300053084 Bacteria 4832
683 Ga0495619_0031706 3300053085 Bacteria 3425
684 Ga0495619_0256722 3300053085 Bacteria 1211
685 Ga0495619_0494244 3300053085 Bacteria 842
686 Ga0501084_0024662 3300054114 Bacteria 5019
687 Ga0587073_0132631 3300059492 Bacteria 686
688 Ga0587073_0296549 3300059492 Bacteria 525
689 Ga0587101_083778 3300059623 Bacteria 609
690 Ga0587067_131402 3300059640 Bacteria 611
691 Ga0501082_0595469 3300060353 Bacteria 967
692 Ga0466962_0169960 3300061719 Bacteria 1061
693 Ga0530510_0014564 3300061734 Bacteria 5548
694 Ga0070714_100015900
695 JGI25407J50210_10002975
696 JGI25407J50210_10162175
697 Ga0058863_11539949
698 Ga0058863_11640622
699 Ga0058863_11850974
700 Ga0070658_11057494
701 Ga0070676_10959524
702 Ga0070683_100038580
703 Ga0070683_100044580
704 Ga0070683_100182632
705 Ga0070683_100609680
706 Ga0070690_100157897
707 Ga0070690_100517928
708 Ga0070670_100053618
709 Ga0068869_100009771
710 Ga0068869_100428959
711 Ga0068869_101676726
712 Ga0070680_100000223
713 Ga0070680_100010600
714 Ga0070680_100122784
715 Ga0070680_100139820
716 Ga0070682_100066179
717 Ga0070682_100066274
718 Ga0070682_100143535
719 Ga0068868_100075890
720 Ga0068868_100542638
721 Ga0070660_100027580
722 Ga0070660_100140999
723 Ga0070689_100420530
724 Ga0070687_100159570
725 Ga0070687_100160778
726 Ga0070687_100261671
727 Ga0070661_100036145
728 Ga0070661_101080996
729 Ga0070668_101289671
730 Ga0070668_101944261
731 Ga0070669_100712643
732 Ga0070675_101792968
733 Ga0070674_100226010
734 Ga0070673_102314076
735 Ga0070659_100035661
736 Ga0070659_100391723
737 Ga0070659_100660325
738 Ga0070709_10404451
739 Ga0070709_11140071
740 Ga0070714_100398812
741 Ga0070714_100537606
742 Ga0070714_100844817
743 Ga0070714_102156219
744 Ga0070713_100863540
745 Ga0070713_101431835
746 Ga0070710_10009988
747 Ga0070710_10046557
748 Ga0070710_10220042
749 Ga0070710_10381851
750 Ga0070701_10328870
751 Ga0070711_100141126
752 Ga0070711_100203243
753 Ga0070711_100220252
754 Ga0070711_100633840
755 Ga0070711_100915254
756 Ga0070711_101158394
757 Ga0070705_100016895
758 Ga0070705_100362669
759 Ga0070705_101862733
760 Ga0070700_100137944
761 Ga0070700_100754588
762 Ga0070700_101407781
763 Ga0070694_100804121
764 Ga0070694_101576300
765 Ga0070663_101036388
766 Ga0070678_100002361
767 Ga0070678_100317352
768 Ga0070678_100414526
769 Ga0070662_100399347
770 Ga0070662_100403957
771 Ga0070662_101121154
772 Ga0070681_10013010
773 Ga0070681_10076706
774 Ga0070681_11262184
775 Ga0070685_11491985
776 Ga0070706_102145951
777 Ga0070679_100033572
778 Ga0070679_100058812
779 Ga0070679_100199280
780 Ga0070679_100452335
781 Ga0070679_101000591
782 Ga0070684_100033449
783 Ga0070684_100126103
784 Ga0070684_100194936
785 Ga0068853_101569572
786 Ga0068853_101722290
787 Ga0070686_100014491
788 Ga0070686_101073249
