F475614

General Info

Members Datasets Scaffolds Average Seq Length
692 319 1296 396

Family's Representative Sequence

Representative Sequence 3300050512|nmdc:mga0n895_87995_c1|nmdc:mga0n895_87995_c1_1452_2789
Length 445
Sequence MDMDQAKKSIGQHELPGPRTWQTDQITSPAGTRSRKERAMHELSEKVHWHEPTGIDRAGVGKFGRPKTPYDLFMESEGIPVFRDVGLKTVLDLPMKPWKRMGGKGTYIQLFGTEGKWGSYVVEIPGAGALNPEKHIYEEVYLVAEGRGTTEVWLDNDSKKHVFEWQKGSLFSIPVNAWHRLINASSSPAVLIGGTTAPNLMNLINNTDFIFNAPYQFKDRFSGADDFYKYKDDIEPDPVRGLAMRRTNFVPDVINCDLPLDNRRSVGWRRVEPFMTGNTFYLWIGQHEVGRYSKAHAHTSAAVLICLKGNGYTYTWPERNGVTPWKDGKADEVKRVDYSQFGMVSAAPGGARWYHQHFNASKEGFRLTAWFGPHNPGREPGPPGEKHTDYTAMDIPEGGTAIPYYMEDPYLREEFAEKLRAEGAVNRMEADFYKKGTVVPKFVGA

Samples

Sample ID Description Type Environment
1 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
5 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
8 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
52 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
55 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
56 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
69 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
70 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
92 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
93 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
94 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
95 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
96 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
97 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
98 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
99 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
142 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
144 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
145 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
146 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
147 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
148 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
149 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
150 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
151 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
152 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
153 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
154 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
155 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
156 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
157 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
158 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
159 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
160 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
161 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
162 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
163 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
164 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
165 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
166 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
167 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
168 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
169 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
170 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
171 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
172 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
173 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
174 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
175 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
176 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
177 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
178 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
179 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
180 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
181 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
182 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
183 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
184 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
185 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
186 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
187 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
188 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
189 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
190 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
191 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
192 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
193 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
194 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
195 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
196 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
197 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
198 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
199 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
200 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
201 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
202 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
203 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
204 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
205 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
206 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
207 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
208 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
209 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
210 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
211 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
212 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
213 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
214 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
215 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
216 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
217 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
218 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
219 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
220 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
221 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
222 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
223 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
224 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
225 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
226 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
227 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
228 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
229 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
230 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
231 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
232 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
233 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
234 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
235 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
236 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
237 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
238 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
239 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
240 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
241 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
