F475586

General Info

Members Datasets Scaffolds Average Seq Length
692 407 1384 253

Family's Representative Sequence

Representative Sequence 3300028794|Ga0307515_10140162|Ga0307515_101401623
Length 268
Sequence MSAVPSANDAAPNVRYEIANHVATVTIDRPQVMNAVDLATEAELQAIWSDLERRDDVRVVVLTGAGDRAFCAGADMKNPSVKGVDYWAASRVGGFGGIALRDTLNIPVIARVNGLALGGGFEMVLGCDIVVACEDASFGLPEALVGRMPLDGGMTLLQRQIPFRQAMGILFTGRRVKAAEALSLGLVNEVVPRGDLDAAVARWVEGITACAPLSLRAIKQVVRQTSTLSPAQAQATRLPAVMAALQSEDADEGVRAFQQKRKPVWQGR

Samples

Sample ID Description Type Environment
1 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
9 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
10 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
11 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
12 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
13 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
14 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
15 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
16 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
17 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
18 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
19 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
20 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
21 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
22 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
25 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
26 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
27 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
28 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
29 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
30 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
31 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
32 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
36 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
37 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
38 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
39 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
40 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
41 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
42 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
43 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
44 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
45 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
46 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
47 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
48 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
49 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
52 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
56 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
73 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
74 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
75 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
76 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
77 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
100 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
104 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
105 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
106 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
107 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
108 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
109 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
110 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
111 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
114 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
115 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
116 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
117 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
119 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
120 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
121 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
123 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
124 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
181 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
182 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
183 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
184 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
185 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
186 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
187 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
188 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
189 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
190 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
191 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
192 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
193 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
194 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
195 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
196 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
197 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
198 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
199 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
200 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
201 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
202 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
203 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
204 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
205 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
206 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
207 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
208 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
209 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
210 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
211 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
212 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
213 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
214 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
215 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
216 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
217 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
218 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
219 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
220 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
221 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
222 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
223 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
224 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
225 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
226 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
227 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
228 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
229 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
230 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
231 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
232 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
233 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
234 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
235 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
236 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
237 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
238 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
239 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
240 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
241 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
242 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
243 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
244 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
245 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
246 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
247 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
248 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
249 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
250 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
251 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
252 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
253 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
254 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
255 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
256 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
257 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
258 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
259 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
260 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
261 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
262 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
263 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
264 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
265 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
266 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
267 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
268 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
269 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
270 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
271 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
272 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
273 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
274 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
275 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
276 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
277 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
278 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
279 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
280 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
281 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
282 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
283 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
284 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
285 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
286 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
287 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
288 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
289 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
290 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
291 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
292 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
293 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
294 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
295 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
296 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
297 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
298 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
299 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
300 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
301 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
302 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
303 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
304 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
305 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
306 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
307 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
308 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
309 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
310 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
311 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
312 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
313 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
314 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
315 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
316 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
317 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
318 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
319 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
320 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
321 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
322 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
323 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
324 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
325 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
326 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
327 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
328 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
329 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
330 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
331 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
332 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
333 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
334 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
335 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
336 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
337 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
338 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
339 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
340 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
341 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
342 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
343 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
344 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
345 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
346 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
347 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
348 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
349 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
350 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
351 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
352 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
353 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
354 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
355 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
356 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
357 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
358 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
359 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
360 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
361 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
362 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
363 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
364 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
365 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
366 2643221557 Ensifer sp. Root558 Isolate Unclassified
367 2643221558 Rhizobium sp. Root149 Isolate Unclassified
368 2643221610 Ensifer sp. Root74 Isolate Unclassified
369 2643221618 Ensifer sp. Root231 Isolate Unclassified
370 2643221655 Ensifer sp. Root1252 Isolate Unclassified
371 2643221659 Ensifer sp. Root127 Isolate Unclassified
372 2643221668 Ensifer sp. Root423 Isolate Unclassified
373 2643221675 Ensifer sp. Root1298 Isolate Unclassified
374 2643221680 Ensifer sp. Root1312 Isolate Unclassified
375 2643221698 Ensifer sp. Root142 Isolate Unclassified
376 2643221712 Ensifer sp. Root258 Isolate Unclassified
377 2643221723 Ensifer sp. Root278 Isolate Unclassified
378 2643221726 Ensifer sp. Root954 Isolate Unclassified
379 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
380 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
381 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
382 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
383 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
384 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
385 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
386 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
387 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
388 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
389 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
390 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
391 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
392 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
393 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
394 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
395 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
396 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
397 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
398 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
399 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
400 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
401 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
402 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
403 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
404 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
405 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
406 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
407 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 90.17
Metatranscriptomes 0
Isolates 9.83