789 Ga0070696_100283859
790 Ga0070693_100031073
791 Ga0070693_100807308
792 Ga0070693_101105398
793 Ga0070665_100089128
794 Ga0070665_100114220
795 Ga0068855_100064949
796 Ga0068855_101434061
797 Ga0070664_100162974
798 Ga0070664_101193136
799 Ga0070664_102283730
800 Ga0068857_100065700
801 Ga0068854_100840844
802 Ga0068856_100012040
803 Ga0068856_100014120
804 Ga0068856_100056348
805 Ga0068856_100085290
806 Ga0068856_100315083
807 Ga0070702_100003380
808 Ga0070702_100092153
809 Ga0068852_100836497
810 Ga0068852_101121607
811 Ga0068852_101623698
812 Ga0068859_100057132
813 Ga0068859_100410574
814 Ga0068859_102230444
815 Ga0068866_10200248
816 Ga0068866_10357607
817 Ga0068861_100499965
818 Ga0068861_100615063
819 Ga0068870_10263733
820 Ga0068863_100491210
821 Ga0068863_101353581
822 Ga0068858_100136788
823 Ga0068858_100203985
824 Ga0068858_100215419
825 Ga0068858_100904641
826 Ga0068860_100049347
827 Ga0068860_100313399
828 Ga0068860_100778412
829 Ga0068862_102109357
830 Ga0081538_10000309
831 Ga0081538_10000542
832 Ga0081538_10060187
833 Ga0081540_1006182
834 Ga0070717_10211259
835 Ga0070717_10610365
836 Ga0070717_10621851
837 Ga0070717_10903700
838 Ga0075432_10038611
839 Ga0070715_10385679
840 Ga0070715_10458544
841 Ga0070716_100474704
842 Ga0070716_101577372
843 Ga0070712_100051616
844 Ga0070712_100085336
845 Ga0070712_100169789
846 Ga0070712_100206707
847 Ga0070712_100459136
848 Ga0097621_100015218
849 Ga0097621_101356509
850 Ga0075433_10148510
851 Ga0075433_10214062
852 Ga0075433_10655073
853 Ga0075433_11236078
854 Ga0075434_100001286
855 Ga0075434_100013897
856 Ga0075434_100410844
857 Ga0075434_100454352
858 Ga0068865_100191600
859 Ga0075436_100012961
860 Ga0097620_100057135
861 Ga0097620_100410532
862 Ga0097620_102229873
863 Ga0075435_100024626
864 Ga0075435_100154502
865 Ga0075435_100539599
866 Ga0105240_10036069
867 Ga0105240_11199196
868 Ga0105240_11967890
869 Ga0105240_11996916
870 Ga0105240_12582979
871 Ga0105240_12592697
872 Ga0111539_10058853
873 Ga0111539_13005211
874 Ga0105245_10002929
875 Ga0105245_10116655
876 Ga0105245_10139246
877 Ga0105245_10887784
878 Ga0105245_10888026
879 Ga0105245_10980089
880 Ga0105245_12512814
881 Ga0105247_10036327
882 Ga0105247_11393405
883 Ga0105243_10009051
884 Ga0105243_10041140
885 Ga0105243_10852060
886 Ga0105243_11838102
887 Ga0105241_10033002
888 Ga0105241_10519744
889 Ga0105241_12364950
890 Ga0105242_10008882
891 Ga0105242_10208630
892 Ga0105242_10655938
893 Ga0105242_10957495
894 Ga0105248_10071900
895 Ga0105248_10242133
896 Ga0105248_10411199
897 Ga0105237_10033925
898 Ga0105237_10042819
899 Ga0105237_10211838
900 Ga0105237_11466904
901 Ga0105237_11919109
902 Ga0105238_10023351
903 Ga0105238_10087358
904 Ga0105238_10122696
905 Ga0105238_10222451
906 Ga0105238_11600288
907 Ga0105249_10061844
908 Ga0105249_11588852