242 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
243 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
244 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
245 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
246 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
247 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
248 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
249 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
250 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
251 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
252 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
253 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
254 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
255 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
256 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
257 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
258 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
259 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
260 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
261 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
262 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
263 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
264 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
265 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
273 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
276 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
277 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
278 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
279 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
280 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
281 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
282 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
283 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
284 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
285 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
286 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
287 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
290 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
291 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
292 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
293 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
294 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
295 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
296 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
297 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
298 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
299 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
300 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
301 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
302 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
303 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
304 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
305 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
306 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
307 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
308 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
309 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
310 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
311 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
312 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
313 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
314 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
315 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
316 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
317 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
318 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
319 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.55
Metatranscriptomes 0.14
Isolates 1.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.18
Nodule 0
Rhizoplane 7.95
Rhizosphere 85.26
Stem 0
Stem Tuber 0
Unclassified 1.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0n895_87995_c1 3300050512 Bacteria 3105
2 JGI24752J21851_1003612 3300001976 Bacteria 2038
3 JGI24743J22301_10000159 3300001991 Bacteria 7006
4 JGI24744J21845_10000795 3300002077 Bacteria 5917
5 JGI24742J22300_10001783 3300002244 Bacteria 3433
6 JGI24751J29686_10002740 3300002459 Bacteria 3544
7 JGI25152J39213_1009813 3300002773 Bacteria 2240
8 JGI25153J46596_10002792 3300003215 Bacteria 9926
9 Ga0065165_1019615 3300005262 Bacteria 2406
10 Ga0070683_100159986 3300005329 Bacteria 2136
11 Ga0070690_100007850 3300005330 Bacteria 6121
12 Ga0070670_100013972 3300005331 Bacteria 6886
13 Ga0070670_100036467 3300005331 Bacteria 4231
14 Ga0068869_100050057 3300005334 Bacteria 3027
15 Ga0070680_100013163 3300005336 Bacteria 6439
16 Ga0070680_100175198 3300005336 Bacteria 1806
17 Ga0070660_100012525 3300005339 Bacteria 6058
18 Ga0070689_100035798 3300005340 Bacteria 3793
19 Ga0070689_100143041 3300005340 Bacteria 1925
20 Ga0070668_100162218 3300005347 Bacteria 1814
21 Ga0070669_100054628 3300005353 Bacteria 2925
22 Ga0070675_100092898 3300005354 Bacteria 2530
23 Ga0070675_100234251 3300005354 Bacteria 1602
24 Ga0070673_100016556 3300005364 Bacteria 5217
25 Ga0070673_100143549 3300005364 Bacteria 2016
26 Ga0070673_100145436 3300005364 Bacteria 2003
27 Ga0070688_100018126 3300005365 Bacteria 4056
28 Ga0070659_100046603 3300005366 Bacteria 3398
29 Ga0070667_100151364 3300005367 Bacteria 2038
30 Ga0070709_10140888 3300005434 Bacteria 1657
31 Ga0070714_100001040 3300005435 Bacteria 19786
32 Ga0070714_100073781 3300005435 Bacteria 2957
33 Ga0070714_100139194 3300005435 Bacteria 2176
34 Ga0070713_100250168 3300005436 Bacteria 1616
35 Ga0070700_100050815 3300005441 Bacteria 2578
36 Ga0070694_100101960 3300005444 Bacteria 2031
37 Ga0070678_100039527 3300005456 Bacteria 3329
38 Ga0070681_10012437 3300005458 Bacteria 8443
39 Ga0070681_10018639 3300005458 Bacteria 6940
40 Ga0070681_10204786 3300005458 Bacteria 1890
41 Ga0068867_100005981 3300005459 Bacteria 8627
42 Ga0070685_10002466 3300005466 Bacteria 9501
43 Ga0070698_100300350 3300005471 Bacteria 1536
44 Ga0070699_100045664 3300005518 Bacteria 3791
45 Ga0070679_100010328 3300005530 Bacteria 8851
46 Ga0070679_100032746 3300005530 Bacteria 5144
47 Ga0070679_100058893 3300005530 Bacteria 3828
48 Ga0070679_100064816 3300005530 Bacteria 3642
49 Ga0070679_100066981 3300005530 Bacteria 3580
50 Ga0070679_100071445 3300005530 Bacteria 3462
51 Ga0070679_100100568 3300005530 Bacteria 2877
52 Ga0070672_100129921 3300005543 Bacteria 2069
53 Ga0070686_100023126 3300005544 Bacteria 3711
54 Ga0070665_100114831 3300005548 Bacteria 2695
55 Ga0070704_100257993 3300005549 Bacteria 1435
56 Ga0070664_100045169 3300005564 Bacteria 3721
57 Ga0070664_100150933 3300005564 Bacteria 2051
58 Ga0068857_100057232 3300005577 Bacteria 3460
59 Ga0068857_100088754 3300005577 Bacteria 2766
60 Ga0068852_100169091 3300005616 Bacteria 2047
61 Ga0068859_100088326 3300005617 Bacteria 3149
62 Ga0068864_100009445 3300005618 Bacteria 8048
63 Ga0068864_100036947 3300005618 Bacteria 4165
64 Ga0068861_100052466 3300005719 Bacteria 3099
65 Ga0068870_10075363 3300005840 Bacteria 1851
66 Ga0068863_100057518 3300005841 Bacteria 3680
67 Ga0068863_100142918 3300005841 Bacteria 2288
68 Ga0068858_100080572 3300005842 Bacteria 3025
