F475613

General Info

Members Datasets Scaffolds Average Seq Length
692 256 1384 82

Family's Representative Sequence

Representative Sequence 3300050512|nmdc:mga0n895_1313229_c1|nmdc:mga0n895_1313229_c1_402_668
Length 88
Sequence MFVPMKARVHVSFKSTVLDPQGQTVRSALQSLGYGTVADVRQGKYFDITLDSTTREQAQKDIEAIAHDVLTNPVIEEYKVEFLDESKP

Samples

Sample ID Description Type Environment
1 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
68 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
69 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
107 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
108 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
109 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
110 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
167 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
168 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
170 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
171 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
172 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
173 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
174 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
175 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
176 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
177 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
178 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
179 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
180 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
181 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
182 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
183 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
184 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
185 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
186 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
187 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
188 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
189 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
190 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
191 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
192 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
193 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
194 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
195 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
196 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
197 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
198 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
199 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
200 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
201 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
202 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
203 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
204 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
205 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
206 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
207 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
208 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
209 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
210 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
211 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
212 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
213 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
214 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
215 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
216 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
217 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
218 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
219 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
220 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
221 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
222 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
223 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
224 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
225 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
226 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
227 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
228 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
229 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
230 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
231 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
232 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
233 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
234 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
235 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
236 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
237 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
238 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
239 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
240 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
241 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
242 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
243 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
244 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
245 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
246 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
247 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
248 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
249 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
250 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
251 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
252 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
253 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
254 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
255 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
256 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.57
Metatranscriptomes 0.43
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.14
Nodule 0
Rhizoplane 0.87
Rhizosphere 98.41
Stem 0
Stem Tuber 0
Unclassified 13.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0n895_1313229_c1 3300050512 Bacteria 694
2 Ga0065712_10654216 3300005290 Bacteria 566
3 Ga0065707_10339735 3300005295 Unclassified 935
4 Ga0070676_11147366 3300005328 Bacteria 589
5 Ga0070683_100007135 3300005329 Bacteria 9414
6 Ga0070683_100017554 3300005329 Bacteria 6326
7 Ga0070683_100086830 3300005329 Bacteria 2933
8 Ga0070683_100097096 3300005329 Bacteria 2771
9 Ga0070683_100122177 3300005329 Bacteria 2461
10 Ga0070683_100340426 3300005329 Bacteria 1428
11 Ga0070690_100437524 3300005330 Bacteria 967
12 Ga0070690_100500324 3300005330 Bacteria 909
13 Ga0070670_100750937 3300005331 Bacteria 879
14 Ga0068869_100025293 3300005334 Bacteria 4121
15 Ga0068869_100876533 3300005334 Bacteria 776
16 Ga0068869_101294797 3300005334 Bacteria 643
17 Ga0070666_11015343 3300005335 Bacteria 615
18 Ga0070680_100027905 3300005336 Bacteria 4524
19 Ga0070680_100312096 3300005336 Bacteria 1334
20 Ga0070680_100838733 3300005336 Unclassified 792
21 Ga0070680_101246700 3300005336 Unclassified 643
22 Ga0070682_100185392 3300005337 Bacteria 1457
23 Ga0068868_100423834 3300005338 Bacteria 1153
24 Ga0068868_100528852 3300005338 Bacteria 1036
25 Ga0070660_100138382 3300005339 Bacteria 1952