909 Ga0105239_10016303
910 Ga0105239_10571263
911 Ga0105239_10623444
912 Ga0105246_10001080
913 Ga0105246_10457812
914 Ga0105246_11515622
915 Ga0157373_11260226
916 Ga0157371_10153650
917 Ga0157370_10023581
918 Ga0157369_10003184
919 Ga0157369_10040419
920 Ga0157369_10151842
921 Ga0157369_10540839
922 Ga0157374_10083994
923 Ga0157374_10451878
924 Ga0157374_10500642
925 Ga0157378_10003749
926 Ga0157378_10148268
927 Ga0157378_11191219
928 Ga0163162_10941812
929 Ga0163162_11929629
930 Ga0157372_10025976
931 Ga0157372_10197389
932 Ga0157372_13477995
933 Ga0157375_10683032
934 Ga0163163_10548526
935 Ga0157380_10315592
936 Ga0157380_10424420
937 Ga0157380_10542239
938 Ga0157377_10069246
939 Ga0157377_10289284
940 Ga0157377_10316806
941 Ga0157379_10050453
942 Ga0157379_10067341
943 Ga0157376_10012529
944 Ga0157376_10078014
945 Ga0157376_10250557
946 Ga0157376_10493941
947 Ga0163161_10392859
948 Ga0163161_11182631
949 Ga0197907_10075268
950 Ga0197907_10311904
951 Ga0206356_10556192
952 Ga0206356_11898381
953 Ga0206355_1191147
954 Ga0206351_10367484
955 Ga0206350_11345497
956 Ga0206354_10260801
957 Ga0206354_11642648
958 Ga0206353_10496518
959 Ga0206353_10589919
960 Ga0213874_10050629
961 Ga0213876_10004962
962 Ga0213876_10029747
963 Ga0213876_10767487
964 Ga0213875_10009470
965 Ga0213875_10271580
966 Ga0213875_10400424
967 Ga0224712_10028632
968 Ga0224712_10092560
969 Ga0224712_10205572
970 Ga0224712_10408121
971 Ga0207692_10110317
972 Ga0207692_10139074
973 Ga0207692_10174957
974 Ga0207692_10801824
975 Ga0207692_11160328
976 Ga0207642_10080805
977 Ga0207642_10159804
978 Ga0207710_10027820
979 Ga0207688_10097181
980 Ga0207680_10276069
981 Ga0207685_10212838
982 Ga0207685_10836660
983 Ga0207699_10048384
984 Ga0207699_10176778
985 Ga0207699_10236841
986 Ga0207705_10352357
987 Ga0207684_10790358
988 Ga0207654_10296046
989 Ga0207654_11286159
990 Ga0207654_11380861
991 Ga0207707_10008414
992 Ga0207707_10011787
993 Ga0207707_10139933
994 Ga0207695_10116818
995 Ga0207695_10878451
996 Ga0207671_10020275
997 Ga0207671_10100433
998 Ga0207671_10595583
999 Ga0207693_10008739
1000 Ga0207693_10138391
1001 Ga0207693_10173342
1002 Ga0207693_10248285
1003 Ga0207693_10384983
1004 Ga0207693_11453400
1005 Ga0207663_10069873
1006 Ga0207663_10155962
1007 Ga0207663_10208021
1008 Ga0207663_10218250
1009 Ga0207663_10590242
1010 Ga0207663_10716967
1011 Ga0207660_10012614
1012 Ga0207660_10047355
1013 Ga0207660_10130344
1014 Ga0207660_10163986
1015 Ga0207662_10106742
1016 Ga0207662_10159629
1017 Ga0207657_10017316
1018 Ga0207657_10323578
1019 Ga0207657_10722597
1020 Ga0207649_10154385
1021 Ga0207649_10422731
1022 Ga0207652_10015676
1023 Ga0207652_10019961
1024 Ga0207652_10059933
1025 Ga0207652_10840745
1026 Ga0207652_11773218
1027 Ga0207681_10586581
1028 Ga0207694_10020903
1029 Ga0207694_10050233