69 Ga0068862_100065141 3300005844 Bacteria 3138
70 Ga0081455_10007292 3300005937 Bacteria 11670
71 Ga0081455_10018166 3300005937 Bacteria 6712
72 Ga0081455_10019160 3300005937 Bacteria 6484
73 Ga0081455_10047260 3300005937 Bacteria 3729
74 Ga0081538_10017857 3300005981 Bacteria 5360
75 Ga0081538_10022560 3300005981 Bacteria 4559
76 Ga0081538_10030614 3300005981 Bacteria 3649
77 Ga0081540_1000612 3300005983 Bacteria 33991
78 Ga0081540_1005942 3300005983 Bacteria 9008
79 Ga0081540_1056634 3300005983 Bacteria 1901
80 Ga0081539_10026447 3300005985 Bacteria 3703
81 Ga0081539_10063009 3300005985 Bacteria 2025
82 Ga0075365_10069576 3300006038 Bacteria 2366
83 Ga0075364_10208723 3300006051 Bacteria 1324
84 Ga0070715_10003603 3300006163 Bacteria 4964
85 Ga0070716_100017847 3300006173 Bacteria 3688
86 Ga0070712_100000210 3300006175 Bacteria 32927
87 Ga0070712_100061039 3300006175 Bacteria 2662
88 Ga0070712_100106326 3300006175 Bacteria 2086
89 Ga0070712_100117168 3300006175 Bacteria 1998
90 Ga0075366_10035133 3300006195 Bacteria 2955
91 Ga0075366_10056722 3300006195 Bacteria 2327
92 Ga0097621_100327409 3300006237 Unclassified 1358
93 Ga0075428_100018890 3300006844 Bacteria 7623
94 Ga0075428_100076117 3300006844 Bacteria 3664
95 Ga0075428_100237516 3300006844 Bacteria 1967
96 Ga0075430_100000255 3300006846 Bacteria 37131
97 Ga0075430_100020485 3300006846 Bacteria 5626
98 Ga0075430_100033565 3300006846 Bacteria 4356
99 Ga0075430_100041039 3300006846 Bacteria 3915
100 Ga0075430_100067950 3300006846 Bacteria 2990
101 Ga0075430_100117998 3300006846 Bacteria 2212
102 Ga0075431_100049539 3300006847 Bacteria 4331
103 Ga0075431_100078422 3300006847 Bacteria 3409
104 Ga0075431_100216872 3300006847 Bacteria 1953
105 Ga0075433_10033611 3300006852 Bacteria 4398
106 Ga0075433_10050963 3300006852 Bacteria 3604
107 Ga0075434_100064866 3300006871 Bacteria 3637
108 Ga0075434_100176744 3300006871 Bacteria 2155
109 Ga0075436_100008134 3300006914 Bacteria 7179
110 Ga0075436_100009792 3300006914 Bacteria 6552
111 Ga0097620_100088327 3300006931 Bacteria 3149
112 Ga0099794_10002449 3300007265 Bacteria 6845
113 Ga0099794_10003432 3300007265 Bacteria 6043
114 Ga0099795_10002310 3300007788 Bacteria 4450
115 Ga0099795_10019898 3300007788 Bacteria 2178
116 Ga0099795_10055394 3300007788 Bacteria 1456
117 Ga0105250_10017133 3300009092 Bacteria 2945
118 Ga0105240_10007001 3300009093 Bacteria 16465
119 Ga0105240_10007390 3300009093 Bacteria 15972
120 Ga0105240_10062723 3300009093 Bacteria 4626
121 Ga0111539_10121738 3300009094 Unclassified 3057
122 Ga0111539_10152990 3300009094 Bacteria 2700
123 Ga0111539_10187164 3300009094 Bacteria 2417
124 Ga0111539_10233313 3300009094 Bacteria 2142
125 Ga0111539_10349793 3300009094 Bacteria 1720
126 Ga0105245_10033559 3300009098 Bacteria 4550
127 Ga0114129_10019015 3300009147 Bacteria 9786
128 Ga0114129_10019114 3300009147 Bacteria 9758
129 Ga0114129_10087403 3300009147 Bacteria 4323
130 Ga0114129_10253130 3300009147 Bacteria 2363
131 Ga0114129_10502562 3300009147 Bacteria 1583
132 Ga0105241_10247043 3300009174 Bacteria 1511
133 Ga0105242_10080116 3300009176 Bacteria 2729
134 Ga0105248_10055746 3300009177 Bacteria 4434
135 Ga0105237_10000625 3300009545 Bacteria 49435
136 Ga0105249_10016632 3300009553 Bacteria 6529
137 Ga0099796_10001655 3300010159 Bacteria 4612
138 Ga0099796_10005380 3300010159 Bacteria 3192
139 Ga0099796_10017929 3300010159 Bacteria 2117
140 Ga0099796_10056706 3300010159 Bacteria 1376
141 Ga0105239_10000051 3300010375 Bacteria 169036
142 Ga0157371_10042548 3300013102 Unclassified 3238
143 Ga0157374_10110060 3300013296 Bacteria 2649
144 Ga0163162_10029264 3300013306 Bacteria 5451
145 Ga0157375_10160635 3300013308 Bacteria 2388
146 Ga0163163_10013076 3300014325 Bacteria 7582
147 Ga0157380_10045808 3300014326 Bacteria 3434
148 Ga0157377_10006770 3300014745 Bacteria 5491
149 Ga0157379_10005269 3300014968 Bacteria 11102
150 Ga0157376_10037586 3300014969 Bacteria 3932
151 Ga0213876_10036260 3300021384 Bacteria 2602
152 Ga0213875_10000153 3300021388 Bacteria 73168
153 Ga0224572_1000751 3300024225 Bacteria 4223
154 Ga0228598_1002054 3300024227 Bacteria 4396
155 Ga0209129_1000209 3300025258 Bacteria 68109
156 Ga0209233_1006308 3300025261 Bacteria 3833
157 Ga0209025_1000878 3300025294 Bacteria 47176
158 Ga0209758_1000760 3300025297 Bacteria 46690
159 Ga0207697_10060806 3300025315 Bacteria 1571
160 Ga0207692_10042661 3300025898 Bacteria 2253
161 Ga0207688_10000274 3300025901 Bacteria 23548
162 Ga0207645_10071599 3300025907 Bacteria 2219
163 Ga0207684_10150528 3300025910 Bacteria 2002
164 Ga0207707_10050583 3300025912 Bacteria 3619
165 Ga0207707_10129301 3300025912 Bacteria 2209
166 Ga0207707_10176028 3300025912 Bacteria 1869
167 Ga0207695_10005372 3300025913 Bacteria 17034
168 Ga0207695_10049993 3300025913 Bacteria 4401
169 Ga0207671_10004734 3300025914 Bacteria 12844
170 Ga0207693_10002396 3300025915 Bacteria 16268
171 Ga0207693_10011810 3300025915 Bacteria 7058
172 Ga0207693_10057651 3300025915 Bacteria 3044
173 Ga0207693_10099662 3300025915 Bacteria 2278
174 Ga0207693_10218976 3300025915 Bacteria 1496
175 Ga0207663_10015238 3300025916 Bacteria 4237
176 Ga0207660_10009542 3300025917 Bacteria 6281
177 Ga0207657_10029015 3300025919 Bacteria 5042
178 Ga0207652_10010202 3300025921 Bacteria 7562
179 Ga0207652_10026074 3300025921 Bacteria 4865
180 Ga0207652_10030096 3300025921 Bacteria 4545
181 Ga0207652_10034112 3300025921 Bacteria 4288
182 Ga0207652_10054688 3300025921 Bacteria 3432
183 Ga0207652_10107113 3300025921 Bacteria 2475
184 Ga0207646_10202304 3300025922 Bacteria 1794
185 Ga0207650_10007377 3300025925 Bacteria 7483
186 Ga0207687_10024241 3300025927 Bacteria 4051
187 Ga0207700_10226009 3300025928 Bacteria 1589
188 Ga0207664_10000657 3300025929 Bacteria 23838
189 Ga0207709_10044087 3300025935 Bacteria 2693
190 Ga0207670_10001077 3300025936 Bacteria 14370
191 Ga0207669_10004872 3300025937 Bacteria 5960
192 Ga0207669_10013450 3300025937 Bacteria 4065
193 Ga0207665_10002138 3300025939 Bacteria 13362
194 Ga0207665_10072624 3300025939 Bacteria 2351
195 Ga0207691_10001917 3300025940 Bacteria 20311
196 Ga0207691_10123542 3300025940 Bacteria 2291
197 Ga0207711_10058631 3300025941 Bacteria 3314
198 Ga0207689_10019992 3300025942 Bacteria 5640
199 Ga0207661_10134090 3300025944 Bacteria 2125
200 Ga0207679_10121935 3300025945 Bacteria 2077
201 Ga0207651_10038481 3300025960 Bacteria 3145
202 Ga0207651_10060211 3300025960 Bacteria 2635
203 Ga0207651_10086911 3300025960 Bacteria 2274
204 Ga0207651_10145606 3300025960 Bacteria 1837
205 Ga0207712_10280676 3300025961 Bacteria 1359
206 Ga0207668_10072994 3300025972 Bacteria 2457
207 Ga0207658_10037695 3300025986 Bacteria 3476
208 Ga0207703_10004180 3300026035 Bacteria 11899
209 Ga0207639_10051879 3300026041 Bacteria 3122
210 Ga0207678_10014823 3300026067 Bacteria 6859
211 Ga0207708_10002274 3300026075 Bacteria 14164
212 Ga0207641_10006517 3300026088 Bacteria 9824
213 Ga0207641_10074708 3300026088 Bacteria 2925
214 Ga0207648_10010742 3300026089 Bacteria 8654
215 Ga0207648_10175322 3300026089 Bacteria 1896
216 Ga0207676_10003488 3300026095 Bacteria 11136
217 Ga0207674_10061137 3300026116 Bacteria 3807
218 Ga0207675_100005913 3300026118 Bacteria 11677
219 Ga0207683_10119999 3300026121 Bacteria 2360
220 Ga0207698_10061762 3300026142 Bacteria 2922
221 Ga0207428_10054538 3300027907 Bacteria 3183