26 Ga0070689_100444697 3300005340 Bacteria 1102
27 Ga0070691_10002783 3300005341 Bacteria 7802
28 Ga0070687_100771352 3300005343 Unclassified 678
29 Ga0070661_100895822 3300005344 Bacteria 732
30 Ga0070692_10153095 3300005345 Bacteria 1315
31 Ga0070669_100197521 3300005353 Bacteria 1581
32 Ga0070669_100227085 3300005353 Unclassified 1478
33 Ga0070671_100114221 3300005355 Bacteria 2270
34 Ga0070671_101362999 3300005355 Bacteria 626
35 Ga0070671_101888220 3300005355 Unclassified 531
36 Ga0070673_100436597 3300005364 Bacteria 1176
37 Ga0070673_101417154 3300005364 Bacteria 654
38 Ga0070688_100875160 3300005365 Bacteria 707
39 Ga0070659_100268159 3300005366 Bacteria 1418
40 Ga0070667_100627203 3300005367 Bacteria 991
41 Ga0070667_100690221 3300005367 Unclassified 944
42 Ga0070667_100956585 3300005367 Bacteria 798
43 Ga0070709_10024059 3300005434 Bacteria 3583
44 Ga0070709_10314756 3300005434 Bacteria 1147
45 Ga0070709_10438201 3300005434 Bacteria 982
46 Ga0070709_11093675 3300005434 Bacteria 637
47 Ga0070714_100369553 3300005435 Bacteria 1350
48 Ga0070713_100023291 3300005436 Bacteria 4802
49 Ga0070713_100278727 3300005436 Unclassified 1533
50 Ga0070713_101407424 3300005436 Bacteria 676
51 Ga0070710_10386950 3300005437 Bacteria 934
52 Ga0070710_10522498 3300005437 Bacteria 816
53 Ga0070710_10666185 3300005437 Unclassified 731
54 Ga0070711_100306698 3300005439 Bacteria 1264
55 Ga0070711_101817671 3300005439 Bacteria 535
56 Ga0070705_100778042 3300005440 Bacteria 759
57 Ga0070705_100931029 3300005440 Bacteria 701
58 Ga0070705_101751707 3300005440 Unclassified 526
59 Ga0070700_100478513 3300005441 Bacteria 953
60 Ga0070694_100758746 3300005444 Bacteria 793
61 Ga0070708_100302492 3300005445 Bacteria 1506
62 Ga0070708_102035778 3300005445 Unclassified 531
63 Ga0070678_100217094 3300005456 Bacteria 1588
64 Ga0070678_101065618 3300005456 Bacteria 745
65 Ga0070662_100904218 3300005457 Bacteria 753
66 Ga0070681_10001506 3300005458 Bacteria 20626
67 Ga0070681_10021181 3300005458 Bacteria 6514
68 Ga0070681_10040260 3300005458 Bacteria 4683
69 Ga0070681_10115307 3300005458 Bacteria 2625
70 Ga0070681_10580392 3300005458 Bacteria 1035
71 Ga0070681_10675944 3300005458 Bacteria 948
72 Ga0068867_100167830 3300005459 Bacteria 1736
73 Ga0068867_100363081 3300005459 Bacteria 1212
74 Ga0068867_100769226 3300005459 Bacteria 856
75 Ga0070685_10343128 3300005466 Bacteria 1019
76 Ga0070706_100140015 3300005467 Bacteria 2258
77 Ga0070706_101626280 3300005467 Bacteria 589
78 Ga0070707_100645508 3300005468 Bacteria 1021
79 Ga0070707_102168297 3300005468 Bacteria 523
80 Ga0070698_100489269 3300005471 Bacteria 1168
81 Ga0070698_102103489 3300005471 Bacteria 518
82 Ga0070699_100076626 3300005518 Bacteria 2911
83 Ga0070679_100007294 3300005530 Bacteria 10325
84 Ga0070679_101022040 3300005530 Bacteria 771
85 Ga0070679_101684162 3300005530 Unclassified 582
86 Ga0070684_100007045 3300005535 Bacteria 8739
87 Ga0070684_100155017 3300005535 Bacteria 2077
88 Ga0070684_100245709 3300005535 Bacteria 1635
89 Ga0070684_100255350 3300005535 Bacteria 1602
90 Ga0070684_100299230 3300005535 Bacteria 1476
91 Ga0070684_100431651 3300005535 Bacteria 1217
92 Ga0070684_101092495 3300005535 Bacteria 749
93 Ga0070697_100045059 3300005536 Bacteria 3574
94 Ga0070697_100192893 3300005536 Bacteria 1730
95 Ga0070697_101445737 3300005536 Bacteria 614
96 Ga0070697_101512351 3300005536 Bacteria 600
97 Ga0068853_100068437 3300005539 Bacteria 3087
98 Ga0068853_101076143 3300005539 Bacteria 775
99 Ga0068853_102182345 3300005539 Unclassified 537
100 Ga0070672_100220962 3300005543 Bacteria 1589
101 Ga0070672_100342569 3300005543 Bacteria 1273
102 Ga0070686_100516403 3300005544 Bacteria 929
103 Ga0070695_100078922 3300005545 Unclassified 2172
104 Ga0070695_100079743 3300005545 Bacteria 2162
105 Ga0070695_100445363 3300005545 Bacteria 991
106 Ga0070696_100002449 3300005546 Bacteria 12308
107 Ga0070696_100573106 3300005546 Bacteria 907
108 Ga0070696_101981523 3300005546 Unclassified 505
109 Ga0070693_100064409 3300005547 Bacteria 2140
110 Ga0070693_100100626 3300005547 Bacteria 1760
111 Ga0070693_100124002 3300005547 Bacteria 1606
112 Ga0070665_100695046 3300005548 Unclassified 1030
113 Ga0070704_100192796 3300005549 Bacteria 1639
114 Ga0070704_100775149 3300005549 Unclassified 855
115 Ga0068855_100065973 3300005563 Bacteria 4220
116 Ga0068855_100145832 3300005563 Unclassified 2695
117 Ga0068855_100216890 3300005563 Bacteria 2148
118 Ga0070664_100638571 3300005564 Bacteria 989
119 Ga0070664_100649824 3300005564 Bacteria 980
120 Ga0070664_101816627 3300005564 Unclassified 578
121 Ga0068857_100000716 3300005577 Bacteria 24726
122 Ga0068857_100007977 3300005577 Bacteria 9139
123 Ga0068854_100181668 3300005578 Bacteria 1644
124 Ga0068854_100518611 3300005578 Bacteria 1006
125 Ga0068856_100000584 3300005614 Bacteria 39905
126 Ga0068856_100140862 3300005614 Bacteria 2419
127 Ga0068856_100159639 3300005614 Bacteria 2265
128 Ga0068856_101122406 3300005614 Bacteria 803
129 Ga0068856_101765361 3300005614 Bacteria 631
130 Ga0068852_100006091 3300005616 Bacteria 8693
131 Ga0068859_100016192 3300005617 Bacteria 7489
132 Ga0068859_101503142 3300005617 Bacteria 743
133 Ga0068859_101949141 3300005617 Bacteria 649
134 Ga0068859_102109246 3300005617 Bacteria 622
135 Ga0068864_100678670 3300005618 Bacteria 1005
136 Ga0068864_101485320 3300005618 Bacteria 680
137 Ga0068866_10441773 3300005718 Bacteria 848
138 Ga0068866_10943434 3300005718 Bacteria 609
139 Ga0068861_100278512 3300005719 Bacteria 1439
140 Ga0068861_102113777 3300005719 Bacteria 563
141 Ga0068863_101145121 3300005841 Bacteria 783
142 Ga0068863_102156244 3300005841 Bacteria 567
143 Ga0068863_102658262 3300005841 Unclassified 509
144 Ga0068858_100044836 3300005842 Bacteria 4098
145 Ga0068858_100096434 3300005842 Bacteria 2756
146 Ga0068858_100204746 3300005842 Bacteria 1867
147 Ga0068858_100279133 3300005842 Bacteria 1591
148 Ga0068858_100718827 3300005842 Bacteria 972
149 Ga0068858_102031139 3300005842 Bacteria 568
150 Ga0068860_100024195 3300005843 Bacteria 5872
151 Ga0068860_100122756 3300005843 Bacteria 2488
152 Ga0068860_100684624 3300005843 Bacteria 1035
153 Ga0068860_100782586 3300005843 Bacteria 967
154 Ga0068860_100912688 3300005843 Bacteria 894
155 Ga0070717_10133509 3300006028 Bacteria 2136
156 Ga0070717_10312356 3300006028 Bacteria 1399
157 Ga0070716_101589560 3300006173 Bacteria 537
158 Ga0070712_100556800 3300006175 Unclassified 967
159 Ga0097621_100244106 3300006237 Bacteria 1571
160 Ga0097621_100266943 3300006237 Bacteria 1503
161 Ga0097621_100396063 3300006237 Bacteria 1236
162 Ga0097621_100416886 3300006237 Bacteria 1205
163 Ga0097621_100425453 3300006237 Bacteria 1192
164 Ga0097621_100501177 3300006237 Bacteria 1100
165 Ga0097621_101901201 3300006237 Unclassified 568
166 Ga0068871_100033247 3300006358 Bacteria 4083
167 Ga0068871_100082392 3300006358 Bacteria 2667
168 Ga0068871_100255290 3300006358 Bacteria 1528
169 Ga0068871_100313951 3300006358 Bacteria 1378
170 Ga0068871_100496422 3300006358 Bacteria 1099
171 Ga0068871_101505931 3300006358 Bacteria 636
172 Ga0075428_101513191 3300006844 Bacteria 703
173 Ga0075430_100028428 3300006846 Bacteria 4751
174 Ga0075431_100007793 3300006847 Bacteria 10665
175 Ga0075431_100013566 3300006847 Bacteria 8237
176 Ga0075433_10568149 3300006852 Unclassified 996
177 Ga0075434_102633211 3300006871 Unclassified 503
