F475593

General Info

Members Datasets Scaffolds Average Seq Length
692 566 320 317

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_0011176|Ga0395905_0011176_7440_8483
Length 347
Sequence MLTQSYGTIRLLILTRLRAIRIAGHIFIRGGIPLRRLLLLTAVLGLAISIAAPAKALTVVPPGNRHAEQPDVPGASSRRTKAGHTTFERKYEKVRDLLANDSDLISKIKMTARAYRIDPIHMIGAIVGEHTYNVDAYDSLQQYYVKAAAYAGNSFRFAYNGEKIDDFIARPEFAECNGKSGSYALWTCRERVWDRSFRGKQGFPNNRFSAVFFQPFYAGQTFGLGQINPLTALELSDLVAKVSGYPKLDESKASDVYQAIMDPDKSLAYMAASIKMSIDDYKRIAGMDISKNPGVTATLYNVGNPAARAAQLAAKNKGRAAGQQLMPEENYYGWLVNDKLAELKGLL

Samples

Sample ID Description Type Environment
1 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
2 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
3 2509276019 Ensifer aridi TW10 Isolate Nodule
4 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
5 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
6 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
7 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
8 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
9 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
10 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
11 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
12 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
13 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
14 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
15 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
16 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
17 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
18 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
19 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
20 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
21 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
22 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
23 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
24 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
25 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
26 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
27 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
28 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
29 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
30 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
31 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
32 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
33 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
34 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
35 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
36 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
37 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
38 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
39 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
40 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
41 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
42 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
43 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
44 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
45 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
46 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
47 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
48 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
49 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
50 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
51 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
52 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
53 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
54 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
55 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
56 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
57 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
58 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
59 2643221558 Rhizobium sp. Root149 Isolate Unclassified
60 2643221568 Rhizobium sp. Root564 Isolate Unclassified
61 2643221607 Rhizobium sp. Root73 Isolate Unclassified
62 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
63 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
64 2643221688 Rhizobium sp. Root482 Isolate Unclassified
65 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
66 2643221693 Rhizobium sp. Root491 Isolate Unclassified
67 2643221719 Rhizobium sp. Root274 Isolate Unclassified
68 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
69 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
70 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
71 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
72 2738541293 Rhizobium sp. GV031 Isolate Unclassified
73 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
74 2738543024 Aminobacter sp. AP02 Isolate Unclassified
75 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
76 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
77 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
78 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
79 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
80 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
81 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
82 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
83 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
84 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
85 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
86 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
87 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
88 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
89 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
90 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
91 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
92 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
93 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
94 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
95 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
96 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
97 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
98 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
99 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
100 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
101 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
102 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
103 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
104 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
105 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
106 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
107 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
108 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
109 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
110 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
111 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
112 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
113 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
114 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
115 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
116 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
117 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
118 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
119 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
120 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
121 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
122 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
123 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
124 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
125 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
126 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
127 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
128 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
129 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
130 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
131 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
132 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
133 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
134 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
135 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
136 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
137 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
138 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
139 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
140 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
141 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
142 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
143 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
144 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
145 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
146 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
147 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
148 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
149 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
150 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
151 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
152 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
153 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
154 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
155 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
156 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
157 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
158 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
159 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
160 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
161 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
162 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
163 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
164 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
165 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
166 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
167 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
168 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
169 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
170 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
171 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
172 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
173 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
174 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
175 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
176 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
177 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
178 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
179 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
180 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
181 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
182 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
183 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
184 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
185 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
186 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
187 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
188 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
189 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
190 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
191 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
192 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
193 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
194 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
195 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
196 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
197 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
198 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
199 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
200 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
201 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
202 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
203 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
204 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
205 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
206 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
207 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
208 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
209 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
210 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
211 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
212 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
213 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
214 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
215 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
216 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
217 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
218 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
219 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
220 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
221 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
222 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
223 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
224 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
225 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
226 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
227 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
228 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
229 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
230 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
231 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
232 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
233 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
234 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
235 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
236 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
237 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
238 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
239 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
240 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
241 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
242 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
243 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
244 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
245 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
246 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
247 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
248 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
249 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
250 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
251 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
252 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
253 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
254 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
255 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
256 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
257 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
258 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
259 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
260 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
261 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
262 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
263 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
264 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
265 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
266 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
267 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
268 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
269 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
270 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
271 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
272 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
273 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
274 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
275 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
276 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
277 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
278 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
279 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
280 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
281 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
282 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
283 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
284 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
285 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
286 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
287 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
288 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
289 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
290 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
291 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
292 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
293 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
294 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
295 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
296 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
297 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
298 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
299 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
300 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
301 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
302 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
303 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
304 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
305 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
306 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
307 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
308 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
309 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
310 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
311 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
312 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
313 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
314 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
315 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
316 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
317 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
318 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
319 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
320 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
321 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
322 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
323 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
324 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
325 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
326 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
327 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
328 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
329 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
330 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
331 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
332 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
333 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
334 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
335 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
336 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
337 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
338 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
339 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
340 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
341 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
342 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
343 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
344 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
345 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
346 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
347 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
348 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
349 2996887358 Rhizobium sp. R711 Isolate Nodule
350 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
351 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
352 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
353 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
354 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
355 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
356 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
357 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
358 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
359 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
360 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
361 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
362 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
363 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
364 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
365 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
366 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
367 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
368 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
369 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
370 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
371 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
372 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
373 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
374 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
375 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
376 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
377 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
378 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
379 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
380 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
381 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
382 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
383 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
384 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
385 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
386 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
387 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
388 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
389 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
390 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
391 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
392 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
393 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
394 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
395 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
396 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
397 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
398 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
399 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
400 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
401 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
402 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
403 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
404 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
405 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
406 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
407 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
408 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
409 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
410 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
411 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
412 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
413 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
414 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
415 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
416 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
417 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
418 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
419 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
420 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
421 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
422 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
423 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
424 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
425 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
426 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
427 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
428 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
429 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
430 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
431 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
432 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
433 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
434 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
435 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
436 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
437 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
438 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
439 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
440 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
441 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
442 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
443 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
444 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
445 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
446 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
447 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
448 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
449 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
450 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
451 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
452 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
453 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
454 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
455 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
456 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
457 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
458 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
459 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
460 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
461 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
462 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
463 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
464 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
465 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
466 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
467 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
468 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
469 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
470 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
471 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
472 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
473 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
474 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
475 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
476 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
477 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
478 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
479 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
480 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
481 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
482 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
483 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
484 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
485 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
486 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
487 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
488 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
489 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
490 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
491 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
492 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
493 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
494 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
495 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
496 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
497 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
498 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
499 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
500 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
501 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
502 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
503 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
504 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
505 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
506 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
507 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
508 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
509 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
510 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
511 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
512 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
513 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
514 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
515 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
516 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
517 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
518 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
519 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
520 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
521 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
522 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
523 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
524 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
525 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
526 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
527 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
528 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
529 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
530 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
531 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
532 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
533 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
534 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
535 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
536 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
537 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
538 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
539 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
540 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
541 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
542 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
543 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
544 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
545 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
546 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
547 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
548 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
549 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
550 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
551 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
552 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
553 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
554 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
555 8005258706 Rhizobium sp. R693 Isolate Nodule
556 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
557 8005321885 Rhizobium sp. R72 Isolate Nodule
558 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
559 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
560 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
561 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
562 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
563 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
564 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
565 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
566 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 46.1
Metatranscriptomes 0.14
Isolates 53.76