222 Ga0268266_10041495 3300028379 Bacteria 3926
223 Ga0268266_10266096 3300028379 Bacteria 1590
224 Ga0265337_1002189 3300028556 Bacteria 9138
225 Ga0265337_1003078 3300028556 Bacteria 7358
226 Ga0265334_10000940 3300028573 Bacteria 14526
227 Ga0265338_10002492 3300028800 Bacteria 27463
228 Ga0265338_10003861 3300028800 Bacteria 20783
229 Ga0265338_10024214 3300028800 Bacteria 6210
230 Ga0265773_1000387 3300031018 Bacteria 1714
231 Ga0265325_10000031 3300031241 Bacteria 102905
232 Ga0265325_10035756 3300031241 Bacteria 2635
233 Ga0265325_10054085 3300031241 Bacteria 2056
234 Ga0265340_10003001 3300031247 Bacteria 9599
235 Ga0265339_10000096 3300031249 Bacteria 74964
236 Ga0265339_10002413 3300031249 Bacteria 13404
237 Ga0265313_10000024 3300031595 Bacteria 138587
238 Ga0265313_10000661 3300031595 Bacteria 35522
239 Ga0265314_10015140 3300031711 Bacteria 6133
240 Ga0265342_10000354 3300031712 Bacteria 51330
241 Ga0265342_10019956 3300031712 Bacteria 4310
242 Ga0307409_100076665 3300031995 Bacteria 2682
243 Ga0373934_0001525 3300035086 Bacteria 8480
244 Ga0373949_0027376 3300035090 Bacteria 1340
245 Ga0373923_0005525 3300035111 Bacteria 4297
246 Ga0373923_0079794 3300035111 Bacteria 1418
247 Ga0373932_0007889 3300035112 Unclassified 2541
248 Ga0373936_0010979 3300035113 Bacteria 3423
249 Ga0373936_0015461 3300035113 Bacteria 2925
250 Ga0373945_0001308 3300035116 Bacteria 7555
251 Ga0373945_0002210 3300035116 Bacteria 6083
252 Ga0373945_0026847 3300035116 Bacteria 2008
253 Ga0373953_0001573 3300035117 Bacteria 6673
254 Ga0373953_0025971 3300035117 Bacteria 2241
255 Ga0373954_0001648 3300035118 Bacteria 9137
256 Ga0373954_0001781 3300035118 Bacteria 8856
257 Ga0373954_0036732 3300035118 Bacteria 2275
258 Ga0373954_0040347 3300035118 Bacteria 2174
259 Ga0373956_0000078 3300035119 Bacteria 32263
260 Ga0373956_0027810 3300035119 Bacteria 2458
261 Ga0373956_0096327 3300035119 Bacteria 1369
262 Ga0373957_0002055 3300035120 Bacteria 5642
263 Ga0373957_0054584 3300035120 Bacteria 1535
264 Ga0373943_0000233 3300035170 Bacteria 22738
265 Ga0373943_0007312 3300035170 Bacteria 4957
266 Ga0373943_0035727 3300035170 Bacteria 2377
267 Ga0373946_0000049 3300035171 Bacteria 31469
268 Ga0373946_0000677 3300035171 Bacteria 11425
269 Ga0373946_0011505 3300035171 Bacteria 3303
270 Ga0373946_0030018 3300035171 Bacteria 2168
271 Ga0373946_0062614 3300035171 Bacteria 1587
272 Ga0373955_0000227 3300035172 Bacteria 23600
273 Ga0373955_0001483 3300035172 Bacteria 9975
274 Ga0373955_0014250 3300035172 Bacteria 3863
275 Ga0373955_0052375 3300035172 Bacteria 2226
276 Ga0373955_0093820 3300035172 Bacteria 1714
277 Ga0373924_0009827 3300035410 Bacteria 3515
278 Ga0373924_0012308 3300035410 Bacteria 3194
279 Ga0373924_0022644 3300035410 Bacteria 2457
280 Ga0373924_0032019 3300035410 Bacteria 2117
281 Ga0373931_0001819 3300035691 Bacteria 9274
282 Ga0373931_0003497 3300035691 Bacteria 7068
283 Ga0373931_0063646 3300035691 Bacteria 1994
284 Ga0373931_0073540 3300035691 Bacteria 1870
285 Ga0373935_0000466 3300035692 Bacteria 21064
286 Ga0373935_0001083 3300035692 Bacteria 14865
287 Ga0373935_0002492 3300035692 Bacteria 10542
288 Ga0373935_0029753 3300035692 Bacteria 3381
289 Ga0373935_0041307 3300035692 Bacteria 2897
290 Ga0373935_0065624 3300035692 Bacteria 2330
291 Ga0373927_0000113 3300035695 Bacteria 60608
292 Ga0373927_0010893 3300035695 Bacteria 6055
293 Ga0373927_0016279 3300035695 Bacteria 4906
294 Ga0373927_0091102 3300035695 Bacteria 1980
295 Ga0373933_0000380 3300035724 Bacteria 28436
296 Ga0373933_0006695 3300035724 Bacteria 6280
297 Ga0373933_0015019 3300035724 Bacteria 4315
298 Ga0373947_0000168 3300035725 Bacteria 35315
299 Ga0373947_0006997 3300035725 Bacteria 6536
300 Ga0373947_0014906 3300035725 Bacteria 4461
301 Ga0373947_0019503 3300035725 Bacteria 3910
302 Ga0373947_0030965 3300035725 Bacteria 3146
303 Ga0373947_0083621 3300035725 Bacteria 1979
304 Ga0373947_0092780 3300035725 Bacteria 1886
305 Ga0373947_0126382 3300035725 Bacteria 1628
306 Ga0373937_0000079 3300036401 Bacteria 88626
307 Ga0373937_0000480 3300036401 Bacteria 36669
308 Ga0373937_0004515 3300036401 Bacteria 11820
309 Ga0373937_0017436 3300036401 Bacteria 6397
310 Ga0373937_0043790 3300036401 Bacteria 4088
311 Ga0373937_0077608 3300036401 Bacteria 3069
312 Ga0373937_0402118 3300036401 Bacteria 1299
313 Ga0373925_0000007 3300037068 Bacteria 257023
314 Ga0373925_0003256 3300037068 Bacteria 12656
315 Ga0373925_0015131 3300037068 Bacteria 5577
316 Ga0373925_0079467 3300037068 Bacteria 2492
317 Ga0373925_0079537 3300037068 Bacteria 2491
318 Ga0373925_0116635 3300037068 Bacteria 2068
319 Ga0373925_0237982 3300037068 Bacteria 1457
320 Ga0373925_0241786 3300037068 Unclassified 1446
321 Ga0395899_0007318 3300037312 Bacteria 8538
322 Ga0395900_0002874 3300037418 Bacteria 18763
323 Ga0395900_0069811 3300037418 Bacteria 3612
324 Ga0395898_0004719 3300037466 Bacteria 14834
325 Ga0395898_0214223 3300037466 Bacteria 1837
326 Ga0395905_0001763 3300037471 Bacteria 25156
327 Ga0436364_0042559 3300037853 Bacteria 2612
328 Ga0436364_0535844 3300037853 Bacteria 1573
329 Ga0436364_0953684 3300037853 Bacteria 1563
330 Ga0436364_1030070 3300037853 Bacteria 2567
331 Ga0395901_0049175 3300038443 Bacteria 4380
332 Ga0436365_0406577 3300039437 Bacteria 2285
333 Ga0436365_1492121 3300039437 Bacteria 4580
334 Ga0436365_1811122 3300039437 Bacteria 1852
335 Ga0436360_0084426 3300039438 Bacteria 1760
336 Ga0436360_0571589 3300039438 Bacteria 1823
337 Ga0436361_0757040 3300039447 Bacteria 6071
338 Ga0436363_0200606 3300039450 Bacteria 1489
339 Ga0436363_0211846 3300039450 Bacteria 3217
340 Ga0436363_1293510 3300039450 Bacteria 3878
341 Ga0451851_1113993 3300041507 Bacteria 1823
342 Ga0466966_0030005 3300044684 Bacteria 3535
343 Ga0466963_0020577 3300044694 Bacteria 4149
344 Ga0466963_0063167 3300044694 Bacteria 2478
345 Ga0466957_0031269 3300044842 Bacteria 3180
346 Ga0466959_0026245 3300045049 Bacteria 4318
347 Ga0466958_0039367 3300045836 Bacteria 2840
348 Ga0466967_0276757 3300045976 Bacteria 1610
349 Ga0495592_0000254 3300046454 Bacteria 45710
350 Ga0495592_0003313 3300046454 Bacteria 11533
351 Ga0495592_0009882 3300046454 Bacteria 7185
352 Ga0495592_0045287 3300046454 Bacteria 3283
353 Ga0495592_0216793 3300046454 Bacteria 1282
354 Ga0495603_0013221 3300046455 Bacteria 4989
355 Ga0495603_0138011 3300046455 Bacteria 1419
356 Ga0495629_0007735 3300046459 Bacteria 7908
357 Ga0495629_0050671 3300046459 Bacteria 2907
358 Ga0495629_0061523 3300046459 Bacteria 2624
359 Ga0495629_0216676 3300046459 Unclassified 1321
360 Ga0495638_0000035 3300046460 Bacteria 276385
361 Ga0495641_0006762 3300046461 Bacteria 7357
362 Ga0495651_0009915 3300046462 Bacteria 7326
363 Ga0495651_0025486 3300046462 Bacteria 4602
364 Ga0495653_0000034 3300046463 Bacteria 131084
365 Ga0495653_0006362 3300046463 Bacteria 9690
366 Ga0495580_0046525 3300046472 Bacteria 3078
367 Ga0495582_0015890 3300046473 Bacteria 4127
368 Ga0495582_0026837 3300046473 Bacteria 3156
369 Ga0495582_0132617 3300046473 Bacteria 1408
370 Ga0495662_0000223 3300046476 Bacteria 23829
371 Ga0495662_0010258 3300046476 Bacteria 4592
372 Ga0495662_0011695 3300046476 Bacteria 4290
373 Ga0495664_0000003 3300046477 Bacteria 551602
374 Ga0495664_0002068 3300046477 Bacteria 10737
375 Ga0495664_0025239 3300046477 Bacteria 3459
376 Ga0495584_0100600 3300046491 Bacteria 1461
377 Ga0495594_0021796 3300046499 Bacteria 3421