178 Ga0075429_100110235 3300006880 Bacteria 2406
179 Ga0068865_100790717 3300006881 Bacteria 818
180 Ga0068865_101172196 3300006881 Bacteria 679
181 Ga0075436_100012053 3300006914 Bacteria 5930
182 Ga0075436_100656892 3300006914 Bacteria 775
183 Ga0075436_100880693 3300006914 Unclassified 669
184 Ga0097620_100016192 3300006931 Bacteria 7489
185 Ga0097620_101502496 3300006931 Bacteria 743
186 Ga0097620_101949228 3300006931 Bacteria 649
187 Ga0097620_102108056 3300006931 Bacteria 622
188 Ga0075435_100157591 3300007076 Bacteria 1911
189 Ga0075435_101095321 3300007076 Unclassified 696
190 Ga0075435_101173684 3300007076 Bacteria 672
191 Ga0105251_10493582 3300009011 Bacteria 571
192 Ga0105240_10031731 3300009093 Bacteria 6846
193 Ga0105240_10035165 3300009093 Bacteria 6459
194 Ga0105240_10093517 3300009093 Bacteria 3669
195 Ga0105240_10111179 3300009093 Bacteria 3315
196 Ga0105240_10326903 3300009093 Bacteria 1746
197 Ga0105240_10507818 3300009093 Unclassified 1339
198 Ga0105240_12652754 3300009093 Bacteria 517
199 Ga0111539_10805708 3300009094 Bacteria 1093
200 Ga0105245_10002670 3300009098 Bacteria 16053
201 Ga0105245_10005954 3300009098 Bacteria 10713
202 Ga0105245_10037336 3300009098 Bacteria 4319
203 Ga0105245_10454026 3300009098 Bacteria 1291
204 Ga0105245_10666649 3300009098 Bacteria 1071
205 Ga0105245_10758057 3300009098 Bacteria 1007
206 Ga0105245_10886085 3300009098 Bacteria 934
207 Ga0105245_11021126 3300009098 Bacteria 872
208 Ga0105245_12041953 3300009098 Bacteria 627
209 Ga0105247_10090348 3300009101 Bacteria 1943
210 Ga0105247_11181889 3300009101 Bacteria 608
211 Ga0105247_11333020 3300009101 Bacteria 578
212 Ga0105247_11660143 3300009101 Unclassified 527
213 Ga0114129_10116654 3300009147 Bacteria 3679
214 Ga0114129_10121220 3300009147 Unclassified 3599
215 Ga0114129_10410666 3300009147 Bacteria 1783
216 Ga0105243_10013344 3300009148 Bacteria 6213
217 Ga0105243_10398268 3300009148 Bacteria 1278
218 Ga0105241_10007182 3300009174 Bacteria 8198
219 Ga0105241_10098922 3300009174 Unclassified 2315
220 Ga0105241_10173312 3300009174 Bacteria 1783
221 Ga0105241_10225637 3300009174 Bacteria 1577
222 Ga0105241_10320640 3300009174 Bacteria 1336
223 Ga0105242_10040268 3300009176 Bacteria 3765
224 Ga0105242_10282570 3300009176 Bacteria 1508
225 Ga0105242_10300646 3300009176 Bacteria 1465
226 Ga0105242_10321273 3300009176 Bacteria 1420
227 Ga0105242_10845591 3300009176 Bacteria 910
228 Ga0105242_12673207 3300009176 Bacteria 549
229 Ga0105242_13321408 3300009176 Unclassified 500
230 Ga0105248_10018601 3300009177 Bacteria 7681
231 Ga0105248_10032605 3300009177 Bacteria 5820
232 Ga0105248_10564474 3300009177 Bacteria 1284
233 Ga0105248_10693651 3300009177 Bacteria 1149
234 Ga0105248_10732278 3300009177 Bacteria 1116
235 Ga0105248_11327569 3300009177 Bacteria 814
236 Ga0105248_12999004 3300009177 Bacteria 538
237 Ga0105248_13284642 3300009177 Bacteria 514
238 Ga0105237_10005182 3300009545 Bacteria 14740
239 Ga0105237_10033554 3300009545 Bacteria 5201
240 Ga0105237_10166206 3300009545 Bacteria 2205
241 Ga0105237_10186104 3300009545 Bacteria 2076
242 Ga0105237_10725425 3300009545 Unclassified 1000
243 Ga0105237_11283072 3300009545 Unclassified 739
244 Ga0105237_11315468 3300009545 Unclassified 729
245 Ga0105237_11654365 3300009545 Bacteria 647
246 Ga0105237_11665667 3300009545 Archaea 645
247 Ga0105237_12235626 3300009545 Bacteria 556
248 Ga0105238_10000959 3300009551 Bacteria 29509
249 Ga0105238_10028606 3300009551 Bacteria 5678
250 Ga0105238_10029874 3300009551 Bacteria 5549
251 Ga0105238_10230386 3300009551 Unclassified 1829
252 Ga0105238_10246065 3300009551 Bacteria 1766
253 Ga0105238_10641039 3300009551 Unclassified 1072
254 Ga0105238_11064845 3300009551 Bacteria 831
255 Ga0105249_10038382 3300009553 Bacteria 4346
256 Ga0105249_10183721 3300009553 Bacteria 2036
257 Ga0105239_10003659 3300010375 Bacteria 18789
258 Ga0105239_10045052 3300010375 Bacteria 4835
259 Ga0105239_10075160 3300010375 Bacteria 3714
260 Ga0105239_10191690 3300010375 Bacteria 2288
261 Ga0105239_10811884 3300010375 Bacteria 1072
262 Ga0105239_11170939 3300010375 Unclassified 886
263 Ga0105239_12381428 3300010375 Unclassified 617
264 Ga0105246_10003902 3300011119 Bacteria 9033
265 Ga0105246_10194265 3300011119 Bacteria 1573
266 Ga0105246_10282282 3300011119 Bacteria 1333
267 Ga0105246_11175621 3300011119 Bacteria 705
268 Ga0157370_10003423 3300013104 Bacteria 18634
269 Ga0157370_10795084 3300013104 Unclassified 861
270 Ga0157370_10906805 3300013104 Unclassified 800
271 Ga0157370_11129948 3300013104 Bacteria 708
272 Ga0157369_10002413 3300013105 Bacteria 22447
273 Ga0157369_10018212 3300013105 Bacteria 7876
274 Ga0157369_10900032 3300013105 Bacteria 907
275 Ga0157369_11074523 3300013105 Bacteria 823
276 Ga0157369_11581073 3300013105 Unclassified 667
277 Ga0157374_10083419 3300013296 Bacteria 3036
278 Ga0157374_10340256 3300013296 Bacteria 1489
279 Ga0157374_11349380 3300013296 Unclassified 735
280 Ga0157374_12025961 3300013296 Unclassified 602
281 Ga0157374_12883227 3300013296 Unclassified 508
282 Ga0157378_10002546 3300013297 Bacteria 16220
283 Ga0157378_10453098 3300013297 Bacteria 1274
284 Ga0157378_10484912 3300013297 Bacteria 1232
285 Ga0157378_11509488 3300013297 Bacteria 717
286 Ga0157378_11944582 3300013297 Unclassified 637
287 Ga0157378_12575043 3300013297 Bacteria 561
288 Ga0163162_11163785 3300013306 Bacteria 875
289 Ga0163162_11290798 3300013306 Bacteria 829
290 Ga0157372_10025251 3300013307 Bacteria 6459
291 Ga0157372_10059006 3300013307 Bacteria 4291
292 Ga0157372_12015464 3300013307 Unclassified 663
293 Ga0157372_12085716 3300013307 Bacteria 651
294 Ga0157372_12324477 3300013307 Bacteria 616
295 Ga0157375_10008895 3300013308 Bacteria 8789
296 Ga0157375_10175888 3300013308 Bacteria 2290
297 Ga0157375_10938071 3300013308 Bacteria 1008
298 Ga0157375_11117946 3300013308 Bacteria 923
299 Ga0157375_12588673 3300013308 Bacteria 606
300 Ga0163163_10008800 3300014325 Bacteria 8985
301 Ga0163163_10597845 3300014325 Bacteria 1166
302 Ga0163163_10837609 3300014325 Bacteria 983
303 Ga0163163_11545419 3300014325 Bacteria 725
304 Ga0163163_12239651 3300014325 Bacteria 605
305 Ga0163163_12421708 3300014325 Bacteria 583
306 Ga0163163_13264567 3300014325 Unclassified 506
307 Ga0157379_10339883 3300014968 Bacteria 1373
308 Ga0157379_10706663 3300014968 Bacteria 946
309 Ga0157379_11697663 3300014968 Bacteria 619
310 Ga0157379_11922465 3300014968 Bacteria 583
311 Ga0157379_12326758 3300014968 Bacteria 534
312 Ga0157376_10259985 3300014969 Bacteria 1626
313 Ga0157376_10333491 3300014969 Bacteria 1446
314 Ga0157376_11256047 3300014969 Bacteria 770
315 Ga0157376_11776081 3300014969 Bacteria 653
316 Ga0157376_11917620 3300014969 Bacteria 629
317 Ga0157376_11989662 3300014969 Bacteria 619
318 Ga0157376_12287913 3300014969 Unclassified 580
319 Ga0182005_1148912 3300015265 Bacteria 680
320 Ga0163161_11513587 3300017792 Unclassified 589
321 Ga0213874_10142642 3300021377 Bacteria 830
322 Ga0207692_11169372 3300025898 Bacteria 510
323 Ga0207642_10284391 3300025899 Bacteria 952
324 Ga0207642_10413808 3300025899 Bacteria 809
325 Ga0207710_10022185 3300025900 Bacteria 2724
326 Ga0207685_10134584 3300025905 Unclassified 1101
327 Ga0207699_10026864 3300025906 Bacteria 3179
328 Ga0207699_10301145 3300025906 Bacteria 1120
329 Ga0207645_10049329 3300025907 Bacteria 2688