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.56
Nodule 3.47
Rhizoplane 5.78
Rhizosphere 67.63
Stem 0
Stem Tuber 0
Unclassified 0.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307515_10140162 3300028794 Bacteria 2599
2 JGI24740J21852_10000448 3300001979 Bacteria 17668
3 JGI25155J39150_1000242 3300002704 Bacteria 21207
4 JGI25156J39149_1000561 3300002705 Bacteria 21207
5 JGI25162J39368_1000317 3300002737 Bacteria 42748
6 JGI25162J39368_1000864 3300002737 Bacteria 19867
7 JGI25154J39366_1000464 3300002738 Bacteria 21207
8 JGI25157J39369_1000598 3300002741 Bacteria 21207
9 JGI25152J39213_1000690 3300002773 Bacteria 17579
10 JGI25159J45721_1000141 3300002987 Bacteria 33401
11 JGI25159J45721_1001217 3300002987 Bacteria 10920
12 JGI25165J46597_1000432 3300003214 Bacteria 42748
13 JGI25165J46597_1000576 3300003214 Bacteria 32714
14 JGI25165J46597_1009404 3300003214 Bacteria 1473
15 JGI25153J46596_10000205 3300003215 Bacteria 54275
16 JGI25153J46596_10041607 3300003215 Bacteria 1411
17 rootH1_10149566 3300003323 Bacteria 2084
18 JGI25160J50197_1000018 3300003354 Bacteria 239933
19 JGI25160J50197_1000318 3300003354 Bacteria 33405
20 JGI25161J50226_1000088 3300003374 Bacteria 75140
21 JGI25161J50226_1001492 3300003374 Bacteria 6965
22 Ga0055526_1005835 3300003771 Bacteria 6916
23 Ga0055524_1001298 3300003775 Bacteria 14638
24 Ga0055524_1037304 3300003775 Bacteria 1291
25 Ga0055536_1001378 3300003781 Bacteria 14760
26 Ga0055536_1032940 3300003781 Bacteria 1331
27 Ga0055530_10013202 3300003791 Bacteria 2830
28 Ga0055531_10013324 3300003794 Bacteria 3796
29 Ga0055531_10037059 3300003794 Bacteria 1490
30 Ga0058692_1005198 3300003856 Bacteria 3743
31 Ga0055543_1000004 3300004625 Bacteria 239971
32 Ga0055543_1000414 3300004625 Bacteria 26885
33 Ga0065165_1000065 3300005262 Bacteria 174075
34 Ga0065165_1002809 3300005262 Bacteria 13651
35 Ga0070658_10104778 3300005327 Bacteria 2340
36 Ga0070676_10123030 3300005328 Bacteria 1631
37 Ga0070676_10164342 3300005328 Bacteria 1431
38 Ga0070683_100069609 3300005329 Bacteria 3281
39 Ga0070683_100400408 3300005329 Bacteria 1309
40 Ga0070690_100007793 3300005330 Bacteria 6138
41 Ga0070670_100001858 3300005331 Bacteria 17202
42 Ga0070670_100002742 3300005331 Bacteria 14546
43 Ga0070670_100058771 3300005331 Bacteria 3301
44 Ga0070677_10027515 3300005333 Bacteria 2141
45 Ga0070677_10126050 3300005333 Bacteria 1162
46 Ga0068869_100000178 3300005334 Bacteria 32316
47 Ga0068869_100028538 3300005334 Bacteria 3901
48 Ga0070666_10003416 3300005335 Bacteria 9621
49 Ga0070666_10028053 3300005335 Bacteria 3692
50 Ga0068868_100007519 3300005338 Bacteria 7762
51 Ga0068868_100042099 3300005338 Bacteria 3562
52 Ga0068868_100109326 3300005338 Bacteria 2245
53 Ga0070687_100058068 3300005343 Bacteria 2031
54 Ga0070661_100004971 3300005344 Bacteria 9154