378 Ga0495594_0044534 3300046499 Bacteria 2434
379 Ga0495596_0011612 3300046500 Bacteria 3792
380 Ga0495606_0002285 3300046507 Bacteria 22658
381 Ga0495608_0000319 3300046511 Bacteria 33877
382 Ga0495618_0000018 3300046514 Bacteria 139407
383 Ga0495618_0050255 3300046514 Bacteria 2633
384 Ga0495628_0000001 3300046516 Bacteria 917742
385 Ga0495628_0024524 3300046516 Bacteria 4936
386 Ga0495628_0142357 3300046516 Bacteria 1830
387 Ga0495628_0228424 3300046516 Bacteria 1396
388 Ga0495630_0005195 3300046517 Bacteria 9172
389 Ga0495630_0008347 3300046517 Bacteria 7434
390 Ga0495630_0043787 3300046517 Bacteria 3345
391 Ga0495630_0203394 3300046517 Bacteria 1511
392 Ga0495630_0271041 3300046517 Bacteria 1297
393 Ga0495648_0021176 3300046524 Bacteria 4511
394 Ga0495666_0006389 3300046526 Bacteria 5936
395 Ga0495652_0000006 3300046529 Bacteria 459709
396 Ga0495652_0083703 3300046529 Bacteria 2625
397 Ga0495665_0011336 3300046531 Bacteria 4823
398 Ga0495665_0013487 3300046531 Bacteria 4417
399 Ga0495665_0014654 3300046531 Bacteria 4226
400 Ga0495665_0037290 3300046531 Bacteria 2595
401 Ga0495665_0041080 3300046531 Bacteria 2462
402 Ga0495640_0000002 3300046533 Bacteria 646434
403 Ga0495640_0003289 3300046533 Bacteria 13001
404 Ga0495640_0005316 3300046533 Bacteria 10232
405 Ga0495640_0012138 3300046533 Bacteria 6595
406 Ga0495640_0027493 3300046533 Bacteria 4102
407 Ga0495640_0055729 3300046533 Bacteria 2704
408 Ga0495586_0041189 3300046535 Bacteria 2487
409 Ga0495586_0084015 3300046535 Bacteria 1752
410 Ga0495586_0117616 3300046535 Bacteria 1483
411 Ga0495587_0000001 3300046536 Bacteria 724132
412 Ga0495587_0041776 3300046536 Bacteria 2735
413 Ga0495598_0029866 3300046537 Bacteria 1523
414 Ga0495645_0000009 3300046543 Bacteria 239632
415 Ga0495645_0000372 3300046543 Bacteria 31206
416 Ga0495645_0024699 3300046543 Bacteria 4361
417 Ga0495667_0000004 3300046559 Bacteria 295297
418 Ga0495667_0014228 3300046559 Bacteria 5373
419 Ga0495667_0079151 3300046559 Bacteria 2137
420 Ga0495668_0137461 3300046616 Bacteria 1338
421 Ga0495634_0000014 3300046642 Bacteria 128091
422 Ga0495634_0004200 3300046642 Bacteria 11373
423 Ga0495634_0012436 3300046642 Bacteria 6160
424 Ga0495634_0026333 3300046642 Bacteria 4060
425 Ga0495634_0114932 3300046642 Bacteria 1728
426 Ga0495635_0000001 3300046663 Bacteria 704901
427 Ga0495635_0095154 3300046663 Bacteria 2036
428 Ga0495659_0000447 3300046664 Bacteria 15414
429 Ga0495657_0000336 3300046675 Bacteria 43164
430 Ga0495657_0006506 3300046675 Bacteria 9134
431 Ga0495599_0000053 3300046678 Bacteria 80559
432 Ga0495599_0000856 3300046678 Bacteria 17018
433 Ga0495599_0033974 3300046678 Bacteria 3206
434 Ga0495623_0000091 3300046679 Bacteria 53677
435 Ga0495646_0000020 3300046680 Bacteria 117021
436 Ga0495647_0001007 3300046681 Bacteria 8573
437 Ga0495647_0018367 3300046681 Bacteria 2488
438 Ga0495658_0037797 3300046683 Bacteria 2671
439 Ga0495613_0112455 3300046689 Bacteria 1961
440 Ga0495624_0001118 3300046690 Bacteria 21215
441 Ga0495624_0034881 3300046690 Bacteria 3251
442 Ga0495624_0085722 3300046690 Bacteria 1945
443 Ga0495600_0000123 3300046809 Bacteria 43494
444 Ga0495600_0005818 3300046809 Bacteria 7453
445 Ga0495581_0027319 3300047315 Bacteria 3309
446 Ga0495581_0037619 3300047315 Bacteria 2801
447 Ga0495581_0054801 3300047315 Bacteria 2302
448 Ga0495604_0000008 3300047317 Bacteria 341160
449 Ga0495636_0009867 3300047318 Bacteria 3761
450 Ga0495674_0000016 3300047319 Bacteria 216763
451 Ga0495674_0021520 3300047319 Bacteria 5964
452 Ga0495674_0162659 3300047319 Unclassified 1867
453 Ga0495674_0207291 3300047319 Bacteria 1625
454 Ga0495672_0022226 3300047320 Bacteria 4127
455 Ga0495672_0032009 3300047320 Bacteria 3277
456 Ga0495676_0072619 3300047321 Bacteria 2641
457 Ga0495676_0139877 3300047321 Unclassified 1736
458 Ga0495680_0001791 3300047322 Bacteria 22730
459 Ga0495680_0014696 3300047322 Bacteria 6771
460 Ga0495680_0095054 3300047322 Unclassified 2229
461 Ga0495675_0000745 3300047444 Bacteria 20330
462 Ga0495675_0026811 3300047444 Bacteria 3673
463 Ga0495684_0000002 3300047471 Bacteria 341216
464 Ga0495684_0000928 3300047471 Bacteria 23791
465 Ga0495684_0001824 3300047471 Bacteria 17119
466 Ga0495684_0004590 3300047471 Bacteria 10791
467 Ga0495684_0004954 3300047471 Bacteria 10400
468 Ga0495684_0052884 3300047471 Bacteria 3099
469 Ga0495593_0002527 3300047673 Bacteria 10987
470 Ga0495593_0043232 3300047673 Bacteria 2415
471 Ga0495593_0125959 3300047673 Bacteria 1302
472 Ga0495602_0000022 3300048088 Bacteria 163672
473 Ga0496100_0004563 3300048903 Bacteria 7360
474 Ga0496100_0035286 3300048903 Bacteria 3144
475 Ga0496101_0002221 3300048904 Bacteria 11860
476 Ga0496101_0008127 3300048904 Bacteria 6846
477 Ga0496101_0029602 3300048904 Bacteria 3830
478 Ga0496101_0108194 3300048904 Bacteria 2090
479 Ga0496102_0026593 3300048905 Bacteria 5163
480 Ga0496102_0035431 3300048905 Bacteria 4491
481 Ga0496102_0129230 3300048905 Bacteria 2363
482 Ga0496102_0201567 3300048905 Bacteria 1876
483 Ga0496103_0008195 3300048906 Bacteria 6202
484 Ga0496104_0000609 3300048907 Bacteria 30631
485 Ga0496104_0001668 3300048907 Bacteria 19171
486 Ga0496104_0003575 3300048907 Bacteria 13418
487 Ga0496104_0042531 3300048907 Bacteria 4264
488 Ga0496104_0207023 3300048907 Bacteria 1873
489 Ga0496104_0221458 3300048907 Bacteria 1804
490 Ga0496105_0001278 3300048908 Bacteria 17592
491 Ga0496105_0003662 3300048908 Bacteria 11422
492 Ga0496105_0008016 3300048908 Bacteria 8205
493 Ga0496105_0010336 3300048908 Bacteria 7338
494 Ga0496106_0000002 3300048909 Bacteria 377020
495 Ga0496106_0001992 3300048909 Bacteria 15367
496 Ga0496106_0014955 3300048909 Bacteria 5741
497 Ga0496106_0037943 3300048909 Bacteria 3605
498 Ga0496106_0148574 3300048909 Bacteria 1847
499 Ga0496107_0002763 3300048910 Bacteria 11556
500 Ga0496108_0000510 3300048911 Bacteria 30463
501 Ga0496108_0056718 3300048911 Bacteria 3291
502 Ga0496108_0106257 3300048911 Bacteria 2397
503 Ga0496108_0118705 3300048911 Bacteria 2267
504 Ga0496109_0003609 3300048912 Bacteria 12934
505 Ga0496109_0060654 3300048912 Bacteria 3456
506 Ga0496109_0071208 3300048912 Bacteria 3191
507 Ga0496110_0044262 3300048913 Bacteria 3887
508 Ga0496110_0045372 3300048913 Bacteria 3841
509 Ga0496110_0236749 3300048913 Bacteria 1661
510 Ga0496111_0001147 3300048914 Bacteria 14708
511 Ga0496111_0021137 3300048914 Bacteria 4540
512 Ga0496112_0000320 3300048915 Bacteria 30902
513 Ga0496112_0017770 3300048915 Bacteria 6692
514 Ga0496112_0230052 3300048915 Bacteria 1809
515 Ga0496112_0283231 3300048915 Bacteria 1604
516 Ga0496113_0001355 3300048916 Bacteria 13563
517 Ga0496113_0017894 3300048916 Bacteria 4927
518 Ga0496113_0095511 3300048916 Bacteria 2297
519 Ga0496114_0004710 3300048917 Bacteria 10613
520 Ga0496114_0185379 3300048917 Bacteria 1818
521 Ga0496114_0233760 3300048917 Bacteria 1615
522 Ga0496115_0005695 3300048918 Bacteria 9065
523 Ga0496115_0013034 3300048918 Bacteria 6275
524 Ga0496115_0014471 3300048918 Bacteria 5973
525 Ga0496115_0017959 3300048918 Bacteria 5419
526 Ga0496115_0025376 3300048918 Bacteria 4613
527 Ga0496115_0025929 3300048918 Bacteria 4568
528 Ga0496117_0034301 3300048920 Bacteria 3825
529 Ga0496121_0000656 3300048924 Bacteria 64883
530 Ga0496121_0002262 3300048924 Bacteria 29972
531 Ga0496121_0010417 3300048924 Bacteria 10489
532 Ga0496121_0034947 3300048924 Bacteria 4511