330 Ga0207645_11061136 3300025907 Bacteria 547
331 Ga0207684_10115347 3300025910 Bacteria 2301
332 Ga0207684_11603377 3300025910 Unclassified 527
333 Ga0207654_10037467 3300025911 Bacteria 2715
334 Ga0207654_10056664 3300025911 Bacteria 2274
335 Ga0207654_10071491 3300025911 Bacteria 2063
336 Ga0207654_10103316 3300025911 Bacteria 1759
337 Ga0207654_10112904 3300025911 Bacteria 1693
338 Ga0207654_10214620 3300025911 Bacteria 1273
339 Ga0207654_10461781 3300025911 Bacteria 892
340 Ga0207707_10000224 3300025912 Bacteria 60855
341 Ga0207707_10016125 3300025912 Bacteria 6515
342 Ga0207707_10053174 3300025912 Bacteria 3525
343 Ga0207707_10060530 3300025912 Bacteria 3294
344 Ga0207707_10137520 3300025912 Bacteria 2136
345 Ga0207707_10406716 3300025912 Bacteria 1168
346 Ga0207695_10000533 3300025913 Bacteria 79615
347 Ga0207695_10075823 3300025913 Bacteria 3420
348 Ga0207695_10551219 3300025913 Bacteria 1034
349 Ga0207695_10826748 3300025913 Bacteria 806
350 Ga0207695_11176810 3300025913 Unclassified 647
351 Ga0207695_11671350 3300025913 Bacteria 517
352 Ga0207671_10011156 3300025914 Bacteria 7339
353 Ga0207671_10044748 3300025914 Bacteria 3274
354 Ga0207671_10125069 3300025914 Bacteria 1969
355 Ga0207671_10161826 3300025914 Bacteria 1733
356 Ga0207671_10174428 3300025914 Unclassified 1671
357 Ga0207671_10916022 3300025914 Bacteria 693
358 Ga0207671_11331091 3300025914 Unclassified 559
359 Ga0207671_11539975 3300025914 Bacteria 512
360 Ga0207693_10320162 3300025915 Bacteria 1214
361 Ga0207663_10118590 3300025916 Bacteria 1808
362 Ga0207660_10024767 3300025917 Bacteria 4065
363 Ga0207660_10275426 3300025917 Bacteria 1334
364 Ga0207660_11077920 3300025917 Unclassified 655
365 Ga0207660_11580958 3300025917 Unclassified 529
366 Ga0207657_10142219 3300025919 Bacteria 1960
367 Ga0207649_10402307 3300025920 Bacteria 1025
368 Ga0207649_11578603 3300025920 Bacteria 519
369 Ga0207652_10005967 3300025921 Bacteria 9856
370 Ga0207652_10181971 3300025921 Bacteria 1889
371 Ga0207652_10680617 3300025921 Bacteria 919
372 Ga0207646_10556847 3300025922 Bacteria 1031
373 Ga0207681_10229929 3300025923 Bacteria 1439
374 Ga0207681_11231077 3300025923 Bacteria 629
375 Ga0207694_10000545 3300025924 Bacteria 34152
376 Ga0207694_10006193 3300025924 Bacteria 9136
377 Ga0207694_10145060 3300025924 Bacteria 1910
378 Ga0207650_11528018 3300025925 Bacteria 567
379 Ga0207687_10004677 3300025927 Bacteria 9108
380 Ga0207687_10005226 3300025927 Bacteria 8605
381 Ga0207687_10242357 3300025927 Bacteria 1429
382 Ga0207687_10499849 3300025927 Bacteria 1015
383 Ga0207687_10995329 3300025927 Bacteria 719
384 Ga0207687_11004778 3300025927 Bacteria 715
385 Ga0207700_10014023 3300025928 Bacteria 5238
386 Ga0207664_11591317 3300025929 Bacteria 575
387 Ga0207644_10091367 3300025931 Bacteria 2270
388 Ga0207644_11417554 3300025931 Bacteria 583
389 Ga0207644_11804335 3300025931 Unclassified 512
390 Ga0207690_10537194 3300025932 Bacteria 949
391 Ga0207706_10381587 3300025933 Bacteria 1223
392 Ga0207686_10021344 3300025934 Bacteria 3716
393 Ga0207686_10061420 3300025934 Bacteria 2382
394 Ga0207686_11586084 3300025934 Bacteria 540
395 Ga0207709_10088202 3300025935 Bacteria 2019
396 Ga0207709_10222568 3300025935 Bacteria 1362
397 Ga0207709_10393528 3300025935 Bacteria 1058
398 Ga0207709_10599065 3300025935 Bacteria 872
399 Ga0207669_11568638 3300025937 Bacteria 562
400 Ga0207704_10451544 3300025938 Bacteria 1026
401 Ga0207704_11518164 3300025938 Bacteria 575
402 Ga0207704_11862115 3300025938 Unclassified 517
403 Ga0207665_10738593 3300025939 Unclassified 775
404 Ga0207691_10114855 3300025940 Bacteria 2391
405 Ga0207711_10001263 3300025941 Bacteria 23968
406 Ga0207711_10099799 3300025941 Bacteria 2567
407 Ga0207711_10573217 3300025941 Unclassified 1053
408 Ga0207711_10696266 3300025941 Bacteria 948
409 Ga0207689_10013497 3300025942 Bacteria 6976
410 Ga0207689_10202925 3300025942 Bacteria 1637
411 Ga0207661_10009833 3300025944 Bacteria 6869
412 Ga0207661_10014054 3300025944 Bacteria 5857
413 Ga0207661_10089515 3300025944 Bacteria 2561
414 Ga0207661_10120083 3300025944 Bacteria 2236
415 Ga0207661_10125668 3300025944 Bacteria 2190
416 Ga0207661_10219170 3300025944 Bacteria 1681
417 Ga0207661_10513844 3300025944 Bacteria 1095
418 Ga0207679_10227789 3300025945 Bacteria 1572
419 Ga0207679_10764831 3300025945 Bacteria 879
420 Ga0207679_11289639 3300025945 Bacteria 670
421 Ga0207679_11447983 3300025945 Bacteria 630
422 Ga0207667_10000322 3300025949 Bacteria 66404
423 Ga0207667_10172300 3300025949 Bacteria 2224
424 Ga0207667_10228690 3300025949 Archaea 1905
425 Ga0207667_10696488 3300025949 Bacteria 1019
426 Ga0207651_10019830 3300025960 Bacteria 4042
427 Ga0207651_10955618 3300025960 Bacteria 765
428 Ga0207712_10389223 3300025961 Bacteria 1169
429 Ga0207712_10710854 3300025961 Bacteria 878
430 Ga0207640_10251780 3300025981 Bacteria 1371
431 Ga0207640_10462292 3300025981 Bacteria 1048
432 Ga0207640_11814610 3300025981 Bacteria 551
433 Ga0207658_10473746 3300025986 Bacteria 1112
434 Ga0207677_10379999 3300026023 Bacteria 1192
435 Ga0207677_10386975 3300026023 Bacteria 1182
436 Ga0207677_10913674 3300026023 Unclassified 792
437 Ga0207677_11488531 3300026023 Bacteria 625
438 Ga0207703_10014253 3300026035 Bacteria 6199
439 Ga0207703_10048869 3300026035 Bacteria 3417
440 Ga0207703_10746219 3300026035 Unclassified 933
441 Ga0207703_10767232 3300026035 Bacteria 919
442 Ga0207703_11304450 3300026035 Unclassified 698
443 Ga0207703_11382094 3300026035 Bacteria 677
444 Ga0207639_10052227 3300026041 Bacteria 3114
445 Ga0207639_10934243 3300026041 Bacteria 811
446 Ga0207708_11122263 3300026075 Bacteria 686
447 Ga0207702_10025144 3300026078 Bacteria 4941
448 Ga0207702_10106429 3300026078 Bacteria 2485
449 Ga0207702_10261124 3300026078 Bacteria 1631
450 Ga0207702_11061618 3300026078 Bacteria 804
451 Ga0207702_11324006 3300026078 Archaea 714
452 Ga0207702_11631178 3300026078 Bacteria 638
453 Ga0207641_10797852 3300026088 Bacteria 934
454 Ga0207641_11571628 3300026088 Bacteria 660
455 Ga0207648_10218287 3300026089 Bacteria 1694
456 Ga0207648_10866133 3300026089 Bacteria 843
457 Ga0207676_10368994 3300026095 Bacteria 1333
458 Ga0207676_11346121 3300026095 Bacteria 709
459 Ga0207676_12193212 3300026095 Unclassified 550
460 Ga0207674_10000350 3300026116 Bacteria 59446
461 Ga0207674_10008397 3300026116 Bacteria 11938
462 Ga0207675_100268722 3300026118 Bacteria 1654
463 Ga0207683_10117129 3300026121 Bacteria 2389
464 Ga0207698_10011052 3300026142 Bacteria 5836
465 Ga0268266_10932912 3300028379 Bacteria 840
466 Ga0268264_10226124 3300028381 Bacteria 1725
467 Ga0268264_10247298 3300028381 Bacteria 1655
468 Ga0268264_10717874 3300028381 Bacteria 994
469 Ga0265318_10358982 3300028577 Bacteria 532
470 Ga0265338_10166967 3300028800 Unclassified 1693
471 Ga0265760_10140667 3300031090 Bacteria 786
472 Ga0265330_10446643 3300031235 Bacteria 549
473 Ga0265332_10155566 3300031238 Bacteria 956
474 Ga0265325_10278798 3300031241 Unclassified 750
475 Ga0265325_10313112 3300031241 Bacteria 699
476 Ga0265325_10415686 3300031241 Unclassified 588
477 Ga0265329_10205922 3300031242 Bacteria 648
478 Ga0265340_10029341 3300031247 Bacteria 2763
479 Ga0265331_10097410 3300031250 Bacteria 1356
480 Ga0265331_10135583 3300031250 Bacteria 1121
481 Ga0265316_10003615 3300031344 Bacteria 15593
482 Ga0265316_10032634 3300031344 Bacteria 4248