55 Ga0070668_100012507 3300005347 Bacteria 6323
56 Ga0070668_100014910 3300005347 Bacteria 5810
57 Ga0070668_100090004 3300005347 Bacteria 2418
58 Ga0070668_100235008 3300005347 Bacteria 1517
59 Ga0070668_100328005 3300005347 Bacteria 1290
60 Ga0070669_100006527 3300005353 Bacteria 8398
61 Ga0070669_100059883 3300005353 Bacteria 2796
62 Ga0070675_100002209 3300005354 Bacteria 14434
63 Ga0070675_100126869 3300005354 Bacteria 2171
64 Ga0070671_100003475 3300005355 Bacteria 12292
65 Ga0070671_100008025 3300005355 Bacteria 8449
66 Ga0070671_100019353 3300005355 Bacteria 5539
67 Ga0070671_100136998 3300005355 Bacteria 2064
68 Ga0070674_100012576 3300005356 Bacteria 5202
69 Ga0070674_100024901 3300005356 Bacteria 3888
70 Ga0070674_100061174 3300005356 Bacteria 2627
71 Ga0070673_100007554 3300005364 Bacteria 7185
72 Ga0070673_100029140 3300005364 Bacteria 4114
73 Ga0070673_100580438 3300005364 Bacteria 1021
74 Ga0070688_100020269 3300005365 Bacteria 3864
75 Ga0070659_100010938 3300005366 Bacteria 6697
76 Ga0070667_100001198 3300005367 Bacteria 23577
77 Ga0070667_100004710 3300005367 Bacteria 11440
78 Ga0070667_100066233 3300005367 Bacteria 3069
79 Ga0070667_100396890 3300005367 Bacteria 1255
80 Ga0070667_100509310 3300005367 Bacteria 1104
81 Ga0070714_100002111 3300005435 Bacteria 14588
82 Ga0070714_100029168 3300005435 Bacteria 4585
83 Ga0070714_100223066 3300005435 Bacteria 1733
84 Ga0070714_100268630 3300005435 Bacteria 1581
85 Ga0070713_100003455 3300005436 Bacteria 10434
86 Ga0070713_100337257 3300005436 Bacteria 1396
87 Ga0070710_10000193 3300005437 Bacteria 28438
88 Ga0070701_10134940 3300005438 Bacteria 1406
89 Ga0070711_100000687 3300005439 Bacteria 17734
90 Ga0070705_100112034 3300005440 Bacteria 1745
91 Ga0070694_100084208 3300005444 Bacteria 2218
92 Ga0070678_100003099 3300005456 Bacteria 9217
93 Ga0070678_100007564 3300005456 Bacteria 6454
94 Ga0070662_100010850 3300005457 Bacteria 6000
95 Ga0068867_100000273 3300005459 Bacteria 33912
96 Ga0068867_100003231 3300005459 Bacteria 11490
97 Ga0068867_100007980 3300005459 Bacteria 7478
98 Ga0068867_100060518 3300005459 Bacteria 2809
99 Ga0068853_100173358 3300005539 Bacteria 1953
100 Ga0068853_100669605 3300005539 Bacteria 988
101 Ga0070672_100000495 3300005543 Bacteria 22911
102 Ga0070672_100006786 3300005543 Bacteria 7731
103 Ga0070672_100022728 3300005543 Bacteria 4612
104 Ga0070672_100150917 3300005543 Bacteria 1922
105 Ga0070695_100102727 3300005545 Bacteria 1928
106 Ga0070695_100161745 3300005545 Bacteria 1572
107 Ga0070696_100156367 3300005546 Bacteria 1677
108 Ga0068855_100009005 3300005563 Bacteria 12061
109 Ga0068855_100032192 3300005563 Bacteria 6261
110 Ga0070664_100040340 3300005564 Bacteria 3935
111 Ga0068857_100001689 3300005577 Bacteria 17740
112 Ga0068854_100044953 3300005578 Bacteria 3138