533 Ga0496121_0082266 3300048924 Bacteria 2546
534 Ga0496121_0193435 3300048924 Bacteria 1456
535 Ga0496126_0014765 3300048929 Bacteria 7881
536 Ga0495682_0000040 3300049460 Bacteria 119566
537 Ga0501031_0008283 3300049568 Bacteria 6763
538 Ga0501033_0035157 3300049570 Bacteria 3757
539 Ga0501034_0034043 3300049571 Bacteria 5166
540 Ga0501034_0061768 3300049571 Bacteria 3762
541 Ga0501034_0353108 3300049571 Bacteria 1398
542 Ga0501036_0007032 3300049572 Bacteria 9159
543 Ga0501036_0261503 3300049572 Bacteria 1450
544 Ga0501037_0044410 3300049573 Bacteria 3263
545 Ga0501038_0036326 3300049574 Bacteria 4324
546 Ga0501039_0004929 3300049575 Bacteria 10116
547 Ga0501042_0009819 3300049578 Bacteria 6392
548 Ga0501043_0031701 3300049579 Bacteria 4155
549 Ga0501043_0100256 3300049579 Bacteria 2276
550 Ga0501046_0026522 3300049580 Bacteria 4732
551 Ga0501046_0075858 3300049580 Bacteria 2606
552 Ga0501047_0022882 3300049581 Bacteria 6000
553 Ga0501047_0026490 3300049581 Bacteria 5578
554 Ga0501047_0035890 3300049581 Bacteria 4790
555 Ga0501047_0141092 3300049581 Bacteria 2288
556 Ga0501048_0011040 3300049582 Bacteria 6737
557 Ga0501048_0120648 3300049582 Bacteria 1853
558 Ga0501048_0136447 3300049582 Bacteria 1734
559 Ga0501067_0017817 3300049583 Bacteria 3932
560 Ga0501068_0014288 3300049584 Bacteria 4537
561 Ga0501069_0003607 3300049585 Bacteria 7973
562 Ga0501070_0009246 3300049586 Bacteria 8334
563 Ga0501070_0031238 3300049586 Bacteria 4461
564 Ga0501071_0005171 3300049587 Bacteria 8359
565 Ga0501073_0030681 3300049589 Bacteria 3837
566 Ga0501073_0064692 3300049589 Bacteria 2551
567 Ga0501074_0033881 3300049590 Bacteria 3702
568 Ga0501075_0020575 3300049591 Bacteria 4803
569 Ga0501075_0191847 3300049591 Bacteria 1558
570 Ga0501076_0116236 3300049592 Bacteria 2165
571 Ga0501080_0021527 3300049742 Bacteria 5967
572 Ga0501080_0108231 3300049742 Bacteria 2576
573 Ga0501035_0006037 3300049822 Bacteria 11406
574 Ga0501035_0047008 3300049822 Bacteria 3878
575 Ga0501035_0106992 3300049822 Bacteria 2451
576 Ga0501044_0001075 3300049823 Bacteria 32629
577 Ga0501044_0031696 3300049823 Bacteria 5561
578 Ga0501044_0091168 3300049823 Bacteria 3074
579 Ga0501044_0200262 3300049823 Bacteria 1955
580 Ga0501045_0068939 3300049824 Bacteria 2599
581 nmdc:mga03683_23300_c1 3300050489 Bacteria 2410
582 nmdc:mga00v17_174007_c1 3300050491 Bacteria 1389
583 nmdc:mga00v17_238657_c1 3300050491 Unclassified 1178
584 nmdc:mga0yw44_48392_c1 3300050492 Bacteria 2564
585 nmdc:mga05p37_30389_c1 3300050507 Bacteria 6592
586 nmdc:mga05p37_376056_c1 3300050507 Bacteria 1666
587 nmdc:mga05p37_6334_c1 3300050507 Bacteria 13942
588 nmdc:mga05p37_8357_c1 3300050507 Bacteria 12239
589 nmdc:mga0qj67_133568_c1 3300050509 Unclassified 2010
590 nmdc:mga0qj67_159332_c1 3300050509 Bacteria 1832
591 nmdc:mga0qj67_219_c1 3300050509 Bacteria 39116
592 nmdc:mga0qj67_41013_c1 3300050509 Bacteria 3639
593 nmdc:mga0qj67_9429_c1 3300050509 Bacteria 7265
594 nmdc:mga06r32_261579_c1 3300050510 Bacteria 1718
595 nmdc:mga06r32_262829_c1 3300050510 Bacteria 1713
596 nmdc:mga06r32_425649_c1 3300050510 Bacteria 1309
597 nmdc:mga06r32_49881_c1 3300050510 Bacteria 4004
598 nmdc:mga06r32_70479_c1 3300050510 Bacteria 3381
599 nmdc:mga08y16_124561_c1 3300050511 Bacteria 2681
600 nmdc:mga08y16_13621_c1 3300050511 Bacteria 8559
601 nmdc:mga08y16_149381_c1 3300050511 Bacteria 2429
602 nmdc:mga0n895_191851_c1 3300050512 Bacteria 2074
603 nmdc:mga0n895_20991_c1 3300050512 Bacteria 6101
604 nmdc:mga08x19_152868_c1 3300050514 Bacteria 1564
605 nmdc:mga08x19_18010_c1 3300050514 Bacteria 4327
606 nmdc:mga08x19_21779_c1 3300050514 Bacteria 3961
607 nmdc:mga08x19_91009_c1 3300050514 Bacteria 2013
608 nmdc:mga0a205_35063_c1 3300050515 Bacteria 4817
609 nmdc:mga0a205_48119_c1 3300050515 Bacteria 4115
610 Ga0495601_0000001 3300053077 Bacteria 549454
611 Ga0495601_0000793 3300053077 Bacteria 17029
612 Ga0495601_0004550 3300053077 Bacteria 8015
613 Ga0495601_0022818 3300053077 Bacteria 3845
614 Ga0495601_0024726 3300053077 Bacteria 3699
615 Ga0495601_0044075 3300053077 Bacteria 2804
616 Ga0495601_0072626 3300053077 Bacteria 2198
617 Ga0495601_0168465 3300053077 Bacteria 1431
618 Ga0495601_0171857 3300053077 Bacteria 1416
619 Ga0495612_0000003 3300053078 Bacteria 303629
620 Ga0495612_0001305 3300053078 Bacteria 10290
621 Ga0495612_0011350 3300053078 Bacteria 3591
622 Ga0495595_0000082 3300053084 Bacteria 45698
623 Ga0495595_0001074 3300053084 Bacteria 10575
624 Ga0495595_0030560 3300053084 Bacteria 2417
625 Ga0495619_0000004 3300053085 Bacteria 500068
626 Ga0495619_0003873 3300053085 Bacteria 9617
627 Ga0495619_0087714 3300053085 Bacteria 2104
628 Ga0500641_0022153 3300053096 Bacteria 2430
629 Ga0500597_057881 3300053120 Bacteria 1662
630 Ga0500568_0000318 3300053139 Bacteria 38449
631 Ga0500616_0000199 3300053153 Bacteria 97974
632 Ga0500616_0038345 3300053153 Bacteria 2589
633 Ga0500619_000044 3300053154 Bacteria 38579
634 Ga0500622_0033154 3300053156 Bacteria 2708
635 Ga0501082_0007928 3300060353 Bacteria 9174
636 Ga0501082_0012546 3300060353 Bacteria 7281
637 Ga0501082_0044935 3300060353 Bacteria 3810
638 Ga0501082_0152576 3300060353 Bacteria 2007
639 Ga0530510_0095183 3300061734 Bacteria 2175
640 2585269774 2582581306 Bacteria 6450535
641 2585391100 2582581865 Bacteria 6644329
642 2838079102 2838074704 Bacteria 6785777
643 2895515066 2895511927 Bacteria 6802080
644 2896385764 2896384573 Bacteria 7700774
645 2904582457 2904578770 Bacteria 5302906
646 2919123936 2919119836 Bacteria 5208557
647 2920766435 2920760137 Bacteria 7427611
648 3005414024 3005409236 Bacteria 7188837
649 nmdc:mga0n895_87995_c1
650 JGI24752J21851_1003612
651 JGI24743J22301_10000159
652 JGI24744J21845_10000795
653 JGI24742J22300_10001783
654 JGI24751J29686_10002740
655 JGI25152J39213_1009813
656 JGI25153J46596_10002792
657 Ga0065165_1019615
658 Ga0070683_100159986
659 Ga0070690_100007850
660 Ga0070670_100013972
661 Ga0070670_100036467
662 Ga0068869_100050057
663 Ga0070680_100013163
664 Ga0070680_100175198
665 Ga0070660_100012525
666 Ga0070689_100035798
667 Ga0070689_100143041
668 Ga0070668_100162218
669 Ga0070669_100054628
670 Ga0070675_100092898
671 Ga0070675_100234251
672 Ga0070673_100016556
673 Ga0070673_100143549
674 Ga0070673_100145436
675 Ga0070688_100018126
676 Ga0070659_100046603
677 Ga0070667_100151364
678 Ga0070709_10140888
679 Ga0070714_100001040
680 Ga0070714_100073781
681 Ga0070714_100139194
682 Ga0070713_100250168
683 Ga0070700_100050815
684 Ga0070694_100101960
685 Ga0070678_100039527
686 Ga0070681_10012437
687 Ga0070681_10018639
688 Ga0070681_10204786
689 Ga0068867_100005981
690 Ga0070685_10002466
691 Ga0070698_100300350
692 Ga0070699_100045664
693 Ga0070679_100010328
694 Ga0070679_100032746
695 Ga0070679_100058893
696 Ga0070679_100064816
697 Ga0070679_100066981
698 Ga0070679_100071445
699 Ga0070679_100100568
700 Ga0070672_100129921
701 Ga0070686_100023126
702 Ga0070665_100114831
703 Ga0070704_100257993
704 Ga0070664_100045169
705 Ga0070664_100150933
706 Ga0068857_100057232
707 Ga0068857_100088754
708 Ga0068852_100169091
709 Ga0068859_100088326
710 Ga0068864_100009445
711 Ga0068864_100036947
712 Ga0068861_100052466
713 Ga0068870_10075363
714 Ga0068863_100057518
715 Ga0068863_100142918
716 Ga0068858_100080572
717 Ga0068862_100065141
718 Ga0081455_10007292
719 Ga0081455_10018166
720 Ga0081455_10019160
721 Ga0081455_10047260
722 Ga0081538_10017857