Biome Distribution

Category Percentage (%)
Aerial Root 0.72
Bulb 0
Endosphere 19.08
Nodule 41.76
Rhizoplane 2.17
Rhizosphere 21.1
Stem 0
Stem Tuber 0
Unclassified 15.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 RicEn_C4817 2010549000 Bacteria 1433
2 JGI24740J21852_10002325 3300001979 Bacteria 8648
3 JGI25155J39150_1000018 3300002704 Bacteria 157606
4 JGI25156J39149_1000055 3300002705 Bacteria 87733
5 JGI25162J39368_1001324 3300002737 Bacteria 13820
6 JGI25162J39368_1001456 3300002737 Bacteria 12524
7 JGI25154J39366_1000384 3300002738 Bacteria 24221
8 JGI25157J39369_1000076 3300002741 Bacteria 87678
9 JGI25152J39213_1000309 3300002773 Bacteria 31571
10 JGI25152J39213_1000648 3300002773 Bacteria 18401
11 JGI25152J39213_1001491 3300002773 Bacteria 9993
12 JGI25150J39212_1000018 3300002774 Bacteria 146535
13 JGI25150J39212_1004106 3300002774 Bacteria 3287
14 JGI25159J45721_1005441 3300002987 Bacteria 3997
15 JGI25151J46595_10000034 3300003187 Bacteria 192271
16 JGI25151J46595_10013528 3300003187 Bacteria 3669
17 JGI25165J46597_1001191 3300003214 Bacteria 15787
18 JGI25165J46597_1001335 3300003214 Bacteria 13869
19 JGI25153J46596_10003823 3300003215 Bacteria 8300
20 JGI25153J46596_10005428 3300003215 Bacteria 6696
21 rootH1_10226648 3300003323 Bacteria 1801
22 JGI25160J50197_1000051 3300003354 Bacteria 132923
23 JGI25160J50197_1000056 3300003354 Bacteria 119463
24 JGI25161J50226_1000011 3300003374 Bacteria 210140
25 JGI25161J50226_1000192 3300003374 Bacteria 39913
26 Ga0055526_1001303 3300003771 Bacteria 17875
27 Ga0055526_1001461 3300003771 Bacteria 16772
28 Ga0055524_1002221 3300003775 Bacteria 10181
29 Ga0055524_1003944 3300003775 Bacteria 7024
30 Ga0055530_10009538 3300003791 Bacteria 3714
31 Ga0055540_1000886 3300003792 Bacteria 19743
32 Ga0055543_1000041 3300004625 Bacteria 118501
33 Ga0055543_1000180 3300004625 Bacteria 52220
34 Ga0055543_1001069 3300004625 Bacteria 12064
35 Ga0065165_1000155 3300005262 Bacteria 119501
36 Ga0065165_1000303 3300005262 Bacteria 82513
37 Ga0070670_100000217 3300005331 Bacteria 53128
38 Ga0070668_100015599 3300005347 Bacteria 5679
39 Ga0070669_100116709 3300005353 Bacteria 2032
40 Ga0070667_100094799 3300005367 Bacteria 2572
41 Ga0070667_100106501 3300005367 Bacteria 2427
42 Ga0070665_100173427 3300005548 Bacteria 2158
43 Ga0075365_10000540 3300006038 Bacteria 14537
44 Ga0075365_10017204 3300006038 Bacteria 4417
45 Ga0075365_10037932 3300006038 Bacteria 3129
46 Ga0075368_10020936 3300006042 Bacteria 2480
47 Ga0075363_100011555 3300006048 Bacteria 4232
48 Ga0075363_100042115 3300006048 Bacteria 2411
49 Ga0075364_10025671 3300006051 Bacteria 3752
50 Ga0075362_10000994 3300006177 Bacteria 8685
51 Ga0075362_10049075 3300006177 Bacteria 1884
52 Ga0075367_10007501 3300006178 Bacteria 5590
53 Ga0075367_10016750 3300006178 Bacteria 4007
54 Ga0075367_10036179 3300006178 Bacteria 2861
55 Ga0075369_10001016 3300006186 Bacteria 9361
56 Ga0075369_10001058 3300006186 Bacteria 9208
57 Ga0075366_10026085 3300006195 Bacteria 3420
58 Ga0079104_1010553 3300006946 Bacteria 3035
59 Ga0105251_10007113 3300009011 Bacteria 6966
60 Ga0105244_10023759 3300009036 Bacteria 3356
61 Ga0105250_10024304 3300009092 Bacteria 2441
62 Ga0105247_10222388 3300009101 Bacteria 1278
63 Ga0105243_10020415 3300009148 Bacteria 5023
64 Ga0105248_10017883 3300009177 Bacteria 7823
65 Ga0105237_10003956 3300009545 Bacteria 17343
66 Ga0123341_1042294 3300009765 Bacteria 2894
67 Ga0123342_1005926 3300009766 Bacteria 17311
68 Ga0105239_10005695 3300010375 Bacteria 14553
69 Ga0105246_10171232 3300011119 Bacteria 1663
70 Ga0157373_10025263 3300013100 Bacteria 4298
71 Ga0157371_10000071 3300013102 Bacteria 164088
72 Ga0157370_10000079 3300013104 Bacteria 107305
73 Ga0157370_10012926 3300013104 Bacteria 8628
74 Ga0157370_10122743 3300013104 Bacteria 2425
75 Ga0157369_10065808 3300013105 Bacteria 3900
76 Ga0182007_10003879 3300015262 Bacteria 6935
77 Ga0182005_1008112 3300015265 Bacteria 3110
78 Ga0183363_1113 3300015690 Bacteria 22078
79 Ga0163161_10111884 3300017792 Bacteria 2042
80 Ga0214542_1000064 3300021321 Bacteria 127681
81 Ga0214543_1000063 3300021327 Bacteria 127694
82 Ga0228710_1000002 3300022740 Bacteria 287279
83 Ga0209435_100031 3300025206 Bacteria 164115
84 Ga0209436_100013 3300025208 Bacteria 131492
85 Ga0209436_104486 3300025208 Bacteria 3445
86 Ga0209563_103848 3300025230 Bacteria 3002
87 Ga0209437_100179 3300025233 Bacteria 134210
88 Ga0209437_100181 3300025233 Bacteria 132953
89 Ga0207425_1000035 3300025245 Bacteria 225942
90 Ga0207425_1001049 3300025245 Bacteria 12800
91 Ga0207425_1018977 3300025245 Bacteria 1487
92 Ga0209646_1000102 3300025246 Bacteria 164115
93 Ga0209646_1002136 3300025246 Bacteria 4591
94 Ga0209026_1000096 3300025250 Bacteria 164115
95 Ga0209759_1000090 3300025256 Bacteria 164115
96 Ga0209129_1000029 3300025258 Bacteria 401149
97 Ga0209129_1000409 3300025258 Bacteria 33785
98 Ga0209129_1000988 3300025258 Bacteria 17029
99 Ga0209129_1000993 3300025258 Bacteria 16985
100 Ga0209129_1001100 3300025258 Bacteria 15745
101 Ga0209129_1001572 3300025258 Bacteria 12539
102 Ga0209129_1009813 3300025258 Bacteria 2466
103 Ga0209233_1000185 3300025261 Bacteria 133788
104 Ga0209233_1000475 3300025261 Bacteria 24854
105 Ga0209233_1000514 3300025261 Bacteria 22716
106 Ga0209673_1000370 3300025273 Bacteria 81047
107 Ga0209673_1006786 3300025273 Bacteria 5440
108 Ga0209130_1000009 3300025284 Bacteria 498952
109 Ga0209130_1000058 3300025284 Bacteria 210250
110 Ga0209130_1000133 3300025284 Bacteria 119561
111 Ga0209130_1012418 3300025284 Bacteria 2231
112 Ga0209675_1017808 3300025291 Bacteria 2015
113 Ga0209025_1000132 3300025294 Bacteria 197432
114 Ga0209025_1000914 3300025294 Bacteria 45435
115 Ga0209025_1001178 3300025294 Bacteria 37028
116 Ga0209025_1003820 3300025294 Bacteria 13750
117 Ga0209025_1003970 3300025294 Bacteria 13280
118 Ga0209025_1010458 3300025294 Bacteria 6283
119 Ga0209025_1017689 3300025294 Bacteria 4096
120 Ga0209564_1000738 3300025295 Bacteria 46490
121 Ga0209564_1002121 3300025295 Bacteria 16824
122 Ga0209564_1002842 3300025295 Bacteria 12751
123 Ga0209564_1003680 3300025295 Bacteria 10120
124 Ga0209564_1011785 3300025295 Bacteria 3882
125 Ga0209564_1014726 3300025295 Bacteria 3230
126 Ga0209758_1001061 3300025297 Bacteria 35810
127 Ga0209758_1001207 3300025297 Bacteria 32535
128 Ga0209758_1001208 3300025297 Bacteria 32514
129 Ga0209758_1002613 3300025297 Bacteria 17931
130 Ga0209758_1002888 3300025297 Bacteria 16624
131 Ga0209050_1004529 3300025298 Bacteria 9343
132 Ga0209256_1000459 3300025299 Bacteria 61577
133 Ga0209256_1001010 3300025299 Bacteria 33243
134 Ga0209256_1001829 3300025299 Bacteria 19892
135 Ga0209256_1004467 3300025299 Bacteria 8754
136 Ga0209256_1008200 3300025299 Bacteria 4905
137 Ga0207426_1000131 3300025302 Bacteria 210250
138 Ga0207426_1000214 3300025302 Bacteria 137296
139 Ga0207426_1000248 3300025302 Bacteria 119561
140 Ga0207426_1000450 3300025302 Bacteria 65777
141 Ga0207426_1000747 3300025302 Bacteria 36594
142 Ga0209051_1001765 3300025303 Bacteria 17171
143 Ga0209051_1002754 3300025303 Bacteria 12165
144 Ga0209051_1015450 3300025303 Bacteria 3509
145 Ga0209257_1003933 3300025304 Bacteria 12073
146 Ga0209257_1021078 3300025304 Bacteria 2380
147 Ga0207713_1053816 3300025735 Bacteria 1582
148 Ga0207695_10000234 3300025913 Bacteria 146987
149 Ga0207671_10000234 3300025914 Bacteria 83448
150 Ga0207681_10048360 3300025923 Bacteria 2870
151 Ga0207650_10001202 3300025925 Bacteria 19013
152 Ga0207711_10031519 3300025941 Bacteria 4476
153 Ga0207712_10107929 3300025961 Bacteria 2082
154 Ga0207658_10032061 3300025986 Bacteria 3737
155 Ga0207658_10040948 3300025986 Bacteria 3352
156 Ga0209281_1000030 3300027111 Bacteria 425931
157 Ga0209281_1000893 3300027111 Bacteria 25367