483 Ga0265316_10046218 3300031344 Bacteria 3451
484 Ga0265316_10349793 3300031344 Bacteria 1070
485 Ga0265316_10627234 3300031344 Bacteria 761
486 Ga0265316_10922662 3300031344 Bacteria 609
487 Ga0265313_10025296 3300031595 Bacteria 3150
488 Ga0265314_10001232 3300031711 Bacteria 29204
489 Ga0265314_10047950 3300031711 Bacteria 3002
490 Ga0265342_10010023 3300031712 Bacteria 6616
491 Ga0265342_10047427 3300031712 Bacteria 2578
492 Ga0373948_0107730 3300034817 Unclassified 662
493 Ga0373926_0083219 3300035083 Bacteria 1185
494 Ga0373926_0264883 3300035083 Unclassified 668
495 Ga0373926_0341748 3300035083 Bacteria 587
496 Ga0373926_0358353 3300035083 Bacteria 573
497 Ga0373934_0008883 3300035086 Bacteria 3755
498 Ga0373934_0059347 3300035086 Bacteria 1523
499 Ga0373934_0131405 3300035086 Unclassified 1021
500 Ga0373944_0127437 3300035089 Bacteria 882
501 Ga0373923_0059258 3300035111 Bacteria 1623
502 Ga0373923_0284288 3300035111 Unclassified 780
503 Ga0373932_0369728 3300035112 Bacteria 549
504 Ga0373945_0062482 3300035116 Bacteria 1392
505 Ga0373953_0042990 3300035117 Bacteria 1802
506 Ga0373953_0327979 3300035117 Bacteria 669
507 Ga0373954_0001032 3300035118 Bacteria 11047
508 Ga0373954_0057260 3300035118 Bacteria 1835
509 Ga0373954_0260109 3300035118 Bacteria 855
510 Ga0373954_0514408 3300035118 Bacteria 593
511 Ga0373954_0548047 3300035118 Bacteria 573
512 Ga0373956_0050534 3300035119 Bacteria 1867
513 Ga0373956_0265645 3300035119 Bacteria 816
514 Ga0373956_0377211 3300035119 Bacteria 676
515 Ga0373956_0547773 3300035119 Unclassified 552
516 Ga0373957_0042108 3300035120 Bacteria 1722
517 Ga0373957_0105329 3300035120 Unclassified 1132
518 Ga0373943_0878902 3300035170 Unclassified 535
519 Ga0373955_0077590 3300035172 Bacteria 1871
520 Ga0373955_0134589 3300035172 Bacteria 1445
521 Ga0373955_0192829 3300035172 Bacteria 1212
522 Ga0373955_0241168 3300035172 Unclassified 1083
523 Ga0373955_0354693 3300035172 Bacteria 888
524 Ga0373955_0540147 3300035172 Unclassified 713
525 Ga0373955_0651344 3300035172 Bacteria 646
526 Ga0373924_0432248 3300035410 Bacteria 589
527 Ga0373931_0667652 3300035691 Unclassified 684
528 Ga0373935_0104436 3300035692 Bacteria 1872
529 Ga0373935_1001783 3300035692 Unclassified 621
530 Ga0373927_0002004 3300035695 Bacteria 15009
531 Ga0373927_0092234 3300035695 Bacteria 1968
532 Ga0373927_0223867 3300035695 Bacteria 1236
533 Ga0373927_0314736 3300035695 Bacteria 1031
534 Ga0373927_0570302 3300035695 Bacteria 748
535 Ga0373927_0598040 3300035695 Bacteria 729
536 Ga0373933_0016662 3300035724 Bacteria 4114
537 Ga0373933_0105862 3300035724 Bacteria 1750
538 Ga0373933_0177318 3300035724 Bacteria 1358
539 Ga0373933_0206755 3300035724 Bacteria 1257
540 Ga0373933_0250267 3300035724 Bacteria 1141
541 Ga0373947_0003264 3300035725 Bacteria 9613
542 Ga0373947_0063427 3300035725 Bacteria 2251
543 Ga0373947_0269044 3300035725 Unclassified 1131
544 Ga0373947_0544513 3300035725 Bacteria 790
545 Ga0373947_0610128 3300035725 Bacteria 744
546 Ga0373937_0010698 3300036401 Bacteria 8025
547 Ga0373937_0014132 3300036401 Bacteria 7041
548 Ga0373937_0014460 3300036401 Bacteria 6969
549 Ga0373937_0062758 3300036401 Bacteria 3416
550 Ga0373937_0124100 3300036401 Bacteria 2408
551 Ga0373937_0500822 3300036401 Bacteria 1154
552 Ga0373937_0614437 3300036401 Bacteria 1032
553 Ga0373937_1098572 3300036401 Bacteria 744
554 Ga0373937_1778376 3300036401 Bacteria 563
555 Ga0265778_002429 3300036457 Unclassified 1796
556 Ga0265778_007704 3300036457 Bacteria 1186
557 Ga0373925_0000082 3300037068 Bacteria 101345
558 Ga0373925_0017271 3300037068 Bacteria 5227
559 Ga0373925_0368539 3300037068 Bacteria 1168
560 Ga0373925_0790657 3300037068 Bacteria 782
561 Ga0373925_0805032 3300037068 Bacteria 775
562 Ga0373925_0876426 3300037068 Bacteria 740
563 Ga0436365_0582778 3300039437 Unclassified 501
564 Ga0436365_0849505 3300039437 Bacteria 616
565 Ga0436363_0411808 3300039450 Bacteria 2497
566 Ga0436362_0733995 3300039453 Bacteria 1185
567 Ga0436362_0989568 3300039453 Bacteria 544
568 Ga0453684_0369502 3300044712 Unclassified 1613
569 Ga0453684_1781362 3300044712 Bacteria 627
570 Ga0466971_0709761 3300044719 Bacteria 506
571 Ga0451576_0091210 3300045051 Bacteria 3170
572 Ga0451576_0149209 3300045051 Bacteria 2438
573 Ga0451576_0720981 3300045051 Bacteria 1048
574 Ga0451576_2181513 3300045051 Unclassified 569
575 Ga0466958_0117279 3300045836 Bacteria 1665
576 Ga0495592_0085403 3300046454 Bacteria 2275
577 Ga0495592_0120699 3300046454 Bacteria 1844
578 Ga0495592_0323629 3300046454 Bacteria 996
579 Ga0495629_0185281 3300046459 Bacteria 1442
580 Ga0495651_0047833 3300046462 Bacteria 3305
581 Ga0495651_0085861 3300046462 Bacteria 2369
582 Ga0495653_0131147 3300046463 Bacteria 1774
583 Ga0495580_0005927 3300046472 Bacteria 10023
584 Ga0495580_0008889 3300046472 Bacteria 7946
585 Ga0495580_0022386 3300046472 Bacteria 4651
586 Ga0495580_0103377 3300046472 Bacteria 1980
587 Ga0495580_0114646 3300046472 Bacteria 1872
588 Ga0495580_0145575 3300046472 Bacteria 1642
589 Ga0495580_0493458 3300046472 Bacteria 818
590 Ga0495580_0664668 3300046472 Unclassified 684
591 Ga0495580_0725673 3300046472 Bacteria 649
592 Ga0495582_0009165 3300046473 Bacteria 5460
593 Ga0495639_0238494 3300046475 Unclassified 897
594 Ga0495662_0004426 3300046476 Bacteria 7052
595 Ga0495664_0001552 3300046477 Bacteria 12161
596 Ga0495664_0207810 3300046477 Bacteria 1186
597 Ga0495664_0285930 3300046477 Bacteria 996
598 Ga0495594_0128429 3300046499 Bacteria 1435
599 Ga0495608_0026046 3300046511 Bacteria 3991
600 Ga0495608_0083989 3300046511 Bacteria 2067
601 Ga0495608_0261279 3300046511 Bacteria 1078
602 Ga0495608_0729871 3300046511 Bacteria 588
603 Ga0495628_0221618 3300046516 Bacteria 1420
604 Ga0495628_0466753 3300046516 Bacteria 915
605 Ga0495630_1229330 3300046517 Bacteria 566
606 Ga0495666_0328581 3300046526 Bacteria 690
607 Ga0495652_0186508 3300046529 Bacteria 1587
608 Ga0495652_0190284 3300046529 Bacteria 1566
609 Ga0495652_0379351 3300046529 Unclassified 1006
610 Ga0495665_0023139 3300046531 Bacteria 3337
611 Ga0495640_0414259 3300046533 Bacteria 826
612 Ga0495640_0742599 3300046533 Bacteria 587
613 Ga0495640_0765308 3300046533 Unclassified 577
614 Ga0495586_0023495 3300046535 Bacteria 3293
615 Ga0495586_0112079 3300046535 Bacteria 1519
616 Ga0495587_0007890 3300046536 Bacteria 6878
617 Ga0495587_0016593 3300046536 Bacteria 4582
618 Ga0495587_0040372 3300046536 Bacteria 2790
619 Ga0495587_0306745 3300046536 Bacteria 887
620 Ga0495645_0034911 3300046543 Bacteria 3666
621 Ga0495645_0078414 3300046543 Bacteria 2374
622 Ga0495645_0303349 3300046543 Bacteria 1042
623 Ga0495667_0103125 3300046559 Bacteria 1845
624 Ga0495667_0118338 3300046559 Bacteria 1711
625 Ga0495667_0590905 3300046559 Bacteria 692
626 Ga0495634_0054980 3300046642 Bacteria 2663
627 Ga0495634_0248629 3300046642 Bacteria 1088
628 Ga0495635_0556380 3300046663 Bacteria 752
629 Ga0495635_0706126 3300046663 Bacteria 654
630 Ga0495635_0877741 3300046663 Bacteria 575
631 Ga0495599_0008857 3300046678 Bacteria 6127
632 Ga0495599_0068273 3300046678 Bacteria 2219
633 Ga0495599_0647422 3300046678 Bacteria 612
634 Ga0495599_0742680 3300046678 Bacteria 563
635 Ga0495623_0224909 3300046679 Bacteria 1067
636 Ga0495623_0363962 3300046679 Bacteria 785
637 Ga0495646_0030209 3300046680 Bacteria 3384