1030 Ga0207694_10148295
1031 Ga0207694_11236900
1032 Ga0207650_10203637
1033 Ga0207687_10008371
1034 Ga0207687_10012650
1035 Ga0207687_10056136
1036 Ga0207687_10390841
1037 Ga0207687_10455181
1038 Ga0207700_10264465
1039 Ga0207700_10659955
1040 Ga0207700_11201335
1041 Ga0207664_10083533
1042 Ga0207664_10333280
1043 Ga0207664_10459979
1044 Ga0207664_10942692
1045 Ga0207664_11587304
1046 Ga0207690_10013023
1047 Ga0207690_10214688
1048 Ga0207690_10243651
1049 Ga0207706_10511116
1050 Ga0207706_10751093
1051 Ga0207686_10300183
1052 Ga0207686_10915741
1053 Ga0207686_10965916
1054 Ga0207709_10029946
1055 Ga0207709_10097273
1056 Ga0207709_11835621
1057 Ga0207669_10033967
1058 Ga0207704_10056080
1059 Ga0207665_10434291
1060 Ga0207665_10652896
1061 Ga0207711_10102999
1062 Ga0207711_10161992
1063 Ga0207689_10016765
1064 Ga0207661_10004271
1065 Ga0207661_10028230
1066 Ga0207661_10031433
1067 Ga0207679_11036966
1068 Ga0207679_11087493
1069 Ga0207679_11179312
1070 Ga0207667_10010261
1071 Ga0207667_11402538
1072 Ga0207651_11934073
1073 Ga0207712_10274820
1074 Ga0207712_11054184
1075 Ga0207712_11074429
1076 Ga0207640_10153282
1077 Ga0207658_10106728
1078 Ga0207658_11010377
1079 Ga0207677_10037743
1080 Ga0207677_10172025
1081 Ga0207703_10116793
1082 Ga0207703_10670031
1083 Ga0207703_10868033
1084 Ga0207639_11961153
1085 Ga0207678_10902381
1086 Ga0207678_11083053
1087 Ga0207678_11897169
1088 Ga0207708_10057632
1089 Ga0207708_10303654
1090 Ga0207708_10850500
1091 Ga0207708_10944304
1092 Ga0207702_10021410
1093 Ga0207702_10056896
1094 Ga0207702_10156818
1095 Ga0207702_10369607
1096 Ga0207641_10612448
1097 Ga0207641_10679596
1098 Ga0207648_10186124
1099 Ga0207676_11264356
1100 Ga0207674_10041407
1101 Ga0207683_10000098
1102 Ga0207683_10414541
1103 Ga0207698_10005895
1104 Ga0207698_10019057
1105 Ga0207698_10418834
1106 Ga0207698_11502706
1107 Ga0207428_10106637
1108 Ga0268266_10131043
1109 Ga0268265_11688276
1110 Ga0268264_10055429
1111 Ga0268264_10086504
1112 Ga0268264_11222725
1113 Ga0265319_1036303
1114 Ga0265336_10047430
1115 Ga0265336_10064711
1116 Ga0265314_10343982
1117 Ga0307406_10072118
1118 Ga0307409_100068610
1119 Ga0307411_11868179
1120 Ga0307415_100916731
1121 Ga0373958_0072893
1122 Ga0373959_0146637
1123 Ga0373926_0019611
1124 Ga0373929_0228323
1125 Ga0373934_0407310
1126 Ga0373944_0056464
1127 Ga0373952_0041082
1128 Ga0373923_0599554
1129 Ga0373936_0175537
1130 Ga0373945_0110451
1131 Ga0373945_0161463
1132 Ga0373956_0100249
1133 Ga0373960_0050976
1134 Ga0373960_0333754
1135 Ga0373943_0004341
1136 Ga0373946_0017007
1137 Ga0373955_0071396
1138 Ga0373961_0097159
1139 Ga0373962_0037239
1140 Ga0316574_0121798
1141 Ga0373924_0006148
1142 Ga0373931_0114718
1143 Ga0373935_0012322
1144 Ga0373935_1093360
1145 Ga0373927_0017377
1146 Ga0373933_0135284
1147 Ga0373947_0011283