158 Ga0209282_1000004 3300027666 Bacteria 425931
159 Ga0209813_10001006 3300027866 Bacteria 6324
160 Ga0209813_10006588 3300027866 Bacteria 2874
161 Ga0268266_10061332 3300028379 Bacteria 3243
162 Ga0268266_10075558 3300028379 Bacteria 2927
163 Ga0307515_10001473 3300028794 Bacteria 52908
164 Ga0307515_10004817 3300028794 Bacteria 27624
165 Ga0268256_1005620 3300030500 Bacteria 4873
166 Ga0307513_10000926 3300031456 Bacteria 42368
167 Ga0307408_100131027 3300031548 Bacteria 1956
168 Ga0307410_10034299 3300031852 Bacteria 3286
169 Ga0307406_10009129 3300031901 Bacteria 5552
170 Ga0307412_10000806 3300031911 Bacteria 18035
171 Ga0315914_1000001 3300031967 Bacteria 416633
172 Ga0307414_10284346 3300032004 Bacteria 1391
173 Ga0315913_1000022 3300033430 Bacteria 94546
174 Ga0315915_1000002 3300033464 Bacteria 425854
175 Ga0373935_0131629 3300035692 Bacteria 1681
176 Ga0373927_0000068 3300035695 Bacteria 75823
177 Ga0316584_0233652 3300036712 Bacteria 1347
178 Ga0373925_0013020 3300037068 Bacteria 6023
179 Ga0395900_0057051 3300037418 Bacteria 4020
180 Ga0395905_0003872 3300037471 Bacteria 15790
181 Ga0395905_0011176 3300037471 Bacteria 8679
182 Ga0395905_0020145 3300037471 Bacteria 6318
183 Ga0495617_025522 3300046452 Bacteria 1992
184 Ga0495629_0190010 3300046459 Bacteria 1421
185 Ga0495638_0013686 3300046460 Bacteria 5512
186 Ga0495651_0156158 3300046462 Bacteria 1639
187 Ga0495605_0001553 3300046474 Bacteria 14915
188 Ga0495662_0038297 3300046476 Bacteria 2317
189 Ga0495585_0008650 3300046492 Bacteria 6157
190 Ga0495608_0107052 3300046511 Bacteria 1800
191 Ga0495610_0014968 3300046512 Bacteria 4531
192 Ga0495610_0061238 3300046512 Bacteria 1789
193 Ga0495620_0009436 3300046515 Bacteria 5191
194 Ga0495631_0002795 3300046518 Bacteria 9684
195 Ga0495632_0043369 3300046519 Bacteria 2248
196 Ga0495632_0062213 3300046519 Bacteria 1810
197 Ga0495643_0151590 3300046522 Bacteria 1148
198 Ga0495648_0042495 3300046524 Bacteria 2859
199 Ga0495652_0082521 3300046529 Bacteria 2649
200 Ga0495609_0014836 3300046538 Bacteria 3656
201 Ga0495622_0005652 3300046557 Bacteria 5796
202 Ga0495633_0011714 3300046558 Bacteria 4710
203 Ga0495611_0031931 3300046648 Bacteria 2320
204 Ga0495635_0016067 3300046663 Bacteria 5228
205 Ga0495658_0094898 3300046683 Bacteria 1772
206 Ga0495670_0142347 3300046691 Bacteria 1255
207 Ga0495600_0077144 3300046809 Bacteria 2176
208 Ga0495660_0087028 3300046810 Bacteria 1630
209 Ga0495604_0095947 3300047317 Bacteria 2189
210 Ga0495687_040153 3300047443 Bacteria 2064
211 Ga0495686_0006107 3300047472 Bacteria 9329
212 Ga0495686_0012893 3300047472 Bacteria 5827
213 Ga0495686_0036909 3300047472 Bacteria 3134
214 Ga0495686_0125233 3300047472 Bacteria 1528
215 Ga0495602_0071719 3300048088 Bacteria 2957
216 Ga0496101_0125194 3300048904 Bacteria 1947
217 Ga0496102_0224887 3300048905 Bacteria 1769
218 Ga0496103_0068735 3300048906 Bacteria 2214
219 Ga0496104_0248019 3300048907 Bacteria 1693
220 Ga0496106_0002784 3300048909 Bacteria 12961
221 Ga0496106_0120326 3300048909 Bacteria 2052
222 Ga0496109_0540691 3300048912 Bacteria 1099
223 Ga0496110_0233955 3300048913 Bacteria 1671
224 Ga0496113_0054392 3300048916 Bacteria 2997
225 Ga0496113_0179072 3300048916 Bacteria 1680
226 Ga0496116_0000057 3300048919 Bacteria 281652
227 Ga0496116_0027870 3300048919 Bacteria 4103
228 Ga0496116_0042171 3300048919 Bacteria 3123
229 Ga0496116_0042300 3300048919 Bacteria 3116
230 Ga0496116_0049733 3300048919 Bacteria 2799
231 Ga0496117_0000031 3300048920 Bacteria 381048
232 Ga0496118_0003703 3300048921 Bacteria 18940
233 Ga0496118_0008891 3300048921 Bacteria 10264
234 Ga0496119_0010805 3300048922 Bacteria 7640
235 Ga0496119_0012902 3300048922 Bacteria 6727
236 Ga0496119_0015744 3300048922 Bacteria 5799
237 Ga0496119_0022066 3300048922 Bacteria 4573
238 Ga0496119_0093962 3300048922 Bacteria 1698
239 Ga0496120_0000387 3300048923 Bacteria 71224
240 Ga0496120_0022613 3300048923 Bacteria 3953
241 Ga0496120_0136377 3300048923 Bacteria 1251
242 Ga0496121_0000034 3300048924 Bacteria 377095
243 Ga0496121_0006139 3300048924 Bacteria 15083
244 Ga0496121_0028052 3300048924 Bacteria 5250
245 Ga0496121_0039608 3300048924 Bacteria 4148
246 Ga0496122_0000023 3300048925 Bacteria 381035
247 Ga0496122_0078815 3300048925 Bacteria 2305
248 Ga0496122_0088955 3300048925 Bacteria 2113
249 Ga0496122_0176027 3300048925 Bacteria 1282
250 Ga0496123_0000027 3300048926 Bacteria 306773
251 Ga0496123_0000067 3300048926 Bacteria 209159
252 Ga0496123_0014786 3300048926 Bacteria 6444
253 Ga0496123_0052199 3300048926 Bacteria 2715
254 Ga0496124_0019498 3300048927 Bacteria 6308
255 Ga0496124_0048867 3300048927 Bacteria 3611
256 Ga0496124_0068788 3300048927 Bacteria 2941
257 Ga0496124_0088039 3300048927 Bacteria 2539
258 Ga0496124_0135385 3300048927 Bacteria 1951
259 Ga0496124_0146516 3300048927 Bacteria 1857
260 Ga0496125_0000030 3300048928 Bacteria 375023
261 Ga0496125_0028089 3300048928 Bacteria 5087
262 Ga0496125_0112171 3300048928 Bacteria 1971
263 Ga0496125_0141899 3300048928 Bacteria 1668
264 Ga0496126_0000115 3300048929 Bacteria 188546
265 Ga0496126_0186008 3300048929 Bacteria 1761
266 Ga0495678_016594 3300049459 Bacteria 3362
267 Ga0495678_048518 3300049459 Bacteria 1655
268 Ga0501031_0021541 3300049568 Bacteria 4202
269 Ga0501032_0176241 3300049569 Bacteria 1401
270 Ga0501033_0000281 3300049570 Bacteria 49116
271 Ga0501033_0000304 3300049570 Bacteria 46485
272 Ga0501034_0247447 3300049571 Bacteria 1728
273 Ga0501037_0000154 3300049573 Bacteria 64077
274 Ga0501037_0071028 3300049573 Bacteria 2533
275 Ga0501043_0000007 3300049579 Bacteria 224595
276 Ga0501043_0089540 3300049579 Bacteria 2419
277 Ga0501047_0045061 3300049581 Bacteria 4264
278 Ga0501067_0079750 3300049583 Bacteria 1814
279 Ga0501069_0000027 3300049585 Bacteria 106217
280 Ga0501070_0000215 3300049586 Bacteria 54743
281 Ga0501070_0000650 3300049586 Bacteria 31944
282 Ga0501071_0014470 3300049587 Bacteria 5396
283 Ga0501074_0000066 3300049590 Bacteria 50258
284 Ga0501080_0000542 3300049742 Bacteria 29722
285 Ga0501080_0003548 3300049742 Bacteria 13744
286 Ga0501083_0000012 3300049744 Bacteria 178668
287 Ga0501280_005297 3300049776 Bacteria 1848
288 Ga0501035_0000073 3300049822 Bacteria 122603
289 Ga0501035_0000374 3300049822 Bacteria 51467
290 Ga0501035_0000607 3300049822 Bacteria 39537
291 Ga0501035_0020041 3300049822 Bacteria 6143
292 Ga0501044_0000118 3300049823 Bacteria 95218
293 Ga0501044_0031664 3300049823 Bacteria 5565
294 nmdc:mga03683_19564_c1 3300050489 Bacteria 2586
295 nmdc:mga03683_63760_c1 3300050489 Bacteria 1563
296 nmdc:mga00v17_15_c1 3300050491 Bacteria 126234
297 nmdc:mga0yw44_18381_c1 3300050492 Bacteria 3827
298 nmdc:mga0yw44_45077_c1 3300050492 Bacteria 2642
299 nmdc:mga0k408_18949_c1 3300050493 Bacteria 3843
300 nmdc:mga06z11_56681_c1 3300050494 Bacteria 2028
301 nmdc:mga04h51_10397_c1 3300050495 Bacteria 2555
302 nmdc:mga0sz30_661_c1 3300050516 Bacteria 12749
303 Ga0500557_009180 3300053105 Bacteria 2410
304 Ga0500560_061485 3300053107 Bacteria 1225
305 Ga0500569_004387 3300053109 Bacteria 2962
306 Ga0500572_066528 3300053111 Bacteria 1105
307 Ga0500561_0010487 3300053137 Bacteria 1917
308 Ga0500568_0001281 3300053139 Bacteria 16548
309 Ga0500573_0012507 3300053140 Bacteria 4766
310 Ga0500590_035757 3300053148 Bacteria 2569
311 Ga0500604_0041809 3300053151 Bacteria 1387
312 Ga0500616_0003287 3300053153 Bacteria 12474
313 Ga0500616_0051342 3300053153 Bacteria 2173
314 Ga0500624_000897 3300053157 Bacteria 6346
315 Ga0500634_0002218 3300053161 Bacteria 8090
316 Ga0500636_0000030 3300053177 Bacteria 77501
317 Ga0500636_0006262 3300053177 Bacteria 6824
318 Ga0500636_0082485 3300053177 Bacteria 1851
319 Ga0500645_027846 3300053730 Bacteria 1712
320 Ga0587069_010412 3300059642 Bacteria 1223