638 Ga0495658_0433909 3300046683 Bacteria 839
639 Ga0495613_0093864 3300046689 Bacteria 2172
640 Ga0495613_1022330 3300046689 Bacteria 530
641 Ga0495600_0036897 3300046809 Bacteria 3177
642 Ga0495600_0265477 3300046809 Bacteria 1090
643 Ga0495604_0016645 3300047317 Bacteria 5880
644 Ga0495604_0100174 3300047317 Bacteria 2130
645 Ga0495604_0306909 3300047317 Unclassified 1064
646 Ga0495604_0780635 3300047317 Bacteria 603
647 Ga0495674_0052807 3300047319 Bacteria 3575
648 Ga0495674_0112097 3300047319 Bacteria 2311
649 Ga0495674_0171078 3300047319 Bacteria 1813
650 Ga0495674_0211532 3300047319 Bacteria 1606
651 Ga0495674_0613060 3300047319 Bacteria 861
652 Ga0495680_0076004 3300047322 Bacteria 2548
653 Ga0495675_0075262 3300047444 Bacteria 2128
654 Ga0495675_0234931 3300047444 Bacteria 1105
655 Ga0495675_0349546 3300047444 Bacteria 870
656 Ga0495675_0386322 3300047444 Bacteria 818
657 Ga0495675_0421482 3300047444 Unclassified 775
658 Ga0495675_0470637 3300047444 Unclassified 725
659 Ga0495684_0027254 3300047471 Bacteria 4387
660 Ga0495684_0055301 3300047471 Bacteria 3027
661 Ga0495684_0385236 3300047471 Bacteria 988
662 Ga0495684_0519878 3300047471 Bacteria 815
663 Ga0495684_0543976 3300047471 Bacteria 792
664 Ga0495602_0020532 3300048088 Bacteria 6526
665 Ga0495602_0595384 3300048088 Unclassified 761
666 Ga0495602_0929857 3300048088 Unclassified 577
667 Ga0496104_0816953 3300048907 Bacteria 838
668 Ga0496104_1585902 3300048907 Bacteria 557
669 Ga0496106_0833736 3300048909 Bacteria 730
670 Ga0496108_0804803 3300048911 Bacteria 811
671 Ga0496112_0142624 3300048915 Bacteria 2365
672 Ga0496112_0541877 3300048915 Bacteria 1098
673 Ga0501069_0792427 3300049585 Bacteria 574
674 nmdc:mga05p37_1937281_c1 3300050507 Bacteria 561
675 nmdc:mga05p37_297397_c1 3300050507 Bacteria 1919
676 nmdc:mga09592_86859_c1 3300050508 Bacteria 1898
677 nmdc:mga0qj67_179575_c1 3300050509 Bacteria 1719
678 nmdc:mga06r32_5346_c1 3300050510 Bacteria 11562
679 nmdc:mga06r32_76868_c1 3300050510 Bacteria 3242
680 nmdc:mga0rr50_1291389_c1 3300050513 Bacteria 619
681 nmdc:mga0rr50_1379002_c1 3300050513 Bacteria 597
682 nmdc:mga0rr50_1430819_c1 3300050513 Unclassified 585
683 nmdc:mga0rr50_400738_c1 3300050513 Bacteria 1159
684 nmdc:mga0rr50_768928_c1 3300050513 Unclassified 822
685 nmdc:mga08x19_23978_c1 3300050514 Bacteria 3788
686 nmdc:mga08x19_488075_c1 3300050514 Bacteria 869
687 nmdc:mga08x19_741966_c1 3300050514 Unclassified 697
688 Ga0495601_0487993 3300053077 Unclassified 796
689 Ga0495619_0512303 3300053085 Bacteria 825
690 Ga0495619_0641952 3300053085 Bacteria 724
691 Ga0495619_1127076 3300053085 Bacteria 521
692 Ga0500568_0000476 3300053139 Bacteria 29662
693 nmdc:mga0n895_1313229_c1
694 Ga0065712_10654216
695 Ga0065707_10339735
696 Ga0070676_11147366
697 Ga0070683_100007135
698 Ga0070683_100017554
699 Ga0070683_100086830
700 Ga0070683_100097096
701 Ga0070683_100122177
702 Ga0070683_100340426
703 Ga0070690_100437524
704 Ga0070690_100500324
705 Ga0070670_100750937
706 Ga0068869_100025293
707 Ga0068869_100876533
708 Ga0068869_101294797
709 Ga0070666_11015343
710 Ga0070680_100027905
711 Ga0070680_100312096
712 Ga0070680_100838733
713 Ga0070680_101246700
714 Ga0070682_100185392
715 Ga0068868_100423834
716 Ga0068868_100528852
717 Ga0070660_100138382
718 Ga0070689_100444697
719 Ga0070691_10002783
720 Ga0070687_100771352
721 Ga0070661_100895822
722 Ga0070692_10153095
723 Ga0070669_100197521
724 Ga0070669_100227085
725 Ga0070671_100114221
726 Ga0070671_101362999
727 Ga0070671_101888220
728 Ga0070673_100436597
729 Ga0070673_101417154
730 Ga0070688_100875160
731 Ga0070659_100268159
732 Ga0070667_100627203
733 Ga0070667_100690221
734 Ga0070667_100956585
735 Ga0070709_10024059
736 Ga0070709_10314756
737 Ga0070709_10438201
738 Ga0070709_11093675
739 Ga0070714_100369553
740 Ga0070713_100023291
741 Ga0070713_100278727
742 Ga0070713_101407424
743 Ga0070710_10386950
744 Ga0070710_10522498
745 Ga0070710_10666185
746 Ga0070711_100306698
747 Ga0070711_101817671
748 Ga0070705_100778042
749 Ga0070705_100931029
750 Ga0070705_101751707
751 Ga0070700_100478513
752 Ga0070694_100758746
753 Ga0070708_100302492
754 Ga0070708_102035778
755 Ga0070678_100217094
756 Ga0070678_101065618
757 Ga0070662_100904218
758 Ga0070681_10001506
759 Ga0070681_10021181
760 Ga0070681_10040260
761 Ga0070681_10115307
762 Ga0070681_10580392
763 Ga0070681_10675944
764 Ga0068867_100167830
765 Ga0068867_100363081
766 Ga0068867_100769226
767 Ga0070685_10343128
768 Ga0070706_100140015
769 Ga0070706_101626280
770 Ga0070707_100645508
771 Ga0070707_102168297
772 Ga0070698_100489269
773 Ga0070698_102103489
774 Ga0070699_100076626
775 Ga0070679_100007294
776 Ga0070679_101022040
777 Ga0070679_101684162
778 Ga0070684_100007045
779 Ga0070684_100155017
780 Ga0070684_100245709
781 Ga0070684_100255350
782 Ga0070684_100299230
783 Ga0070684_100431651
784 Ga0070684_101092495
785 Ga0070697_100045059
786 Ga0070697_100192893
787 Ga0070697_101445737
788 Ga0070697_101512351
789 Ga0068853_100068437
790 Ga0068853_101076143
791 Ga0068853_102182345
792 Ga0070672_100220962
793 Ga0070672_100342569
794 Ga0070686_100516403
795 Ga0070695_100078922
796 Ga0070695_100079743
797 Ga0070695_100445363
798 Ga0070696_100002449
799 Ga0070696_100573106
800 Ga0070696_101981523
801 Ga0070693_100064409
802 Ga0070693_100100626
803 Ga0070693_100124002
804 Ga0070665_100695046
805 Ga0070704_100192796
806 Ga0070704_100775149
807 Ga0068855_100065973
808 Ga0068855_100145832
809 Ga0068855_100216890
810 Ga0070664_100638571
811 Ga0070664_100649824
812 Ga0070664_101816627
813 Ga0068857_100000716
814 Ga0068857_100007977
815 Ga0068854_100181668
816 Ga0068854_100518611
817 Ga0068856_100000584
818 Ga0068856_100140862
819 Ga0068856_100159639
820 Ga0068856_101122406
821 Ga0068856_101765361
822 Ga0068852_100006091
823 Ga0068859_100016192
824 Ga0068859_101503142
825 Ga0068859_101949141
826 Ga0068859_102109246
827 Ga0068864_100678670
828 Ga0068864_101485320
829 Ga0068866_10441773
830 Ga0068866_10943434
831 Ga0068861_100278512
832 Ga0068861_102113777
833 Ga0068863_101145121
834 Ga0068863_102156244
835 Ga0068863_102658262
836 Ga0068858_100044836
837 Ga0068858_100096434
838 Ga0068858_100204746
839 Ga0068858_100279133
840 Ga0068858_100718827
841 Ga0068858_102031139
842 Ga0068860_100024195
843 Ga0068860_100122756
844 Ga0068860_100684624
845 Ga0068860_100782586
846 Ga0068860_100912688
847 Ga0070717_10133509
848 Ga0070717_10312356
849 Ga0070716_101589560
850 Ga0070712_100556800
851 Ga0097621_100244106
852 Ga0097621_100266943
853 Ga0097621_100396063
854 Ga0097621_100416886
855 Ga0097621_100425453
856 Ga0097621_100501177
857 Ga0097621_101901201
858 Ga0068871_100033247
859 Ga0068871_100082392
860 Ga0068871_100255290
861 Ga0068871_100313951
862 Ga0068871_100496422
863 Ga0068871_101505931
864 Ga0075428_101513191
865 Ga0075430_100028428
866 Ga0075431_100007793
867 Ga0075431_100013566
868 Ga0075433_10568149
869 Ga0075434_102633211
870 Ga0075429_100110235
871 Ga0068865_100790717
872 Ga0068865_101172196
873 Ga0075436_100012053
874 Ga0075436_100656892
875 Ga0075436_100880693
876 Ga0097620_100016192
877 Ga0097620_101502496
878 Ga0097620_101949228
879 Ga0097620_102108056
880 Ga0075435_100157591
881 Ga0075435_101095321
882 Ga0075435_101173684
883 Ga0105251_10493582
884 Ga0105240_10031731
885 Ga0105240_10035165
886 Ga0105240_10093517
887 Ga0105240_10111179
888 Ga0105240_10326903
889 Ga0105240_10507818