1148 Ga0373937_0104501
1149 Ga0373925_0002887
1150 Ga0373925_0036990
1151 Ga0395898_1140317
1152 Ga0436364_0212197
1153 Ga0436364_0557675
1154 Ga0436364_0848903
1155 Ga0436364_1031907
1156 Ga0436364_1083263
1157 Ga0436364_1084053
1158 Ga0436364_1103654
1159 Ga0436364_1424347
1160 Ga0436364_1461162
1161 Ga0395901_1396911
1162 Ga0436365_0586044
1163 Ga0436365_0669823
1164 Ga0436365_0723978
1165 Ga0436365_0904996
1166 Ga0436365_0958254
1167 Ga0436365_1131272
1168 Ga0436365_1208184
1169 Ga0436365_1672751
1170 Ga0436360_0564178
1171 Ga0436360_1013825
1172 Ga0436363_0222022
1173 Ga0436363_0451087
1174 Ga0436363_0584665
1175 Ga0436363_1042291
1176 Ga0436363_1160814
1177 Ga0436363_1249550
1178 Ga0436363_1404914
1179 Ga0451845_0591229
1180 Ga0466966_0298127
1181 Ga0466963_0042606
1182 Ga0466963_0455332
1183 Ga0466964_0408333
1184 Ga0466968_0659876
1185 Ga0466960_0053894
1186 Ga0466960_0146647
1187 Ga0466960_0696870
1188 Ga0466960_1049900
1189 Ga0466959_0298127
1190 Ga0466959_0432422
1191 Ga0466959_0481063
1192 Ga0466959_0697488
1193 Ga0466958_0886740
1194 Ga0466967_0007882
1195 Ga0466967_0257901
1196 Ga0466967_1344158
1197 Ga0466967_1463404
1198 Ga0466967_1673761
1199 Ga0466967_1697315
1200 Ga0495592_0081501
1201 Ga0495603_0027667
1202 Ga0495629_0010815
1203 Ga0495641_0002945
1204 Ga0495651_0012517
1205 Ga0495653_0003629
1206 Ga0495580_0013042
1207 Ga0495582_0005354
1208 Ga0495582_0095276
1209 Ga0495639_0005141
1210 Ga0495662_0000412
1211 Ga0495664_0269024
1212 Ga0495594_0038982
1213 Ga0495594_0053159
1214 Ga0495608_0002056
1215 Ga0495618_0002753
1216 Ga0495628_0211394
1217 Ga0495630_0048581
1218 Ga0495630_0348485
1219 Ga0495666_0008214
1220 Ga0495652_0036180
1221 Ga0495665_0000527
1222 Ga0495640_0024525
1223 Ga0495640_0100592
1224 Ga0495640_0256169
1225 Ga0495586_0137834
1226 Ga0495587_0212039
1227 Ga0495645_0116200
1228 Ga0495622_0046916
1229 Ga0495667_0001822
1230 Ga0495634_0014802
1231 Ga0495635_0004994
1232 Ga0495588_0002905
1233 Ga0495657_0005225
1234 Ga0495657_0671182
1235 Ga0495623_0039850
1236 Ga0495646_0120366
1237 Ga0495647_0006973
1238 Ga0495647_0012604
1239 Ga0495658_0003617
1240 Ga0495613_0004498
1241 Ga0495613_0473939
1242 Ga0495624_0019615
1243 Ga0495600_0013003
1244 Ga0495581_0005975
1245 Ga0495604_0032767
1246 Ga0495674_0017807
1247 Ga0495674_0023349
1248 Ga0495676_0029722
1249 Ga0495676_0032063
1250 Ga0495680_0115841
1251 Ga0495675_0046142
1252 Ga0495684_0001792
1253 Ga0495593_0002686
1254 Ga0495614_0001922
1255 Ga0496100_0047955
1256 Ga0496100_0121982
1257 Ga0496100_0127573
1258 Ga0496100_0154012
1259 Ga0496100_0802971
1260 Ga0496101_0016606
1261 Ga0496101_0018572
1262 Ga0496101_0036749
1263 Ga0496101_0054050
1264 Ga0496101_0152174
1265 Ga0496101_0247425
1266 Ga0496101_0490530
1267 Ga0496102_0002361
1268 Ga0496102_0002511
1269 Ga0496102_0015761