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006038 Ga0075365_10017204 Ga0075365_100172045 295
2 3300006177 Ga0075362_10049075 Ga0075362_100490752 295
3 3300050489 nmdc:mga03683_19564_c1 nmdc:mga03683_19564_c1_168_1127 295
4 3300050492 nmdc:mga0yw44_18381_c1 nmdc:mga0yw44_18381_c1_1280_2239 295
5 3300053177 Ga0500636_0000030 Ga0500636_0000030_67018_67980 302
6 iso_pu_bacteria 2913308742 2913312021 304
7 3300006038 Ga0075365_10000540 Ga0075365_100005403 305
8 3300006186 Ga0075369_10001016 Ga0075369_100010163 305
9 3300009765 Ga0123341_1042294 Ga0123341_10422942 305
10 3300009766 Ga0123342_1005926 Ga0123342_10059262 305
11 iso_pu_bacteria 2738541317 2738947150 305
12 3300049568 Ga0501031_0021541 Ga0501031_0021541_2050_3042 308
13 3300049570 Ga0501033_0000304 Ga0501033_0000304_14461_15453 308
14 3300049573 Ga0501037_0000154 Ga0501037_0000154_56377_57369 308
15 3300049579 Ga0501043_0000007 Ga0501043_0000007_25135_26127 308
16 3300049583 Ga0501067_0079750 Ga0501067_0079750_275_1267 308
17 3300049585 Ga0501069_0000027 Ga0501069_0000027_80086_81078 308
18 3300049586 Ga0501070_0000650 Ga0501070_0000650_15840_16832 308
19 3300049587 Ga0501071_0014470 Ga0501071_0014470_1305_2297 308
20 3300049590 Ga0501074_0000066 Ga0501074_0000066_30387_31379 308
21 3300049742 Ga0501080_0003548 Ga0501080_0003548_7016_8008 308
22 3300049744 Ga0501083_0000012 Ga0501083_0000012_152385_153377 308
23 3300049822 Ga0501035_0000073 Ga0501035_0000073_52634_53626 308
24 3300049823 Ga0501044_0000118 Ga0501044_0000118_69064_70056 308
25 3300013104 Ga0157370_10122743 Ga0157370_101227432 309
26 3300013105 Ga0157369_10065808 Ga0157369_100658083 309
27 3300037471 Ga0395905_0011176 Ga0395905_0011176_7440_8483 309
28 3300048926 Ga0496123_0000067 Ga0496123_0000067_11982_12974 309
29 3300048927 Ga0496124_0088039 Ga0496124_0088039_723_1715 309
30 3300053153 Ga0500616_0051342 Ga0500616_0051342_351_1298 309
31 iso_pu_bacteria 2513237305 2514418232 309
32 iso_pu_bacteria 2597489875 2597810401 309
33 iso_pu_bacteria 2721755686 2723573059 309
34 iso_pu_bacteria 2738543024 2739310284 309
35 iso_pu_bacteria 2841734538 2841736214 309
36 iso_pu_bacteria 2869162929 2869165333 309
37 iso_pu_bacteria 2869169390 2869176200 309
38 iso_pu_bacteria 2869242130 2869248043 309
39 iso_pu_bacteria 2869256925 2869257089 309
40 iso_pu_bacteria 2871474448 2871480367 309
41 iso_pu_bacteria 2871481445 2871483979 309
42 iso_pu_bacteria 2874116593 2874122036 309
43 iso_pu_bacteria 2876386047 2876386523 309
44 iso_pu_bacteria 2876420981 2876424500 309
45 iso_pu_bacteria 2878788777 2878789376 309
46 iso_pu_bacteria 2882632389 2882634575 309
47 iso_pu_bacteria 2906401398 2906407331 309
48 iso_pu_bacteria 2924741084 2924741088 309
49 iso_pu_bacteria 2937836603 2937840585 309
50 iso_pu_bacteria 2937861824 2937866116 309
51 iso_pu_bacteria 2937980651 2937982378 309
52 iso_pu_bacteria 2958071322 2958077176 309
53 iso_pu_bacteria 2958108152 2958109040 309
54 iso_pu_bacteria 2961183825 2961184396 309
55 iso_pu_bacteria 2968138860 2968144376 309
56 iso_pu_bacteria 2970532167 2970535520 309
57 iso_pu_bacteria 2970619444 2970619868 309
58 iso_pu_bacteria 2970627176 2970628669 309
59 iso_pu_bacteria 2977851361 2977855249 309
60 iso_pu_bacteria 2977907340 2977909181 309
61 iso_pu_bacteria 2979764755 2979768470 309
62 iso_pu_bacteria 2979772303 2979772713 309
63 iso_pu_bacteria 3004248173 3004250432 309
64 iso_pu_bacteria 8004312739 8004316559 309
65 iso_pu_bacteria 8004633249 8004640002 309
66 3300028794 Ga0307515_10004817 Ga0307515_1000481715 310
67 3300037418 Ga0395900_0057051 Ga0395900_0057051_2802_3767 310
68 3300037471 Ga0395905_0020145 Ga0395905_0020145_1962_2927 310
69 3300049571 Ga0501034_0247447 Ga0501034_0247447_14_955 310
70 iso_pu_bacteria 2513237088 2513600139 310
71 iso_pu_bacteria 8005658619 8005661018 310
72 iso_pu_bacteria 8055431914 8055433011 310
73 3300003187 JGI25151J46595_10013528 JGI25151J46595_100135282 311
74 3300003354 JGI25160J50197_1000056 JGI25160J50197_100005611 311
75 3300003374 JGI25161J50226_1000192 JGI25161J50226_100019226 311
76 3300003771 Ga0055526_1001303 Ga0055526_10013032 311
77 3300003775 Ga0055524_1002221 Ga0055524_10022215 311
78 3300003791 Ga0055530_10009538 Ga0055530_100095384 311
79 3300004625 Ga0055543_1000180 Ga0055543_100018011 311
80 3300005262 Ga0065165_1000155 Ga0065165_100015512 311
81 3300015690 Ga0183363_1113 Ga0183363_11135 311
82 3300025208 Ga0209436_104486 Ga0209436_1044862 311
83 3300025284 Ga0209130_1000133 Ga0209130_100013311 311
84 3300025284 Ga0209130_1012418 Ga0209130_10124181 311
85 3300025294 Ga0209025_1000914 Ga0209025_100091427 311
86 3300025294 Ga0209025_1003820 Ga0209025_100382011 311
87 3300025294 Ga0209025_1017689 Ga0209025_10176895 311
88 3300025295 Ga0209564_1000738 Ga0209564_100073812 311
89 3300025295 Ga0209564_1002842 Ga0209564_10028429 311
90 3300025298 Ga0209050_1004529 Ga0209050_10045296 311
91 3300025299 Ga0209256_1001010 Ga0209256_10010109 311
92 3300025299 Ga0209256_1001829 Ga0209256_100182911 311
93 3300025299 Ga0209256_1008200 Ga0209256_10082002 311
94 3300025302 Ga0207426_1000248 Ga0207426_100024811 311
95 3300025304 Ga0209257_1021078 Ga0209257_10210782 311
96 3300046460 Ga0495638_0013686 Ga0495638_0013686_490_1464 311
97 3300048919 Ga0496116_0000057 Ga0496116_0000057_9520_10542 311
98 3300049579 Ga0501043_0089540 Ga0501043_0089540_678_1637 311
99 3300059642 Ga0587069_010412 Ga0587069_010412_46_990 311
100 iso_pu_bacteria 2508501122 2509108798 311
101 iso_pu_bacteria 2509276019 2509377929 311
102 iso_pu_bacteria 2510065057 2510308492 311
103 iso_pu_bacteria 2511231052 2511498652 311
104 iso_pu_bacteria 2512047086 2512534800 311
105 iso_pu_bacteria 2512875026 2512973386 311
106 iso_pu_bacteria 2513237086 2513587723 311
107 iso_pu_bacteria 2513237089 2513602096 311
108 iso_pu_bacteria 2513237091 2513619916 311
109 iso_pu_bacteria 2513237140 2513886701 311
110 iso_pu_bacteria 2513237143 2513904720 311
111 iso_pu_bacteria 2513237156 2513983550 311
112 iso_pu_bacteria 2513237160 2514003305 311
113 iso_pu_bacteria 2515154107 2515612369 311
114 iso_pu_bacteria 2516653046 2516894929 311
115 iso_pu_bacteria 2517487022 2517571611 311
116 iso_pu_bacteria 2524023207 2524450254 311
117 iso_pu_bacteria 2551306084 2551674321 311
118 iso_pu_bacteria 2551306084 2551677861 311
119 iso_pu_bacteria 2551306085 2551686201 311
120 iso_pu_bacteria 2551306086 2551694971 311
121 iso_pu_bacteria 2551306087 2551700337 311
122 iso_pu_bacteria 2551306089 2551710721 311
123 iso_pu_bacteria 2551306090 2551722898 311
124 iso_pu_bacteria 2551306091 2551731173 311
125 iso_pu_bacteria 2551306092 2551734672 311
126 iso_pu_bacteria 2551306093 2551746479 311
127 iso_pu_bacteria 2582581865 2585388294 311
128 iso_pu_bacteria 2582581866 2585396109 311
129 iso_pu_bacteria 2643221607 2644052509 311
130 iso_pu_bacteria 2643221636 2644201108 311
131 iso_pu_bacteria 2643221686 2644484787 311
132 iso_pu_bacteria 2643221688 2644492489 311
133 iso_pu_bacteria 2643221689 2644501309 311
134 iso_pu_bacteria 2657244999 2657682245 311
135 iso_pu_bacteria 2690316117 2692319771 311
136 iso_pu_bacteria 2751185821 2753458412 311
137 iso_pu_bacteria 2775506902 2776269506 311
138 iso_pu_bacteria 2775506904 2776282436 311
139 iso_pu_bacteria 2791355082 2792582403 311
140 iso_pu_bacteria 2791355091 2792621743 311
141 iso_pu_bacteria 2791355092 2792629000 311
142 iso_pu_bacteria 2791355094 2792640144 311
143 iso_pu_bacteria 2802428858 2802717024 311
144 iso_pu_bacteria 2802428859 2802724988 311
145 iso_pu_bacteria 2802428860 2802729738 311
146 iso_pu_bacteria 2802428861 2802737084 311
147 iso_pu_bacteria 2802428862 2802743489 311
148 iso_pu_bacteria 2802428863 2802749385 311
149 iso_pu_bacteria 2802429268 2804753860 311
150 iso_pu_bacteria 2818991272 2819244135 311
151 iso_pu_bacteria 2840764183 2840766434 311
152 iso_pu_bacteria 2842521101 2842527127 311
153 iso_pu_bacteria 2847417321 2847421004 311
154 iso_pu_bacteria 2848992105 2848995838 311
155 iso_pu_bacteria 2850079185 2850082815 311
156 iso_pu_bacteria 2855825444 2855827562 311
157 iso_pu_bacteria 2855839649 2855842937 311
158 iso_pu_bacteria 2855872281 2855873699 311
159 iso_pu_bacteria 2858800743 2858801354 311
160 iso_pu_bacteria 2913295892 2913300350 311
161 iso_pu_bacteria 2915980308 2915981649 311
162 iso_pu_bacteria 2915986958 2915989716 311
163 iso_pu_bacteria 2915993759 2916000676 311
164 iso_pu_bacteria 2916000859 2916007593 311
165 iso_pu_bacteria 2916007675 2916014255 311
166 iso_pu_bacteria 2916014648 2916021423 311
167 iso_pu_bacteria 2916021584 2916028030 311
168 iso_pu_bacteria 2916028427 2916034685 311
169 iso_pu_bacteria 2916035215 2916041071 311
170 iso_pu_bacteria 2916041962 2916048230 311
171 iso_pu_bacteria 2916048683 2916054418 311
172 iso_pu_bacteria 2916055098 2916061013 311
173 iso_pu_bacteria 2916061851 2916066420 311
174 iso_pu_bacteria 2916068649 2916075453 311
175 iso_pu_bacteria 2916076590 2916076809 311
176 iso_pu_bacteria 2920760137 2920760149 311
177 iso_pu_bacteria 2921201388 2921207777 311
178 iso_pu_bacteria 2921208531 2921208884 311
179 iso_pu_bacteria 2921237296 2921243631 311
180 iso_pu_bacteria 2921244191 2921248326 311
181 iso_pu_bacteria 2921250672 2921252737 311