723 Ga0081538_10022560
724 Ga0081538_10030614
725 Ga0081540_1000612
726 Ga0081540_1005942
727 Ga0081540_1056634
728 Ga0081539_10026447
729 Ga0081539_10063009
730 Ga0075365_10069576
731 Ga0075364_10208723
732 Ga0070715_10003603
733 Ga0070716_100017847
734 Ga0070712_100000210
735 Ga0070712_100061039
736 Ga0070712_100106326
737 Ga0070712_100117168
738 Ga0075366_10035133
739 Ga0075366_10056722
740 Ga0097621_100327409
741 Ga0075428_100018890
742 Ga0075428_100076117
743 Ga0075428_100237516
744 Ga0075430_100000255
745 Ga0075430_100020485
746 Ga0075430_100033565
747 Ga0075430_100041039
748 Ga0075430_100067950
749 Ga0075430_100117998
750 Ga0075431_100049539
751 Ga0075431_100078422
752 Ga0075431_100216872
753 Ga0075433_10033611
754 Ga0075433_10050963
755 Ga0075434_100064866
756 Ga0075434_100176744
757 Ga0075436_100008134
758 Ga0075436_100009792
759 Ga0097620_100088327
760 Ga0099794_10002449
761 Ga0099794_10003432
762 Ga0099795_10002310
763 Ga0099795_10019898
764 Ga0099795_10055394
765 Ga0105250_10017133
766 Ga0105240_10007001
767 Ga0105240_10007390
768 Ga0105240_10062723
769 Ga0111539_10121738
770 Ga0111539_10152990
771 Ga0111539_10187164
772 Ga0111539_10233313
773 Ga0111539_10349793
774 Ga0105245_10033559
775 Ga0114129_10019015
776 Ga0114129_10019114
777 Ga0114129_10087403
778 Ga0114129_10253130
779 Ga0114129_10502562
780 Ga0105241_10247043
781 Ga0105242_10080116
782 Ga0105248_10055746
783 Ga0105237_10000625
784 Ga0105249_10016632
785 Ga0099796_10001655
786 Ga0099796_10005380
787 Ga0099796_10017929
788 Ga0099796_10056706
789 Ga0105239_10000051
790 Ga0157371_10042548
791 Ga0157374_10110060
792 Ga0163162_10029264
793 Ga0157375_10160635
794 Ga0163163_10013076
795 Ga0157380_10045808
796 Ga0157377_10006770
797 Ga0157379_10005269
798 Ga0157376_10037586
799 Ga0213876_10036260
800 Ga0213875_10000153
801 Ga0224572_1000751
802 Ga0228598_1002054
803 Ga0209129_1000209
804 Ga0209233_1006308
805 Ga0209025_1000878
806 Ga0209758_1000760
807 Ga0207697_10060806
808 Ga0207692_10042661
809 Ga0207688_10000274
810 Ga0207645_10071599
811 Ga0207684_10150528
812 Ga0207707_10050583
813 Ga0207707_10129301
814 Ga0207707_10176028
815 Ga0207695_10005372
816 Ga0207695_10049993
817 Ga0207671_10004734
818 Ga0207693_10002396
819 Ga0207693_10011810
820 Ga0207693_10057651
821 Ga0207693_10099662
822 Ga0207693_10218976
823 Ga0207663_10015238
824 Ga0207660_10009542
825 Ga0207657_10029015
826 Ga0207652_10010202
827 Ga0207652_10026074
828 Ga0207652_10030096
829 Ga0207652_10034112
830 Ga0207652_10054688
831 Ga0207652_10107113
832 Ga0207646_10202304
833 Ga0207650_10007377
834 Ga0207687_10024241
835 Ga0207700_10226009
836 Ga0207664_10000657
837 Ga0207709_10044087
838 Ga0207670_10001077
839 Ga0207669_10004872
840 Ga0207669_10013450
841 Ga0207665_10002138
842 Ga0207665_10072624
843 Ga0207691_10001917
844 Ga0207691_10123542
845 Ga0207711_10058631
846 Ga0207689_10019992
847 Ga0207661_10134090
848 Ga0207679_10121935
849 Ga0207651_10038481
850 Ga0207651_10060211
851 Ga0207651_10086911
852 Ga0207651_10145606
853 Ga0207712_10280676
854 Ga0207668_10072994
855 Ga0207658_10037695
856 Ga0207703_10004180
857 Ga0207639_10051879
858 Ga0207678_10014823
859 Ga0207708_10002274
860 Ga0207641_10006517
861 Ga0207641_10074708
862 Ga0207648_10010742
863 Ga0207648_10175322
864 Ga0207676_10003488
865 Ga0207674_10061137
866 Ga0207675_100005913
867 Ga0207683_10119999
868 Ga0207698_10061762
869 Ga0207428_10054538
870 Ga0268266_10041495
871 Ga0268266_10266096
872 Ga0265337_1002189
873 Ga0265337_1003078
874 Ga0265334_10000940
875 Ga0265338_10002492
876 Ga0265338_10003861
877 Ga0265338_10024214
878 Ga0265773_1000387
879 Ga0265325_10000031
880 Ga0265325_10035756
881 Ga0265325_10054085
882 Ga0265340_10003001
883 Ga0265339_10000096
884 Ga0265339_10002413
885 Ga0265313_10000024
886 Ga0265313_10000661
887 Ga0265314_10015140
888 Ga0265342_10000354
889 Ga0265342_10019956
890 Ga0307409_100076665
891 Ga0373934_0001525
892 Ga0373949_0027376
893 Ga0373923_0005525
894 Ga0373923_0079794
895 Ga0373932_0007889
896 Ga0373936_0010979
897 Ga0373936_0015461
898 Ga0373945_0001308
899 Ga0373945_0002210
900 Ga0373945_0026847
901 Ga0373953_0001573
902 Ga0373953_0025971
903 Ga0373954_0001648
904 Ga0373954_0001781
905 Ga0373954_0036732
906 Ga0373954_0040347
907 Ga0373956_0000078
908 Ga0373956_0027810
909 Ga0373956_0096327
910 Ga0373957_0002055
911 Ga0373957_0054584
912 Ga0373943_0000233
913 Ga0373943_0007312
914 Ga0373943_0035727
915 Ga0373946_0000049
916 Ga0373946_0000677
917 Ga0373946_0011505
918 Ga0373946_0030018
919 Ga0373946_0062614
920 Ga0373955_0000227
921 Ga0373955_0001483
922 Ga0373955_0014250
923 Ga0373955_0052375
924 Ga0373955_0093820
925 Ga0373924_0009827
926 Ga0373924_0012308
927 Ga0373924_0022644
928 Ga0373924_0032019
929 Ga0373931_0001819
930 Ga0373931_0003497
931 Ga0373931_0063646
932 Ga0373931_0073540
933 Ga0373935_0000466
934 Ga0373935_0001083
935 Ga0373935_0002492
936 Ga0373935_0029753
937 Ga0373935_0041307
938 Ga0373935_0065624
939 Ga0373927_0000113
940 Ga0373927_0010893
941 Ga0373927_0016279
942 Ga0373927_0091102
943 Ga0373933_0000380
944 Ga0373933_0006695
945 Ga0373933_0015019
946 Ga0373947_0000168
947 Ga0373947_0006997
948 Ga0373947_0014906
949 Ga0373947_0019503
950 Ga0373947_0030965
951 Ga0373947_0083621
952 Ga0373947_0092780
953 Ga0373947_0126382
954 Ga0373937_0000079
955 Ga0373937_0000480
956 Ga0373937_0004515
957 Ga0373937_0017436
958 Ga0373937_0043790
959 Ga0373937_0077608
960 Ga0373937_0402118
961 Ga0373925_0000007
962 Ga0373925_0003256
963 Ga0373925_0015131
964 Ga0373925_0079467
965 Ga0373925_0079537
966 Ga0373925_0116635
967 Ga0373925_0237982
968 Ga0373925_0241786
969 Ga0395899_0007318
970 Ga0395900_0002874
971 Ga0395900_0069811
972 Ga0395898_0004719
973 Ga0395898_0214223
974 Ga0395905_0001763
975 Ga0436364_0042559
976 Ga0436364_0535844
977 Ga0436364_0953684
978 Ga0436364_1030070
979 Ga0395901_0049175
980 Ga0436365_0406577
981 Ga0436365_1492121
982 Ga0436365_1811122
983 Ga0436360_0084426
984 Ga0436360_0571589
985 Ga0436361_0757040
986 Ga0436363_0200606
987 Ga0436363_0211846
988 Ga0436363_1293510
989 Ga0451851_1113993
990 Ga0466966_0030005
991 Ga0466963_0020577
992 Ga0466963_0063167
993 Ga0466957_0031269
994 Ga0466959_0026245
995 Ga0466958_0039367
996 Ga0466967_0276757
997 Ga0495592_0000254
998 Ga0495592_0003313
999 Ga0495592_0009882
1000 Ga0495592_0045287
1001 Ga0495592_0216793
1002 Ga0495603_0013221
1003 Ga0495603_0138011
1004 Ga0495629_0007735
1005 Ga0495629_0050671
1006 Ga0495629_0061523
1007 Ga0495629_0216676
1008 Ga0495638_0000035
1009 Ga0495641_0006762
1010 Ga0495651_0009915
1011 Ga0495651_0025486
1012 Ga0495653_0000034
1013 Ga0495653_0006362
1014 Ga0495580_0046525
1015 Ga0495582_0015890
1016 Ga0495582_0026837
1017 Ga0495582_0132617
1018 Ga0495662_0000223
1019 Ga0495662_0010258
1020 Ga0495662_0011695
1021 Ga0495664_0000003
1022 Ga0495664_0002068
1023 Ga0495664_0025239
1024 Ga0495584_0100600
1025 Ga0495594_0021796
1026 Ga0495594_0044534
1027 Ga0495596_0011612
1028 Ga0495606_0002285
1029 Ga0495608_0000319
1030 Ga0495618_0000018
1031 Ga0495618_0050255
1032 Ga0495628_0000001
1033 Ga0495628_0024524
1034 Ga0495628_0142357
1035 Ga0495628_0228424
1036 Ga0495630_0005195
1037 Ga0495630_0008347
1038 Ga0495630_0043787
1039 Ga0495630_0203394
1040 Ga0495630_0271041
1041 Ga0495648_0021176
1042 Ga0495666_0006389
1043 Ga0495652_0000006
1044 Ga0495652_0083703
1045 Ga0495665_0011336
1046 Ga0495665_0013487
1047 Ga0495665_0014654