1270 Ga0496102_0048477
1271 Ga0496102_0115980
1272 Ga0496102_0184049
1273 Ga0496103_0000900
1274 Ga0496103_0027995
1275 Ga0496103_0029004
1276 Ga0496103_0557462
1277 Ga0496103_0595286
1278 Ga0496104_0004360
1279 Ga0496104_0026210
1280 Ga0496104_0031074
1281 Ga0496104_0056979
1282 Ga0496104_0419513
1283 Ga0496104_0807707
1284 Ga0496104_1367280
1285 Ga0496105_0000346
1286 Ga0496105_0015778
1287 Ga0496105_0046435
1288 Ga0496105_0059721
1289 Ga0496105_0069163
1290 Ga0496106_0004359
1291 Ga0496106_0008276
1292 Ga0496106_0018071
1293 Ga0496106_0059407
1294 Ga0496106_0070203
1295 Ga0496106_0089690
1296 Ga0496106_1186609
1297 Ga0496107_0007275
1298 Ga0496107_0032110
1299 Ga0496107_0058567
1300 Ga0496107_0091185
1301 Ga0496107_0170159
1302 Ga0496107_0208674
1303 Ga0496108_0001177
1304 Ga0496108_0007539
1305 Ga0496108_0015397
1306 Ga0496108_0022950
1307 Ga0496108_1132288
1308 Ga0496109_0000999
1309 Ga0496109_0005691
1310 Ga0496109_0006528
1311 Ga0496109_0033040
1312 Ga0496109_0035884
1313 Ga0496109_0078528
1314 Ga0496110_0001024
1315 Ga0496110_0099793
1316 Ga0496110_0128773
1317 Ga0496110_0378988
1318 Ga0496111_0000822
1319 Ga0496111_0037932
1320 Ga0496112_0025280
1321 Ga0496112_0033720
1322 Ga0496112_0262385
1323 Ga0496112_0527591
1324 Ga0496112_0764558
1325 Ga0496113_0010520
1326 Ga0496113_0146885
1327 Ga0496113_0891821
1328 Ga0496114_0005124
1329 Ga0496114_0010039
1330 Ga0496114_0014291
1331 Ga0496114_0027105
1332 Ga0496114_0226401
1333 Ga0496114_0261231
1334 Ga0496115_0007165
1335 Ga0496115_0011617
1336 Ga0496115_0042887
1337 Ga0496115_0067927
1338 Ga0496115_0074549
1339 Ga0496115_0182353
1340 Ga0496115_0538550
1341 Ga0496115_1402478
1342 Ga0496115_1402929
1343 Ga0501036_0146297
1344 Ga0501040_0020653
1345 Ga0501041_0293504
1346 Ga0501042_0050300
1347 Ga0501067_0012918
1348 Ga0501068_0367837
1349 Ga0501069_0116471
1350 Ga0501069_0212900
1351 Ga0501072_0136271
1352 Ga0501074_0240056
1353 Ga0501075_0256248
1354 Ga0501076_0080266
1355 Ga0501079_0040248
1356 Ga0501080_1081992
1357 Ga0501081_0210133
1358 Ga0501045_0014049
1359 nmdc:mga08y16_110800_c1
1360 nmdc:mga0n895_117257_c1
1361 nmdc:mga0n895_64166_c1
1362 nmdc:mga0rr50_233745_c1
1363 nmdc:mga0rr50_964813_c1
1364 nmdc:mga08x19_168728_c1
1365 nmdc:mga0a205_431604_c1
1366 nmdc:mga0a205_498518_c1
1367 nmdc:mga0a205_670444_c1
1368 nmdc:mga0a205_921296_c1
1369 Ga0495601_0028092
1370 Ga0495601_0051417
1371 Ga0495601_0257087
1372 Ga0495612_0013474
1373 Ga0495612_0232040
1374 Ga0495655_0321998
1375 Ga0495595_0006299
1376 Ga0495619_0031706
1377 Ga0495619_0256722
1378 Ga0495619_0494244
1379 Ga0501084_0024662
1380 Ga0587073_0132631
1381 Ga0587073_0296549
1382 Ga0587101_083778
1383 Ga0587067_131402
1384 Ga0501082_0595469
1385 Ga0466962_0169960
1386 Ga0530510_0014564

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map