182 iso_pu_bacteria 2921257292 2921263100 311
183 iso_pu_bacteria 2921263974 2921270120 311
184 iso_pu_bacteria 2921282425 2921283665 311
185 iso_pu_bacteria 2921289301 2921290269 311
186 iso_pu_bacteria 2921296804 2921303998 311
187 iso_pu_bacteria 2924144063 2924147702 311
188 iso_pu_bacteria 2924150972 2924157810 311
189 iso_pu_bacteria 2924158325 2924158719 311
190 iso_pu_bacteria 2924165586 2924166016 311
191 iso_pu_bacteria 2924172951 2924178935 311
192 iso_pu_bacteria 2924179722 2924184400 311
193 iso_pu_bacteria 2924186466 2924193040 311
194 iso_pu_bacteria 2924193448 2924199608 311
195 iso_pu_bacteria 2924200457 2924206407 311
196 iso_pu_bacteria 2924207177 2924214021 311
197 iso_pu_bacteria 2924214083 2924220938 311
198 iso_pu_bacteria 2924221636 2924222024 311
199 iso_pu_bacteria 2924228884 2924234631 311
200 iso_pu_bacteria 2936996657 2936997499 311
201 iso_pu_bacteria 2937002841 2937008968 311
202 iso_pu_bacteria 2937009748 2937015700 311
203 iso_pu_bacteria 2937016420 2937020941 311
204 iso_pu_bacteria 2937023124 2937028430 311
205 iso_pu_bacteria 2937029754 2937031661 311
206 iso_pu_bacteria 2937036028 2937041405 311
207 iso_pu_bacteria 2937042894 2937049553 311
208 iso_pu_bacteria 2937049772 2937056490 311
209 iso_pu_bacteria 2937056579 2937063822 311
210 iso_pu_bacteria 2937063883 2937070563 311
211 iso_pu_bacteria 2937071275 2937077965 311
212 iso_pu_bacteria 2937078374 2937081554 311
213 iso_pu_bacteria 2937084907 2937090814 311
214 iso_pu_bacteria 2937091812 2937098522 311
215 iso_pu_bacteria 2937098957 2937102890 311
216 iso_pu_bacteria 2937106411 2937109727 311
217 iso_pu_bacteria 2937113482 2937118590 311
218 iso_pu_bacteria 2937119839 2937124140 311
219 iso_pu_bacteria 2937126314 2937132252 311
220 iso_pu_bacteria 2957375807 2957376728 311
221 iso_pu_bacteria 2957382221 2957388485 311
222 iso_pu_bacteria 2957388812 2957395133 311
223 iso_pu_bacteria 2957395598 2957401881 311
224 iso_pu_bacteria 2957402308 2957408522 311
225 iso_pu_bacteria 2957408893 2957414258 311
226 iso_pu_bacteria 2957422303 2957429274 311
227 iso_pu_bacteria 2957430029 2957436747 311
228 iso_pu_bacteria 2957437181 2957441735 311
229 iso_pu_bacteria 2957443900 2957448325 311
230 iso_pu_bacteria 2957450854 2957457055 311
231 iso_pu_bacteria 2957457609 2957464499 311
232 iso_pu_bacteria 2957464669 2957470407 311
233 iso_pu_bacteria 2957471148 2957477877 311
234 iso_pu_bacteria 2957478035 2957479989 311
235 iso_pu_bacteria 2957484790 2957491339 311
236 iso_pu_bacteria 2957491536 2957497597 311
237 iso_pu_bacteria 2957498199 2957504971 311
238 iso_pu_bacteria 2957505466 2957512964 311
239 iso_pu_bacteria 2960584000 2960584291 311
240 iso_pu_bacteria 2960591022 2960592864 311
241 iso_pu_bacteria 2960597568 2960602700 311
242 iso_pu_bacteria 2960603979 2960610648 311
243 iso_pu_bacteria 2960610863 2960616816 311
244 iso_pu_bacteria 2960617483 2960619028 311
245 iso_pu_bacteria 2960624210 2960631083 311
246 iso_pu_bacteria 2960631154 2960635527 311
247 iso_pu_bacteria 2960637947 2960638895 311
248 iso_pu_bacteria 2960645483 2960646175 311
249 iso_pu_bacteria 2960652885 2960660200 311
250 iso_pu_bacteria 2960660292 2960664876 311
251 iso_pu_bacteria 2960667422 2960673141 311
252 iso_pu_bacteria 2960674078 2960675241 311
253 iso_pu_bacteria 2960680706 2960681789 311
254 iso_pu_bacteria 2960687367 2960693546 311
255 iso_pu_bacteria 2960693952 2960700715 311
256 iso_pu_bacteria 2964607997 2964608253 311
257 iso_pu_bacteria 2964615318 2964621518 311
258 iso_pu_bacteria 2964621998 2964622984 311
259 iso_pu_bacteria 2964628898 2964635639 311
260 iso_pu_bacteria 2964636051 2964642961 311
261 iso_pu_bacteria 2964643177 2964649063 311
262 iso_pu_bacteria 2964649959 2964655149 311
263 iso_pu_bacteria 2964656573 2964660042 311
264 iso_pu_bacteria 2964663802 2964670837 311
265 iso_pu_bacteria 2964670856 2964671655 311
266 iso_pu_bacteria 2964678106 2964678364 311
267 iso_pu_bacteria 2964685014 2964685754 311
268 iso_pu_bacteria 2964691889 2964698580 311
269 iso_pu_bacteria 2964698721 2964705052 311
270 iso_pu_bacteria 2964705432 2964712231 311
271 iso_pu_bacteria 2964712639 2964713174 311
272 iso_pu_bacteria 2964719344 2964726777 311
273 iso_pu_bacteria 2967664464 2967670437 311
274 iso_pu_bacteria 2967671571 2967672358 311
275 iso_pu_bacteria 2967678726 2967681311 311
276 iso_pu_bacteria 2967686174 2967692363 311
277 iso_pu_bacteria 2967693043 2967696528 311
278 iso_pu_bacteria 2967699805 2967700592 311
279 iso_pu_bacteria 2967706974 2967707716 311
280 iso_pu_bacteria 2967714385 2967721259 311
281 iso_pu_bacteria 2967721400 2967728438 311
282 iso_pu_bacteria 2967728569 2967732225 311
283 iso_pu_bacteria 2967735183 2967738526 311
284 iso_pu_bacteria 2967742019 2967748538 311
285 iso_pu_bacteria 2967748971 2967754014 311
286 iso_pu_bacteria 2967755722 2967757810 311
287 iso_pu_bacteria 2967762386 2967765733 311
288 iso_pu_bacteria 2967769361 2967775230 311
289 iso_pu_bacteria 2967775926 2967782666 311
290 iso_pu_bacteria 2970019648 2970022052 311
291 iso_pu_bacteria 2970026789 2970028614 311
292 iso_pu_bacteria 2970033650 2970040595 311
293 iso_pu_bacteria 2970040964 2970046662 311
294 iso_pu_bacteria 2970047711 2970048274 311
295 iso_pu_bacteria 2970054988 2970060568 311
296 iso_pu_bacteria 2970061556 2970068679 311
297 iso_pu_bacteria 2970068827 2970075888 311
298 iso_pu_bacteria 2970076120 2970082036 311
299 iso_pu_bacteria 2970082768 2970087862 311
300 iso_pu_bacteria 2970088815 2970095033 311
301 iso_pu_bacteria 2970095765 2970097264 311
302 iso_pu_bacteria 2970102677 2970104548 311
303 iso_pu_bacteria 2970109326 2970114450 311
304 iso_pu_bacteria 2970116247 2970120904 311
305 iso_pu_bacteria 2970122695 2970127913 311
306 iso_pu_bacteria 2970129317 2970133459 311
307 iso_pu_bacteria 2970143518 2970147399 311
308 iso_pu_bacteria 2970149975 2970156365 311
309 iso_pu_bacteria 2970156795 2970163463 311
310 iso_pu_bacteria 2970164137 2970169944 311
311 iso_pu_bacteria 2970170962 2970177033 311
312 iso_pu_bacteria 2970177841 2970184190 311
313 iso_pu_bacteria 2970184632 2970189698 311
314 iso_pu_bacteria 2970191845 2970198246 311
315 iso_pu_bacteria 2977516862 2977523794 311
316 iso_pu_bacteria 2977530762 2977531264 311
317 iso_pu_bacteria 2977537788 2977543017 311
318 iso_pu_bacteria 2977544691 2977547428 311
319 iso_pu_bacteria 2977551784 2977557949 311
320 iso_pu_bacteria 2977558990 2977560037 311
321 iso_pu_bacteria 2977565890 2977570553 311
322 iso_pu_bacteria 2977572785 2977579082 311
323 iso_pu_bacteria 2977579622 2977583004 311
324 iso_pu_bacteria 643692032 643827592 311
325 iso_pu_bacteria 648276728 648740777 311
326 iso_pu_bacteria 8003992118 8003995519 311
327 iso_pu_bacteria 8003999396 8004003278 311
328 iso_pu_bacteria 8005246636 8005249463 311
329 iso_pu_bacteria 8049293176 8049296460 311
330 3300002773 JGI25152J39213_1000648 JGI25152J39213_10006483 312
331 3300002774 JGI25150J39212_1004106 JGI25150J39212_10041061 312
332 3300003215 JGI25153J46596_10005428 JGI25153J46596_100054283 312
333 3300003771 Ga0055526_1001461 Ga0055526_10014619 312
334 3300003792 Ga0055540_1000886 Ga0055540_100088619 312
335 3300004625 Ga0055543_1001069 Ga0055543_10010699 312
336 3300005353 Ga0070669_100116709 Ga0070669_1001167092 312
337 3300005548 Ga0070665_100173427 Ga0070665_1001734272 312
338 3300006038 Ga0075365_10037932 Ga0075365_100379323 312
339 3300006048 Ga0075363_100011555 Ga0075363_1000115553 312
340 3300006177 Ga0075362_10000994 Ga0075362_100009948 312
341 3300006178 Ga0075367_10007501 Ga0075367_100075014 312
342 3300006186 Ga0075369_10001058 Ga0075369_100010588 312
343 3300006195 Ga0075366_10026085 Ga0075366_100260852 312
344 3300025245 Ga0207425_1001049 Ga0207425_10010496 312
345 3300025258 Ga0209129_1001100 Ga0209129_10011009 312
346 3300025258 Ga0209129_1001572 Ga0209129_10015722 312
347 3300025258 Ga0209129_1009813 Ga0209129_10098131 312
348 3300025273 Ga0209673_1000370 Ga0209673_100037068 312
349 3300025273 Ga0209673_1006786 Ga0209673_10067861 312
350 3300025291 Ga0209675_1017808 Ga0209675_10178082 312
351 3300025294 Ga0209025_1001178 Ga0209025_100117827 312
352 3300025295 Ga0209564_1002121 Ga0209564_10021218 312
353 3300025295 Ga0209564_1011785 Ga0209564_10117853 312
354 3300025297 Ga0209758_1001061 Ga0209758_10010619 312
355 3300025297 Ga0209758_1001207 Ga0209758_100120724 312
356 3300025299 Ga0209256_1000459 Ga0209256_10004599 312
357 3300025302 Ga0207426_1000214 Ga0207426_10002149 312
358 3300025303 Ga0209051_1001765 Ga0209051_10017654 312
359 3300025303 Ga0209051_1002754 Ga0209051_100275411 312
360 3300025304 Ga0209257_1003933 Ga0209257_10039338 312
361 3300028379 Ga0268266_10075558 Ga0268266_100755582 312
362 3300031901 Ga0307406_10009129 Ga0307406_100091292 312
363 3300046512 Ga0495610_0014968 Ga0495610_0014968_2998_3945 312
364 3300046515 Ga0495620_0009436 Ga0495620_0009436_1282_2229 312
365 3300046519 Ga0495632_0062213 Ga0495632_0062213_589_1536 312
366 3300047472 Ga0495686_0006107 Ga0495686_0006107_6251_7198 312
367 3300048919 Ga0496116_0042300 Ga0496116_0042300_509_1450 312
368 3300048924 Ga0496121_0006139 Ga0496121_0006139_647_1588 312
369 3300048925 Ga0496122_0176027 Ga0496122_0176027_97_1140 312