890 Ga0105240_12652754
891 Ga0111539_10805708
892 Ga0105245_10002670
893 Ga0105245_10005954
894 Ga0105245_10037336
895 Ga0105245_10454026
896 Ga0105245_10666649
897 Ga0105245_10758057
898 Ga0105245_10886085
899 Ga0105245_11021126
900 Ga0105245_12041953
901 Ga0105247_10090348
902 Ga0105247_11181889
903 Ga0105247_11333020
904 Ga0105247_11660143
905 Ga0114129_10116654
906 Ga0114129_10121220
907 Ga0114129_10410666
908 Ga0105243_10013344
909 Ga0105243_10398268
910 Ga0105241_10007182
911 Ga0105241_10098922
912 Ga0105241_10173312
913 Ga0105241_10225637
914 Ga0105241_10320640
915 Ga0105242_10040268
916 Ga0105242_10282570
917 Ga0105242_10300646
918 Ga0105242_10321273
919 Ga0105242_10845591
920 Ga0105242_12673207
921 Ga0105242_13321408
922 Ga0105248_10018601
923 Ga0105248_10032605
924 Ga0105248_10564474
925 Ga0105248_10693651
926 Ga0105248_10732278
927 Ga0105248_11327569
928 Ga0105248_12999004
929 Ga0105248_13284642
930 Ga0105237_10005182
931 Ga0105237_10033554
932 Ga0105237_10166206
933 Ga0105237_10186104
934 Ga0105237_10725425
935 Ga0105237_11283072
936 Ga0105237_11315468
937 Ga0105237_11654365
938 Ga0105237_11665667
939 Ga0105237_12235626
940 Ga0105238_10000959
941 Ga0105238_10028606
942 Ga0105238_10029874
943 Ga0105238_10230386
944 Ga0105238_10246065
945 Ga0105238_10641039
946 Ga0105238_11064845
947 Ga0105249_10038382
948 Ga0105249_10183721
949 Ga0105239_10003659
950 Ga0105239_10045052
951 Ga0105239_10075160
952 Ga0105239_10191690
953 Ga0105239_10811884
954 Ga0105239_11170939
955 Ga0105239_12381428
956 Ga0105246_10003902
957 Ga0105246_10194265
958 Ga0105246_10282282
959 Ga0105246_11175621
960 Ga0157370_10003423
961 Ga0157370_10795084
962 Ga0157370_10906805
963 Ga0157370_11129948
964 Ga0157369_10002413
965 Ga0157369_10018212
966 Ga0157369_10900032
967 Ga0157369_11074523
968 Ga0157369_11581073
969 Ga0157374_10083419
970 Ga0157374_10340256
971 Ga0157374_11349380
972 Ga0157374_12025961
973 Ga0157374_12883227
974 Ga0157378_10002546
975 Ga0157378_10453098
976 Ga0157378_10484912
977 Ga0157378_11509488
978 Ga0157378_11944582
979 Ga0157378_12575043
980 Ga0163162_11163785
981 Ga0163162_11290798
982 Ga0157372_10025251
983 Ga0157372_10059006
984 Ga0157372_12015464
985 Ga0157372_12085716
986 Ga0157372_12324477
987 Ga0157375_10008895
988 Ga0157375_10175888
989 Ga0157375_10938071
990 Ga0157375_11117946
991 Ga0157375_12588673
992 Ga0163163_10008800
993 Ga0163163_10597845
994 Ga0163163_10837609
995 Ga0163163_11545419
996 Ga0163163_12239651
997 Ga0163163_12421708
998 Ga0163163_13264567
999 Ga0157379_10339883
1000 Ga0157379_10706663
1001 Ga0157379_11697663
1002 Ga0157379_11922465
1003 Ga0157379_12326758
1004 Ga0157376_10259985
1005 Ga0157376_10333491
1006 Ga0157376_11256047
1007 Ga0157376_11776081
1008 Ga0157376_11917620
1009 Ga0157376_11989662
1010 Ga0157376_12287913
1011 Ga0182005_1148912
1012 Ga0163161_11513587
1013 Ga0213874_10142642
1014 Ga0207692_11169372
1015 Ga0207642_10284391
1016 Ga0207642_10413808
1017 Ga0207710_10022185
1018 Ga0207685_10134584
1019 Ga0207699_10026864
1020 Ga0207699_10301145
1021 Ga0207645_10049329
1022 Ga0207645_11061136
1023 Ga0207684_10115347
1024 Ga0207684_11603377
1025 Ga0207654_10037467
1026 Ga0207654_10056664
1027 Ga0207654_10071491
1028 Ga0207654_10103316
1029 Ga0207654_10112904
1030 Ga0207654_10214620
1031 Ga0207654_10461781
1032 Ga0207707_10000224
1033 Ga0207707_10016125
1034 Ga0207707_10053174
1035 Ga0207707_10060530
1036 Ga0207707_10137520
1037 Ga0207707_10406716
1038 Ga0207695_10000533
1039 Ga0207695_10075823
1040 Ga0207695_10551219
1041 Ga0207695_10826748
1042 Ga0207695_11176810
1043 Ga0207695_11671350
1044 Ga0207671_10011156
1045 Ga0207671_10044748
1046 Ga0207671_10125069
1047 Ga0207671_10161826
1048 Ga0207671_10174428
1049 Ga0207671_10916022
1050 Ga0207671_11331091
1051 Ga0207671_11539975
1052 Ga0207693_10320162
1053 Ga0207663_10118590
1054 Ga0207660_10024767
1055 Ga0207660_10275426
1056 Ga0207660_11077920
1057 Ga0207660_11580958
1058 Ga0207657_10142219
1059 Ga0207649_10402307
1060 Ga0207649_11578603
1061 Ga0207652_10005967
1062 Ga0207652_10181971
1063 Ga0207652_10680617
1064 Ga0207646_10556847
1065 Ga0207681_10229929
1066 Ga0207681_11231077
1067 Ga0207694_10000545
1068 Ga0207694_10006193
1069 Ga0207694_10145060
1070 Ga0207650_11528018
1071 Ga0207687_10004677
1072 Ga0207687_10005226
1073 Ga0207687_10242357
1074 Ga0207687_10499849
1075 Ga0207687_10995329
1076 Ga0207687_11004778
1077 Ga0207700_10014023
1078 Ga0207664_11591317
1079 Ga0207644_10091367
1080 Ga0207644_11417554
1081 Ga0207644_11804335
1082 Ga0207690_10537194
1083 Ga0207706_10381587
1084 Ga0207686_10021344
1085 Ga0207686_10061420
1086 Ga0207686_11586084
1087 Ga0207709_10088202
1088 Ga0207709_10222568
1089 Ga0207709_10393528
1090 Ga0207709_10599065
1091 Ga0207669_11568638
1092 Ga0207704_10451544
1093 Ga0207704_11518164
1094 Ga0207704_11862115
1095 Ga0207665_10738593
1096 Ga0207691_10114855
1097 Ga0207711_10001263
1098 Ga0207711_10099799
1099 Ga0207711_10573217
1100 Ga0207711_10696266
1101 Ga0207689_10013497
1102 Ga0207689_10202925
1103 Ga0207661_10009833
1104 Ga0207661_10014054
1105 Ga0207661_10089515
1106 Ga0207661_10120083
1107 Ga0207661_10125668
1108 Ga0207661_10219170
1109 Ga0207661_10513844
1110 Ga0207679_10227789
1111 Ga0207679_10764831
1112 Ga0207679_11289639
1113 Ga0207679_11447983
1114 Ga0207667_10000322
1115 Ga0207667_10172300
1116 Ga0207667_10228690
1117 Ga0207667_10696488
1118 Ga0207651_10019830
1119 Ga0207651_10955618
1120 Ga0207712_10389223
1121 Ga0207712_10710854
1122 Ga0207640_10251780
1123 Ga0207640_10462292
1124 Ga0207640_11814610
1125 Ga0207658_10473746
1126 Ga0207677_10379999
1127 Ga0207677_10386975
1128 Ga0207677_10913674
1129 Ga0207677_11488531
1130 Ga0207703_10014253
1131 Ga0207703_10048869
1132 Ga0207703_10746219
1133 Ga0207703_10767232
1134 Ga0207703_11304450
1135 Ga0207703_11382094
1136 Ga0207639_10052227
1137 Ga0207639_10934243
1138 Ga0207708_11122263
1139 Ga0207702_10025144
1140 Ga0207702_10106429
1141 Ga0207702_10261124
1142 Ga0207702_11061618
1143 Ga0207702_11324006
1144 Ga0207702_11631178
1145 Ga0207641_10797852
1146 Ga0207641_11571628
1147 Ga0207648_10218287
1148 Ga0207648_10866133
1149 Ga0207676_10368994
1150 Ga0207676_11346121
1151 Ga0207676_12193212
1152 Ga0207674_10000350
1153 Ga0207674_10008397
1154 Ga0207675_100268722
1155 Ga0207683_10117129
1156 Ga0207698_10011052
1157 Ga0268266_10932912
1158 Ga0268264_10226124
1159 Ga0268264_10247298
1160 Ga0268264_10717874
1161 Ga0265318_10358982
1162 Ga0265338_10166967
1163 Ga0265760_10140667
1164 Ga0265330_10446643
1165 Ga0265332_10155566
1166 Ga0265325_10278798
1167 Ga0265325_10313112
1168 Ga0265325_10415686
1169 Ga0265329_10205922
1170 Ga0265340_10029341
1171 Ga0265331_10097410
1172 Ga0265331_10135583
1173 Ga0265316_10003615
1174 Ga0265316_10032634
1175 Ga0265316_10046218
1176 Ga0265316_10349793
1177 Ga0265316_10627234
1178 Ga0265316_10922662
1179 Ga0265313_10025296
1180 Ga0265314_10001232
1181 Ga0265314_10047950
1182 Ga0265342_10010023
1183 Ga0265342_10047427
1184 Ga0373948_0107730
1185 Ga0373926_0083219
1186 Ga0373926_0264883
1187 Ga0373926_0341748
1188 Ga0373926_0358353
1189 Ga0373934_0008883
1190 Ga0373934_0059347
1191 Ga0373934_0131405
1192 Ga0373944_0127437
1193 Ga0373923_0059258
1194 Ga0373923_0284288
1195 Ga0373932_0369728
1196 Ga0373945_0062482
1197 Ga0373953_0042990
1198 Ga0373953_0327979
1199 Ga0373954_0001032
1200 Ga0373954_0057260