1048 Ga0495665_0037290
1049 Ga0495665_0041080
1050 Ga0495640_0000002
1051 Ga0495640_0003289
1052 Ga0495640_0005316
1053 Ga0495640_0012138
1054 Ga0495640_0027493
1055 Ga0495640_0055729
1056 Ga0495586_0041189
1057 Ga0495586_0084015
1058 Ga0495586_0117616
1059 Ga0495587_0000001
1060 Ga0495587_0041776
1061 Ga0495598_0029866
1062 Ga0495645_0000009
1063 Ga0495645_0000372
1064 Ga0495645_0024699
1065 Ga0495667_0000004
1066 Ga0495667_0014228
1067 Ga0495667_0079151
1068 Ga0495668_0137461
1069 Ga0495634_0000014
1070 Ga0495634_0004200
1071 Ga0495634_0012436
1072 Ga0495634_0026333
1073 Ga0495634_0114932
1074 Ga0495635_0000001
1075 Ga0495635_0095154
1076 Ga0495659_0000447
1077 Ga0495657_0000336
1078 Ga0495657_0006506
1079 Ga0495599_0000053
1080 Ga0495599_0000856
1081 Ga0495599_0033974
1082 Ga0495623_0000091
1083 Ga0495646_0000020
1084 Ga0495647_0001007
1085 Ga0495647_0018367
1086 Ga0495658_0037797
1087 Ga0495613_0112455
1088 Ga0495624_0001118
1089 Ga0495624_0034881
1090 Ga0495624_0085722
1091 Ga0495600_0000123
1092 Ga0495600_0005818
1093 Ga0495581_0027319
1094 Ga0495581_0037619
1095 Ga0495581_0054801
1096 Ga0495604_0000008
1097 Ga0495636_0009867
1098 Ga0495674_0000016
1099 Ga0495674_0021520
1100 Ga0495674_0162659
1101 Ga0495674_0207291
1102 Ga0495672_0022226
1103 Ga0495672_0032009
1104 Ga0495676_0072619
1105 Ga0495676_0139877
1106 Ga0495680_0001791
1107 Ga0495680_0014696
1108 Ga0495680_0095054
1109 Ga0495675_0000745
1110 Ga0495675_0026811
1111 Ga0495684_0000002
1112 Ga0495684_0000928
1113 Ga0495684_0001824
1114 Ga0495684_0004590
1115 Ga0495684_0004954
1116 Ga0495684_0052884
1117 Ga0495593_0002527
1118 Ga0495593_0043232
1119 Ga0495593_0125959
1120 Ga0495602_0000022
1121 Ga0496100_0004563
1122 Ga0496100_0035286
1123 Ga0496101_0002221
1124 Ga0496101_0008127
1125 Ga0496101_0029602
1126 Ga0496101_0108194
1127 Ga0496102_0026593
1128 Ga0496102_0035431
1129 Ga0496102_0129230
1130 Ga0496102_0201567
1131 Ga0496103_0008195
1132 Ga0496104_0000609
1133 Ga0496104_0001668
1134 Ga0496104_0003575
1135 Ga0496104_0042531
1136 Ga0496104_0207023
1137 Ga0496104_0221458
1138 Ga0496105_0001278
1139 Ga0496105_0003662
1140 Ga0496105_0008016
1141 Ga0496105_0010336
1142 Ga0496106_0000002
1143 Ga0496106_0001992
1144 Ga0496106_0014955
1145 Ga0496106_0037943
1146 Ga0496106_0148574
1147 Ga0496107_0002763
1148 Ga0496108_0000510
1149 Ga0496108_0056718
1150 Ga0496108_0106257
1151 Ga0496108_0118705
1152 Ga0496109_0003609
1153 Ga0496109_0060654
1154 Ga0496109_0071208
1155 Ga0496110_0044262
1156 Ga0496110_0045372
1157 Ga0496110_0236749
1158 Ga0496111_0001147
1159 Ga0496111_0021137
1160 Ga0496112_0000320
1161 Ga0496112_0017770
1162 Ga0496112_0230052
1163 Ga0496112_0283231
1164 Ga0496113_0001355
1165 Ga0496113_0017894
1166 Ga0496113_0095511
1167 Ga0496114_0004710
1168 Ga0496114_0185379
1169 Ga0496114_0233760
1170 Ga0496115_0005695
1171 Ga0496115_0013034
1172 Ga0496115_0014471
1173 Ga0496115_0017959
1174 Ga0496115_0025376
1175 Ga0496115_0025929
1176 Ga0496117_0034301
1177 Ga0496121_0000656
1178 Ga0496121_0002262
1179 Ga0496121_0010417
1180 Ga0496121_0034947
1181 Ga0496121_0082266
1182 Ga0496121_0193435
1183 Ga0496126_0014765
1184 Ga0495682_0000040
1185 Ga0501031_0008283
1186 Ga0501033_0035157
1187 Ga0501034_0034043
1188 Ga0501034_0061768
1189 Ga0501034_0353108
1190 Ga0501036_0007032
1191 Ga0501036_0261503
1192 Ga0501037_0044410
1193 Ga0501038_0036326
1194 Ga0501039_0004929
1195 Ga0501042_0009819
1196 Ga0501043_0031701
1197 Ga0501043_0100256
1198 Ga0501046_0026522
1199 Ga0501046_0075858
1200 Ga0501047_0022882
1201 Ga0501047_0026490
1202 Ga0501047_0035890
1203 Ga0501047_0141092
1204 Ga0501048_0011040
1205 Ga0501048_0120648
1206 Ga0501048_0136447
1207 Ga0501067_0017817
1208 Ga0501068_0014288
1209 Ga0501069_0003607
1210 Ga0501070_0009246
1211 Ga0501070_0031238
1212 Ga0501071_0005171
1213 Ga0501073_0030681
1214 Ga0501073_0064692
1215 Ga0501074_0033881
1216 Ga0501075_0020575
1217 Ga0501075_0191847
1218 Ga0501076_0116236
1219 Ga0501080_0021527
1220 Ga0501080_0108231
1221 Ga0501035_0006037
1222 Ga0501035_0047008
1223 Ga0501035_0106992
1224 Ga0501044_0001075
1225 Ga0501044_0031696
1226 Ga0501044_0091168
1227 Ga0501044_0200262
1228 Ga0501045_0068939
1229 nmdc:mga03683_23300_c1
1230 nmdc:mga00v17_174007_c1
1231 nmdc:mga00v17_238657_c1
1232 nmdc:mga0yw44_48392_c1
1233 nmdc:mga05p37_30389_c1
1234 nmdc:mga05p37_376056_c1
1235 nmdc:mga05p37_6334_c1
1236 nmdc:mga05p37_8357_c1
1237 nmdc:mga0qj67_133568_c1
1238 nmdc:mga0qj67_159332_c1
1239 nmdc:mga0qj67_219_c1
1240 nmdc:mga0qj67_41013_c1
1241 nmdc:mga0qj67_9429_c1
1242 nmdc:mga06r32_261579_c1
1243 nmdc:mga06r32_262829_c1
1244 nmdc:mga06r32_425649_c1
1245 nmdc:mga06r32_49881_c1
1246 nmdc:mga06r32_70479_c1
1247 nmdc:mga08y16_124561_c1
1248 nmdc:mga08y16_13621_c1
1249 nmdc:mga08y16_149381_c1
1250 nmdc:mga0n895_191851_c1
1251 nmdc:mga0n895_20991_c1
1252 nmdc:mga08x19_152868_c1
1253 nmdc:mga08x19_18010_c1
1254 nmdc:mga08x19_21779_c1
1255 nmdc:mga08x19_91009_c1
1256 nmdc:mga0a205_35063_c1
1257 nmdc:mga0a205_48119_c1
1258 Ga0495601_0000001
1259 Ga0495601_0000793
1260 Ga0495601_0004550
1261 Ga0495601_0022818
1262 Ga0495601_0024726
1263 Ga0495601_0044075
1264 Ga0495601_0072626
1265 Ga0495601_0168465
1266 Ga0495601_0171857
1267 Ga0495612_0000003
1268 Ga0495612_0001305
1269 Ga0495612_0011350
1270 Ga0495595_0000082
1271 Ga0495595_0001074
1272 Ga0495595_0030560
1273 Ga0495619_0000004
1274 Ga0495619_0003873
1275 Ga0495619_0087714
1276 Ga0500641_0022153
1277 Ga0500597_057881
1278 Ga0500568_0000318
1279 Ga0500616_0000199
1280 Ga0500616_0038345
1281 Ga0500619_000044
1282 Ga0500622_0033154
1283 Ga0501082_0007928
1284 Ga0501082_0012546
1285 Ga0501082_0044935
1286 Ga0501082_0152576
1287 Ga0530510_0095183
1288 2585269774
1289 2585391100
1290 2838079102
1291 2895515066
1292 2896385764
1293 2904582457
1294 2919123936
1295 2920766435
1296 3005414024

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

120

193

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
5uqp-assembly1.cif.gz_B the crystal structure of cupin protein from rhodococcus jostii rha1 0.9066 77 156
2et1-assembly1.cif.gz_A oxalate oxidase in complex with substrate analogue glycolate 0.8869 77 160
2et7-assembly1.cif.gz_A structural and spectroscopic insights into the mechanism of oxalate oxidase 0.8856 77 160
6orm-assembly1.cif.gz_A crystal structure of peruvianin-i (cysteine peptidase from thevetia peruviana latex) 0.885 77 160
2ete-assembly1.cif.gz_A recombinant oxalate oxidase in complex with glycolate 0.8835 77 160
ID Description Score Start End Superfamily
af_Q9LUJ7_61_262_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.915 75 156 2.60.120.10
af_Q9S772_37_227_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9032 77 157 2.60.120.10
af_Q7M1Z8_21_213_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8983 78 157 2.60.120.10
af_P93000_22_217_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8978 77 159 2.60.120.10
af_Q94JF3_29_224_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8945 77 159 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A535B1R2-F1-model_v4 Cupin domain-containing protein 0.9796 28 163
AF-A0A351T053-F1-model_v4 Ethanolamine ammonia lyase-activating protein 0.9747 28 180 GO:0016829
AF-A0A536W6I9-F1-model_v4 Cupin domain-containing protein 0.9614 26 173
AF-A0A1F9A578-F1-model_v4 Cupin 0.9344 50 303
AF-A0A816A662-F1-model_v4 Uncharacterized protein 0.9328 79 157

Map