370 3300048929 Ga0496126_0000115 Ga0496126_0000115_9500_10543 312
371 3300049459 Ga0495678_016594 Ga0495678_016594_2204_3151 312
372 iso_pu_bacteria 2510917022 2511135788 312
373 iso_pu_bacteria 2511231027 2511391894 312
374 iso_pu_bacteria 2524023209 2524461244 312
375 iso_pu_bacteria 2582581307 2585272122 312
376 iso_pu_bacteria 2582581308 2585279571 312
377 iso_pu_bacteria 2582581315 2585327409 312
378 iso_pu_bacteria 2582581316 2585334052 312
379 iso_pu_bacteria 2585427527 2585535650 312
380 iso_pu_bacteria 2585427530 2585551028 312
381 iso_pu_bacteria 2585427531 2585563333 312
382 iso_pu_bacteria 2585427608 2585897245 312
383 iso_pu_bacteria 2585427609 2585909160 312
384 iso_pu_bacteria 2585428125 2587984574 312
385 iso_pu_bacteria 2615840626 2616306358 312
386 iso_pu_bacteria 2615840698 2616551155 312
387 iso_pu_bacteria 2617270742 2617382386 312
388 iso_pu_bacteria 2667528174 2671115966 312
389 iso_pu_bacteria 2775507266 2778179279 312
390 iso_pu_bacteria 2818991448 2819612031 312
391 iso_pu_bacteria 2818991453 2819638426 312
392 iso_pu_bacteria 2838029111 2838034181 312
393 iso_pu_bacteria 2842298080 2842302688 312
394 iso_pu_bacteria 2842357229 2842358810 312
395 iso_pu_bacteria 2842475841 2842480851 312
396 iso_pu_bacteria 2842482326 2842485344 312
397 iso_pu_bacteria 2842502639 2842507538 312
398 iso_pu_bacteria 2842509118 2842514629 312
399 iso_pu_bacteria 2842871566 2842874046 312
400 iso_pu_bacteria 2852387548 2852387601 312
401 iso_pu_bacteria 2919408235 2919411515 312
402 iso_pu_bacteria 3005416602 3005416827 312
403 iso_pu_bacteria 8005314921 8005315969 312
404 iso_pu_bacteria 8005484373 8005487059 312
405 iso_pu_bacteria 8005645114 8005645251 312
406 iso_pu_bacteria 8005682033 8005687302 312
407 iso_pu_bacteria 8046767195 8046768313 312
408 iso_pu_bacteria 8057575449 8057582018 312
409 3300002773 JGI25152J39213_1000309 JGI25152J39213_10003095 313
410 3300002773 JGI25152J39213_1001491 JGI25152J39213_10014912 313
411 3300002774 JGI25150J39212_1000018 JGI25150J39212_10000185 313
412 3300003187 JGI25151J46595_10000034 JGI25151J46595_10000034173 313
413 3300003215 JGI25153J46596_10003823 JGI25153J46596_100038233 313
414 3300003323 rootH1_10226648 rootH1_102266481 313
415 3300003775 Ga0055524_1003944 Ga0055524_10039443 313
416 3300005347 Ga0070668_100015599 Ga0070668_1000155993 313
417 3300005367 Ga0070667_100094799 Ga0070667_1000947992 313
418 3300006178 Ga0075367_10036179 Ga0075367_100361792 313
419 3300006946 Ga0079104_1010553 Ga0079104_10105532 313
420 3300009011 Ga0105251_10007113 Ga0105251_100071138 313
421 3300009092 Ga0105250_10024304 Ga0105250_100243042 313
422 3300009101 Ga0105247_10222388 Ga0105247_102223881 313
423 3300009177 Ga0105248_10017883 Ga0105248_100178834 313
424 3300011119 Ga0105246_10171232 Ga0105246_101712322 313
425 3300017792 Ga0163161_10111884 Ga0163161_101118842 313
426 3300022740 Ga0228710_1000002 Ga0228710_1000002245 313
427 3300025208 Ga0209436_100013 Ga0209436_100013113 313
428 3300025245 Ga0207425_1000035 Ga0207425_1000035197 313
429 3300025245 Ga0207425_1018977 Ga0207425_10189772 313
430 3300025258 Ga0209129_1000029 Ga0209129_1000029197 313
431 3300025258 Ga0209129_1000409 Ga0209129_100040926 313
432 3300025258 Ga0209129_1000988 Ga0209129_10009883 313
433 3300025258 Ga0209129_1000993 Ga0209129_10009939 313
434 3300025284 Ga0209130_1000009 Ga0209130_100000910 313
435 3300025294 Ga0209025_1000132 Ga0209025_10001329 313
436 3300025294 Ga0209025_1003970 Ga0209025_100397010 313
437 3300025294 Ga0209025_1010458 Ga0209025_10104582 313
438 3300025295 Ga0209564_1003680 Ga0209564_10036803 313
439 3300025295 Ga0209564_1014726 Ga0209564_10147261 313
440 3300025297 Ga0209758_1001208 Ga0209758_100120824 313
441 3300025297 Ga0209758_1002613 Ga0209758_100261311 313
442 3300025297 Ga0209758_1002888 Ga0209758_100288814 313
443 3300025299 Ga0209256_1004467 Ga0209256_10044671 313
444 3300025302 Ga0207426_1000450 Ga0207426_100045054 313
445 3300025302 Ga0207426_1000747 Ga0207426_10007478 313
446 3300025303 Ga0209051_1015450 Ga0209051_10154502 313
447 3300025735 Ga0207713_1053816 Ga0207713_10538162 313
448 3300025941 Ga0207711_10031519 Ga0207711_100315192 313
449 3300025961 Ga0207712_10107929 Ga0207712_101079292 313
450 3300025986 Ga0207658_10032061 Ga0207658_100320613 313
451 3300027111 Ga0209281_1000030 Ga0209281_100003013 313
452 3300027111 Ga0209281_1000893 Ga0209281_100089313 313
453 3300027666 Ga0209282_1000004 Ga0209282_100000413 313
454 3300027866 Ga0209813_10006588 Ga0209813_100065882 313
455 3300028794 Ga0307515_10001473 Ga0307515_1000147333 313
456 3300031548 Ga0307408_100131027 Ga0307408_1001310272 313
457 3300031852 Ga0307410_10034299 Ga0307410_100342992 313
458 3300031911 Ga0307412_10000806 Ga0307412_1000080616 313
459 3300031967 Ga0315914_1000001 Ga0315914_1000001369 313
460 3300032004 Ga0307414_10284346 Ga0307414_102843462 313
461 3300033430 Ga0315913_1000022 Ga0315913_100002271 313
462 3300033464 Ga0315915_1000002 Ga0315915_100000214 313
463 3300036712 Ga0316584_0233652 Ga0316584_0233652_375_1334 313
464 3300046452 Ga0495617_025522 Ga0495617_025522_832_1803 313
465 3300046474 Ga0495605_0001553 Ga0495605_0001553_1190_2161 313
466 3300046492 Ga0495585_0008650 Ga0495585_0008650_941_1912 313
467 3300046512 Ga0495610_0061238 Ga0495610_0061238_632_1603 313
468 3300046518 Ga0495631_0002795 Ga0495631_0002795_3964_4935 313
469 3300046519 Ga0495632_0043369 Ga0495632_0043369_866_1837 313
470 3300046522 Ga0495643_0151590 Ga0495643_0151590_125_1096 313
471 3300046524 Ga0495648_0042495 Ga0495648_0042495_1310_2260 313
472 3300046538 Ga0495609_0014836 Ga0495609_0014836_2654_3625 313
473 3300046558 Ga0495633_0011714 Ga0495633_0011714_772_1737 313
474 3300046648 Ga0495611_0031931 Ga0495611_0031931_384_1355 313
475 3300046691 Ga0495670_0142347 Ga0495670_0142347_174_1139 313
476 3300046810 Ga0495660_0087028 Ga0495660_0087028_617_1588 313
477 3300047443 Ga0495687_040153 Ga0495687_040153_636_1607 313
478 3300047472 Ga0495686_0012893 Ga0495686_0012893_766_1716 313
479 3300047472 Ga0495686_0036909 Ga0495686_0036909_154_1104 313
480 3300047472 Ga0495686_0125233 Ga0495686_0125233_263_1228 313
481 3300048904 Ga0496101_0125194 Ga0496101_0125194_690_1655 313
482 3300048907 Ga0496104_0248019 Ga0496104_0248019_32_997 313
483 3300048909 Ga0496106_0002784 Ga0496106_0002784_11027_12055 313
484 3300048909 Ga0496106_0120326 Ga0496106_0120326_275_1237 313
485 3300048912 Ga0496109_0540691 Ga0496109_0540691_106_1071 313
486 3300048913 Ga0496110_0233955 Ga0496110_0233955_665_1630 313
487 3300048916 Ga0496113_0179072 Ga0496113_0179072_54_1019 313
488 3300048919 Ga0496116_0027870 Ga0496116_0027870_1580_2545 313
489 3300048919 Ga0496116_0049733 Ga0496116_0049733_1029_1994 313
490 3300048922 Ga0496119_0093962 Ga0496119_0093962_45_1010 313
491 3300048923 Ga0496120_0136377 Ga0496120_0136377_245_1207 313
492 3300048924 Ga0496121_0028052 Ga0496121_0028052_84_1064 313
493 3300048924 Ga0496121_0039608 Ga0496121_0039608_2848_3798 313
494 3300048927 Ga0496124_0019498 Ga0496124_0019498_2419_3384 313
495 3300048927 Ga0496124_0146516 Ga0496124_0146516_825_1790 313
496 3300048928 Ga0496125_0028089 Ga0496125_0028089_755_1720 313
497 3300049459 Ga0495678_048518 Ga0495678_048518_230_1201 313
498 3300049569 Ga0501032_0176241 Ga0501032_0176241_368_1318 313
499 3300049570 Ga0501033_0000281 Ga0501033_0000281_5331_6281 313
500 3300049776 Ga0501280_005297 Ga0501280_005297_663_1613 313
501 3300049822 Ga0501035_0000607 Ga0501035_0000607_13559_14509 313
502 3300053105 Ga0500557_009180 Ga0500557_009180_685_1656 313
503 3300053109 Ga0500569_004387 Ga0500569_004387_1550_2521 313
504 3300053139 Ga0500568_0001281 Ga0500568_0001281_10852_11889 313
505 3300053151 Ga0500604_0041809 Ga0500604_0041809_318_1346 313
506 3300053153 Ga0500616_0003287 Ga0500616_0003287_10864_11835 313
507 3300053730 Ga0500645_027846 Ga0500645_027846_88_1125 313
508 iso_pu_bacteria 2510917030 2511194198 313
509 iso_pu_bacteria 2537561587 2537874512 313
510 iso_pu_bacteria 2554235003 2554249042 313
511 iso_pu_bacteria 2558860242 2559296130 313
512 iso_pu_bacteria 2582581299 2585231817 313
513 iso_pu_bacteria 2582581304 2585257118 313
514 iso_pu_bacteria 2585427594 2585845116 313
515 iso_pu_bacteria 2599185210 2599603077 313
516 iso_pu_bacteria 2600255279 2601611017 313
517 iso_pu_bacteria 2600255308 2601747791 313
518 iso_pu_bacteria 2643221568 2643854771 313
519 iso_pu_bacteria 2643221693 2644521708 313
520 iso_pu_bacteria 2738541293 2738800968 313
521 iso_pu_bacteria 2765235802 2765465782 313
522 iso_pu_bacteria 2808606387 2808988044 313
523 iso_pu_bacteria 2818991439 2819561140 313
524 iso_pu_bacteria 2838675328 2838678489 313
525 iso_pu_bacteria 2838714209 2838718423 313
526 iso_pu_bacteria 2838719591 2838722785 313
527 iso_pu_bacteria 2838724970 2838728489 313
528 iso_pu_bacteria 2839993093 2839993423 313
529 iso_pu_bacteria 2841846520 2841850341 313
530 iso_pu_bacteria 2841859092 2841863407 313
531 iso_pu_bacteria 2842124991 2842129149 313
532 iso_pu_bacteria 2842130223 2842133382 313
533 iso_pu_bacteria 2842152218 2842155707 313
534 iso_pu_bacteria 2842170452 2842174335 313
535 iso_pu_bacteria 2842175837 2842178996 313
536 iso_pu_bacteria 2842187318 2842190847 313