1201 Ga0373954_0260109
1202 Ga0373954_0514408
1203 Ga0373954_0548047
1204 Ga0373956_0050534
1205 Ga0373956_0265645
1206 Ga0373956_0377211
1207 Ga0373956_0547773
1208 Ga0373957_0042108
1209 Ga0373957_0105329
1210 Ga0373943_0878902
1211 Ga0373955_0077590
1212 Ga0373955_0134589
1213 Ga0373955_0192829
1214 Ga0373955_0241168
1215 Ga0373955_0354693
1216 Ga0373955_0540147
1217 Ga0373955_0651344
1218 Ga0373924_0432248
1219 Ga0373931_0667652
1220 Ga0373935_0104436
1221 Ga0373935_1001783
1222 Ga0373927_0002004
1223 Ga0373927_0092234
1224 Ga0373927_0223867
1225 Ga0373927_0314736
1226 Ga0373927_0570302
1227 Ga0373927_0598040
1228 Ga0373933_0016662
1229 Ga0373933_0105862
1230 Ga0373933_0177318
1231 Ga0373933_0206755
1232 Ga0373933_0250267
1233 Ga0373947_0003264
1234 Ga0373947_0063427
1235 Ga0373947_0269044
1236 Ga0373947_0544513
1237 Ga0373947_0610128
1238 Ga0373937_0010698
1239 Ga0373937_0014132
1240 Ga0373937_0014460
1241 Ga0373937_0062758
1242 Ga0373937_0124100
1243 Ga0373937_0500822
1244 Ga0373937_0614437
1245 Ga0373937_1098572
1246 Ga0373937_1778376
1247 Ga0265778_002429
1248 Ga0265778_007704
1249 Ga0373925_0000082
1250 Ga0373925_0017271
1251 Ga0373925_0368539
1252 Ga0373925_0790657
1253 Ga0373925_0805032
1254 Ga0373925_0876426
1255 Ga0436365_0582778
1256 Ga0436365_0849505
1257 Ga0436363_0411808
1258 Ga0436362_0733995
1259 Ga0436362_0989568
1260 Ga0453684_0369502
1261 Ga0453684_1781362
1262 Ga0466971_0709761
1263 Ga0451576_0091210
1264 Ga0451576_0149209
1265 Ga0451576_0720981
1266 Ga0451576_2181513
1267 Ga0466958_0117279
1268 Ga0495592_0085403
1269 Ga0495592_0120699
1270 Ga0495592_0323629
1271 Ga0495629_0185281
1272 Ga0495651_0047833
1273 Ga0495651_0085861
1274 Ga0495653_0131147
1275 Ga0495580_0005927
1276 Ga0495580_0008889
1277 Ga0495580_0022386
1278 Ga0495580_0103377
1279 Ga0495580_0114646
1280 Ga0495580_0145575
1281 Ga0495580_0493458
1282 Ga0495580_0664668
1283 Ga0495580_0725673
1284 Ga0495582_0009165
1285 Ga0495639_0238494
1286 Ga0495662_0004426
1287 Ga0495664_0001552
1288 Ga0495664_0207810
1289 Ga0495664_0285930
1290 Ga0495594_0128429
1291 Ga0495608_0026046
1292 Ga0495608_0083989
1293 Ga0495608_0261279
1294 Ga0495608_0729871
1295 Ga0495628_0221618
1296 Ga0495628_0466753
1297 Ga0495630_1229330
1298 Ga0495666_0328581
1299 Ga0495652_0186508
1300 Ga0495652_0190284
1301 Ga0495652_0379351
1302 Ga0495665_0023139
1303 Ga0495640_0414259
1304 Ga0495640_0742599
1305 Ga0495640_0765308
1306 Ga0495586_0023495
1307 Ga0495586_0112079
1308 Ga0495587_0007890
1309 Ga0495587_0016593
1310 Ga0495587_0040372
1311 Ga0495587_0306745
1312 Ga0495645_0034911
1313 Ga0495645_0078414
1314 Ga0495645_0303349
1315 Ga0495667_0103125
1316 Ga0495667_0118338
1317 Ga0495667_0590905
1318 Ga0495634_0054980
1319 Ga0495634_0248629
1320 Ga0495635_0556380
1321 Ga0495635_0706126
1322 Ga0495635_0877741
1323 Ga0495599_0008857
1324 Ga0495599_0068273
1325 Ga0495599_0647422
1326 Ga0495599_0742680
1327 Ga0495623_0224909
1328 Ga0495623_0363962
1329 Ga0495646_0030209
1330 Ga0495658_0433909
1331 Ga0495613_0093864
1332 Ga0495613_1022330
1333 Ga0495600_0036897
1334 Ga0495600_0265477
1335 Ga0495604_0016645
1336 Ga0495604_0100174
1337 Ga0495604_0306909
1338 Ga0495604_0780635
1339 Ga0495674_0052807
1340 Ga0495674_0112097
1341 Ga0495674_0171078
1342 Ga0495674_0211532
1343 Ga0495674_0613060
1344 Ga0495680_0076004
1345 Ga0495675_0075262
1346 Ga0495675_0234931
1347 Ga0495675_0349546
1348 Ga0495675_0386322
1349 Ga0495675_0421482
1350 Ga0495675_0470637
1351 Ga0495684_0027254
1352 Ga0495684_0055301
1353 Ga0495684_0385236
1354 Ga0495684_0519878
1355 Ga0495684_0543976
1356 Ga0495602_0020532
1357 Ga0495602_0595384
1358 Ga0495602_0929857
1359 Ga0496104_0816953
1360 Ga0496104_1585902
1361 Ga0496106_0833736
1362 Ga0496108_0804803
1363 Ga0496112_0142624
1364 Ga0496112_0541877
1365 Ga0501069_0792427
1366 nmdc:mga05p37_1937281_c1
1367 nmdc:mga05p37_297397_c1
1368 nmdc:mga09592_86859_c1
1369 nmdc:mga0qj67_179575_c1
1370 nmdc:mga06r32_5346_c1
1371 nmdc:mga06r32_76868_c1
1372 nmdc:mga0rr50_1291389_c1
1373 nmdc:mga0rr50_1379002_c1
1374 nmdc:mga0rr50_1430819_c1
1375 nmdc:mga0rr50_400738_c1
1376 nmdc:mga0rr50_768928_c1
1377 nmdc:mga08x19_23978_c1
1378 nmdc:mga08x19_488075_c1
1379 nmdc:mga08x19_741966_c1
1380 Ga0495601_0487993
1381 Ga0495619_0512303
1382 Ga0495619_0641952
1383 Ga0495619_1127076
1384 Ga0500568_0000476

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02700

PurS

Phosphoribosylformylglycinamidine (FGAM) synthase

6

82

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2dgb-assembly1.cif.gz_D structure of thermus thermophilus purs in the p21 form 0.7187 7 88
2dgb-assembly1.cif.gz_D structure of thermus thermophilus purs in the p21 form 0.6926 7 88
1vq3-assembly1.cif.gz_C crystal structure of phosphoribosylformylglycinamidine synthase, purs subunit (ec 6.3.5.3) (tm1244) from thermotoga maritima at 1.90 a resolution 0.6924 8 87
2yx5-assembly1.cif.gz_A crystal structure of methanocaldococcus jannaschii purs, one of the subunits of formylglycinamide ribonucleotide amidotransferase in the purine biosynthetic pathway 0.6736 8 88
2zw2-assembly1.cif.gz_B crystal structure of formylglycinamide ribonucleotide amidotransferase iii from sulfolobus tokodaii (stpurs) 0.6649 8 88
ID Description Score Start End Superfamily
2dgbA00 Alpha Beta;2-Layer Sandwich;Mth169; Chain: A ,;Phosphoribosylformylglycinamidine synthase subunit PurS 0.6995 7 88 3.30.1280.10
2dgbA00 Alpha Beta;2-Layer Sandwich;Mth169; Chain: A ,;Phosphoribosylformylglycinamidine synthase subunit PurS 0.6736 7 88 3.30.1280.10
2yx5A00 Alpha Beta;2-Layer Sandwich;Mth169; Chain: A ,;Phosphoribosylformylglycinamidine synthase subunit PurS 0.6736 8 88 3.30.1280.10
2zw2B00 Alpha Beta;2-Layer Sandwich;Mth169; Chain: A ,;Phosphoribosylformylglycinamidine synthase subunit PurS 0.6649 8 88 3.30.1280.10
af_Q2FZJ2_1_81_3.30.1280.10 Alpha Beta;2-Layer Sandwich;Mth169; Chain: A ,;Phosphoribosylformylglycinamidine synthase subunit PurS 0.6598 8 88 3.30.1280.10
ID Description Score Start End GO Terms
AF-A0A3M1N5U1-F1-model_v4 Phosphoribosylformylglycinamidine synthase subunit PurS (FGAM synthase) (EC 6.3.5.3) (Formylglycinamide ribonucleotide amidotransferase subunit III) (FGAR amidotransferase III) (FGAR-AT III) (Phosphoribosylformylglycinamidine synthase subunit III) 0.7865 8 87 GO:0004642
GO:0005524
GO:0005737
GO:0006189
AF-A0A1Q7HHP7-F1-model_v4 Phosphoribosylformylglycinamidine synthase subunit PurS (FGAM synthase) (EC 6.3.5.3) (Formylglycinamide ribonucleotide amidotransferase subunit III) (FGAR amidotransferase III) (FGAR-AT III) (Phosphoribosylformylglycinamidine synthase subunit III) 0.7829 7 87 GO:0004642
GO:0005524
GO:0005737
GO:0006189
AF-A0A7V5VR07-F1-model_v4 Phosphoribosylformylglycinamidine synthase subunit PurS (FGAM synthase) (EC 6.3.5.3) (Formylglycinamide ribonucleotide amidotransferase subunit III) (FGAR amidotransferase III) (FGAR-AT III) (Phosphoribosylformylglycinamidine synthase subunit III) 0.7627 8 88 GO:0004642
GO:0005524
GO:0005737
GO:0006189
AF-A0A1M4TXH0-F1-model_v4 Phosphoribosylformylglycinamidine synthase subunit PurS (FGAM synthase) (EC 6.3.5.3) (Formylglycinamide ribonucleotide amidotransferase subunit III) (FGAR amidotransferase III) (FGAR-AT III) (Phosphoribosylformylglycinamidine synthase subunit III) 0.7529 8 88 GO:0004642
GO:0005524
GO:0005737
GO:0006189
AF-A0A139DRP9-F1-model_v4 deleted 0.7459 7 88

Map