537 iso_pu_bacteria 2842211629 2842214829 313
538 iso_pu_bacteria 2842224351 2842227550 313
539 iso_pu_bacteria 2842515876 2842519856 313
540 iso_pu_bacteria 2894652903 2894653703 313
541 iso_pu_bacteria 2899792073 2899795509 313
542 iso_pu_bacteria 2899845264 2899849585 313
543 iso_pu_bacteria 2919114240 2919118320 313
544 iso_pu_bacteria 2919119836 2919120403 313
545 iso_pu_bacteria 2919166419 2919170406 313
546 iso_pu_bacteria 2926754445 2926754849 313
547 iso_pu_bacteria 2926760298 2926762014 313
548 iso_pu_bacteria 2929138655 2929142055 313
549 iso_pu_bacteria 2933006813 2933010447 313
550 iso_pu_bacteria 2933011516 2933015881 313
551 iso_pu_bacteria 2933594066 2933597382 313
552 iso_pu_bacteria 2978969890 2978972797 313
553 iso_pu_bacteria 2979089926 2979092716 313
554 iso_pu_bacteria 2979095461 2979099892 313
555 iso_pu_bacteria 2979100975 2979104689 313
556 iso_pu_bacteria 2984509177 2984513512 313
557 iso_pu_bacteria 2984518228 2984522907 313
558 iso_pu_bacteria 2984537506 2984542214 313
559 iso_pu_bacteria 2984587000 2984591049 313
560 iso_pu_bacteria 2984601300 2984601642 313
561 iso_pu_bacteria 2996887358 2996890514 313
562 iso_pu_bacteria 650716007 650738548 313
563 iso_pu_bacteria 8003570095 8003573592 313
564 iso_pu_bacteria 8005258706 8005262701 313
565 iso_pu_bacteria 8005321885 8005325041 313
566 3300001979 JGI24740J21852_10002325 JGI24740J21852_100023257 314
567 3300002704 JGI25155J39150_1000018 JGI25155J39150_1000018137 314
568 3300002705 JGI25156J39149_1000055 JGI25156J39149_10000554 314
569 3300002737 JGI25162J39368_1001324 JGI25162J39368_10013244 314
570 3300002737 JGI25162J39368_1001456 JGI25162J39368_10014563 314
571 3300002738 JGI25154J39366_1000384 JGI25154J39366_100038413 314
572 3300002741 JGI25157J39369_1000076 JGI25157J39369_10000764 314
573 3300002987 JGI25159J45721_1005441 JGI25159J45721_10054411 314
574 3300003214 JGI25165J46597_1001191 JGI25165J46597_100119110 314
575 3300003214 JGI25165J46597_1001335 JGI25165J46597_10013359 314
576 3300003354 JGI25160J50197_1000051 JGI25160J50197_100005110 314
577 3300003374 JGI25161J50226_1000011 JGI25161J50226_1000011184 314
578 3300004625 Ga0055543_1000041 Ga0055543_100004195 314
579 3300005262 Ga0065165_1000303 Ga0065165_100030364 314
580 3300005331 Ga0070670_100000217 Ga0070670_10000021744 314
581 3300005367 Ga0070667_100106501 Ga0070667_1001065012 314
582 3300009036 Ga0105244_10023759 Ga0105244_100237593 314
583 3300009545 Ga0105237_10003956 Ga0105237_100039568 314
584 3300010375 Ga0105239_10005695 Ga0105239_100056958 314
585 3300013104 Ga0157370_10012926 Ga0157370_100129262 314
586 3300015262 Ga0182007_10003879 Ga0182007_100038792 314
587 3300015265 Ga0182005_1008112 Ga0182005_10081122 314
588 3300021321 Ga0214542_1000064 Ga0214542_100006411 314
589 3300021327 Ga0214543_1000063 Ga0214543_1000063101 314
590 3300025206 Ga0209435_100031 Ga0209435_100031139 314
591 3300025233 Ga0209437_100179 Ga0209437_10017910 314
592 3300025233 Ga0209437_100181 Ga0209437_1001818 314
593 3300025246 Ga0209646_1000102 Ga0209646_1000102139 314
594 3300025246 Ga0209646_1002136 Ga0209646_10021362 314
595 3300025250 Ga0209026_1000096 Ga0209026_1000096139 314
596 3300025256 Ga0209759_1000090 Ga0209759_1000090139 314
597 3300025261 Ga0209233_1000185 Ga0209233_10001859 314
598 3300025261 Ga0209233_1000475 Ga0209233_100047514 314
599 3300025261 Ga0209233_1000514 Ga0209233_10005148 314
600 3300025284 Ga0209130_1000058 Ga0209130_100005810 314
601 3300025302 Ga0207426_1000131 Ga0207426_100013110 314
602 3300025913 Ga0207695_10000234 Ga0207695_10000234132 314
603 3300025914 Ga0207671_10000234 Ga0207671_1000023467 314
604 3300025925 Ga0207650_10001202 Ga0207650_100012027 314
605 3300025986 Ga0207658_10040948 Ga0207658_100409483 314
606 3300030500 Ga0268256_1005620 Ga0268256_10056202 314
607 3300031456 Ga0307513_10000926 Ga0307513_1000092617 314
608 3300037471 Ga0395905_0003872 Ga0395905_0003872_306_1289 314
609 3300046459 Ga0495629_0190010 Ga0495629_0190010_335_1288 314
610 3300046462 Ga0495651_0156158 Ga0495651_0156158_40_993 314
611 3300046476 Ga0495662_0038297 Ga0495662_0038297_513_1466 314
612 3300046511 Ga0495608_0107052 Ga0495608_0107052_413_1366 314
613 3300046529 Ga0495652_0082521 Ga0495652_0082521_1319_2272 314
614 3300046557 Ga0495622_0005652 Ga0495622_0005652_853_1806 314
615 3300046663 Ga0495635_0016067 Ga0495635_0016067_258_1211 314
616 3300046683 Ga0495658_0094898 Ga0495658_0094898_118_1071 314
617 3300046809 Ga0495600_0077144 Ga0495600_0077144_837_1790 314
618 3300047317 Ga0495604_0095947 Ga0495604_0095947_432_1385 314
619 3300048088 Ga0495602_0071719 Ga0495602_0071719_469_1422 314
620 3300048905 Ga0496102_0224887 Ga0496102_0224887_176_1129 314
621 3300048906 Ga0496103_0068735 Ga0496103_0068735_704_1657 314
622 3300048921 Ga0496118_0008891 Ga0496118_0008891_501_1454 314
623 3300048922 Ga0496119_0012902 Ga0496119_0012902_568_1521 314
624 3300048922 Ga0496119_0015744 Ga0496119_0015744_40_993 314
625 3300048925 Ga0496122_0078815 Ga0496122_0078815_893_1846 314
626 3300048926 Ga0496123_0014786 Ga0496123_0014786_413_1366 314
627 3300048927 Ga0496124_0135385 Ga0496124_0135385_844_1797 314
628 3300048928 Ga0496125_0112171 Ga0496125_0112171_703_1656 314
629 3300049573 Ga0501037_0071028 Ga0501037_0071028_722_1726 314
630 3300049581 Ga0501047_0045061 Ga0501047_0045061_2460_3464 314
631 3300049586 Ga0501070_0000215 Ga0501070_0000215_31592_32596 314
632 3300049742 Ga0501080_0000542 Ga0501080_0000542_8787_9791 314
633 3300049822 Ga0501035_0000374 Ga0501035_0000374_16421_17425 314
634 3300053148 Ga0500590_035757 Ga0500590_035757_801_1754 314
635 3300053177 Ga0500636_0082485 Ga0500636_0082485_285_1238 314
636 iso_pu_bacteria 2643221558 2643814937 314
637 iso_pu_bacteria 2643221719 2644657865 314
638 iso_pu_bacteria 2842922631 2842926517 314
639 iso_pu_bacteria 2977523885 2977530254 314
640 iso_pu_bacteria 2989776772 2989780302 314
641 3300006042 Ga0075368_10020936 Ga0075368_100209362 315
642 3300006048 Ga0075363_100042115 Ga0075363_1000421152 315
643 3300006051 Ga0075364_10025671 Ga0075364_100256712 315
644 3300006178 Ga0075367_10016750 Ga0075367_100167502 315
645 3300009148 Ga0105243_10020415 Ga0105243_100204152 315
646 3300013100 Ga0157373_10025263 Ga0157373_100252632 315
647 3300013102 Ga0157371_10000071 Ga0157371_10000071144 315
648 3300013104 Ga0157370_10000079 Ga0157370_1000007992 315
649 3300025230 Ga0209563_103848 Ga0209563_1038481 315
650 3300025923 Ga0207681_10048360 Ga0207681_100483602 315
651 3300027866 Ga0209813_10001006 Ga0209813_100010062 315
652 3300028379 Ga0268266_10061332 Ga0268266_100613322 315
653 3300035692 Ga0373935_0131629 Ga0373935_0131629_471_1445 315
654 3300035695 Ga0373927_0000068 Ga0373927_0000068_64655_65629 315
655 3300037068 Ga0373925_0013020 Ga0373925_0013020_4434_5408 315
656 3300048916 Ga0496113_0054392 Ga0496113_0054392_1019_1984 315
657 3300048919 Ga0496116_0042171 Ga0496116_0042171_1475_2440 315
658 3300048920 Ga0496117_0000031 Ga0496117_0000031_371383_372348 315
659 3300048921 Ga0496118_0003703 Ga0496118_0003703_9293_10258 315
660 3300048922 Ga0496119_0022066 Ga0496119_0022066_251_1216 315
661 3300048923 Ga0496120_0000387 Ga0496120_0000387_1487_2452 315
662 3300048925 Ga0496122_0000023 Ga0496122_0000023_371370_372335 315
663 3300048926 Ga0496123_0000027 Ga0496123_0000027_8701_9666 315
664 3300048927 Ga0496124_0048867 Ga0496124_0048867_2109_3074 315
665 3300048928 Ga0496125_0141899 Ga0496125_0141899_129_1094 315
666 3300048929 Ga0496126_0186008 Ga0496126_0186008_222_1187 315
667 3300049823 Ga0501044_0031664 Ga0501044_0031664_2472_3515 315
668 3300050489 nmdc:mga03683_63760_c1 nmdc:mga03683_63760_c1_501_1466 315
669 3300050491 nmdc:mga00v17_15_c1 nmdc:mga00v17_15_c1_119453_120418 315
670 3300050492 nmdc:mga0yw44_45077_c1 nmdc:mga0yw44_45077_c1_129_1094 315
671 3300050493 nmdc:mga0k408_18949_c1 nmdc:mga0k408_18949_c1_1841_2806 315
672 3300050494 nmdc:mga06z11_56681_c1 nmdc:mga06z11_56681_c1_935_1900 315
673 3300050495 nmdc:mga04h51_10397_c1 nmdc:mga04h51_10397_c1_419_1384 315
674 3300050516 nmdc:mga0sz30_661_c1 nmdc:mga0sz30_661_c1_8521_9486 315
675 3300053107 Ga0500560_061485 Ga0500560_061485_50_1015 315
676 3300053111 Ga0500572_066528 Ga0500572_066528_138_1091 315
677 3300053137 Ga0500561_0010487 Ga0500561_0010487_883_1848 315
678 3300053161 Ga0500634_0002218 Ga0500634_0002218_1692_2657 315
679 3300053177 Ga0500636_0006262 Ga0500636_0006262_4697_5650 315
680 iso_pu_bacteria 2791355253 2793281888 315
681 iso_pu_bacteria 8024486573 8024491068 315
682 2010549000 RicEn_C4817 RicEn_85910 316
683 3300048922 Ga0496119_0010805 Ga0496119_0010805_2173_3153 316
684 3300048923 Ga0496120_0022613 Ga0496120_0022613_1277_2257 316
685 3300048924 Ga0496121_0000034 Ga0496121_0000034_10472_11452 316
686 3300048925 Ga0496122_0088955 Ga0496122_0088955_205_1185 316
687 3300048926 Ga0496123_0052199 Ga0496123_0052199_867_1847 316
688 3300048927 Ga0496124_0068788 Ga0496124_0068788_1585_2565 316
689 3300048928 Ga0496125_0000030 Ga0496125_0000030_363481_364461 316
690 3300049822 Ga0501035_0020041 Ga0501035_0020041_4068_5060 316
691 3300053140 Ga0500573_0012507 Ga0500573_0012507_2943_3905 316
692 3300053157 Ga0500624_000897 Ga0500624_000897_3768_4829 316

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07182

DUF1402

Protein of unknown function (DUF1402)

50

347

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4luq-assembly1.cif.gz_A crystal structure of virulence effector tse3 in complex with neutralizer tsi3 0.5332 72 311
6gi3-assembly1.cif.gz_B structure of lytic transglycosylase mlte mutant s73a from e.coli 0.4492 60 315
4g9s-assembly1.cif.gz_A crystal structure of escherichia coli plig in complex with atlantic salmon g-type lysozyme 0.4482 35 313
6gi4-assembly1.cif.gz_B structure of lytic transglycosylase mlte mutant s75a from e.coli 0.4406 60 315
5ao8-assembly1.cif.gz_A crystal structure of sltb3 from pseudomonas aeruginosa in complex with nag-nam-pentapeptide 0.4307 35 248
ID Description Score Start End Superfamily
4g9sA00 Mainly Alpha;Orthogonal Bundle;Lysozyme; 0.4477 35 313 1.10.530.10
4g9sA00 Mainly Alpha;Orthogonal Bundle;Lysozyme; 0.412 35 313 1.10.530.10
4fydB03 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.2724 191 298 3.30.420.10
af_Q8N1E2_22_194_1.10.530.10 Mainly Alpha;Orthogonal Bundle;Lysozyme; 0.2675 35 247 1.10.530.10
af_Q8N1E2_22_194_1.10.530.10 Mainly Alpha;Orthogonal Bundle;Lysozyme; 0.2523 35 247 1.10.530.10
ID Description Score Start End GO Terms
AF-A0A528L366-F1-model_v4 DUF1402 family protein 0.931 129 316
AF-A0A530GY35-F1-model_v4 DUF1402 family protein 0.9289 146 316
AF-A0A529QPG0-F1-model_v4 DUF1402 family protein 0.9248 242 316
AF-A0A1L9QC15-F1-model_v4 deleted 0.922 62 316
AF-A0A528AZS9-F1-model_v4 DUF1402 family protein 0.9208 232 307

Feature Viewer

pLDDT pTM Quality
80.88 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map