113 Ga0068856_100014753 3300005614 Bacteria 7540
114 Ga0068856_100015860 3300005614 Bacteria 7286
115 Ga0068852_100428487 3300005616 Bacteria 1306
116 Ga0068859_100007644 3300005617 Bacteria 10984
117 Ga0068859_100146845 3300005617 Bacteria 2433
118 Ga0068864_100000199 3300005618 Bacteria 54129
119 Ga0068864_100000873 3300005618 Bacteria 25393
120 Ga0068864_100112665 3300005618 Bacteria 2425
121 Ga0068864_100471845 3300005618 Bacteria 1203
122 Ga0068866_10023797 3300005718 Bacteria 2854
123 Ga0068861_100001618 3300005719 Bacteria 14363
124 Ga0068861_100018943 3300005719 Bacteria 4909
125 Ga0068870_10012094 3300005840 Bacteria 4023
126 Ga0068870_10102805 3300005840 Bacteria 1618
127 Ga0068863_100001289 3300005841 Bacteria 25007
128 Ga0068863_100011193 3300005841 Bacteria 8693
129 Ga0068863_100346699 3300005841 Bacteria 1445
130 Ga0068858_100000413 3300005842 Bacteria 44413
131 Ga0068858_100008196 3300005842 Bacteria 10046
132 Ga0068858_100060477 3300005842 Bacteria 3502
133 Ga0068860_100002069 3300005843 Bacteria 21141
134 Ga0068860_100011743 3300005843 Bacteria 8631
135 Ga0068860_100046991 3300005843 Bacteria 4114
136 Ga0068860_100109849 3300005843 Bacteria 2635
137 Ga0068862_100004502 3300005844 Bacteria 11751
138 Ga0068862_100339231 3300005844 Bacteria 1391
139 Ga0070716_100003662 3300006173 Bacteria 7272
140 Ga0070712_100041172 3300006175 Bacteria 3170
141 Ga0075367_10321505 3300006178 Bacteria 975
142 Ga0075366_10004099 3300006195 Bacteria 7794
143 Ga0075366_10015971 3300006195 Bacteria 4311
144 Ga0075366_10138688 3300006195 Bacteria 1469
145 Ga0075370_10003981 3300006353 Bacteria 7099
146 Ga0075430_100301532 3300006846 Bacteria 1325
147 Ga0075434_100061513 3300006871 Bacteria 3736
148 Ga0068865_100003699 3300006881 Bacteria 9192
149 Ga0068865_100071709 3300006881 Bacteria 2458
150 Ga0068865_100482604 3300006881 Bacteria 1030
151 Ga0097620_100007644 3300006931 Bacteria 10984
152 Ga0097620_100146845 3300006931 Bacteria 2433
153 Ga0075435_100007006 3300007076 Bacteria 8000
154 Ga0075435_100739025 3300007076 Bacteria 856
155 Ga0105240_10000290 3300009093 Bacteria 97921
156 Ga0105240_10017596 3300009093 Bacteria 9629
157 Ga0105240_10031112 3300009093 Bacteria 6924
158 Ga0105243_10033029 3300009148 Bacteria 4000
159 Ga0105242_10166777 3300009176 Bacteria 1932
160 Ga0105248_10003661 3300009177 Bacteria 17051
161 Ga0105248_10034653 3300009177 Bacteria 5647
162 Ga0105248_10188727 3300009177 Bacteria 2322
163 Ga0105248_10811012 3300009177 Bacteria 1056
164 Ga0105237_10003258 3300009545 Bacteria 19406
165 Ga0105238_10519249 3300009551 Bacteria 1193
166 Ga0105239_10000202 3300010375 Bacteria 87257
167 Ga0105246_10132002 3300011119 Bacteria 1867
168 Ga0157370_10001158 3300013104 Bacteria 32901
169 Ga0157370_10037327 3300013104 Bacteria 4710
170 Ga0157370_10246996 3300013104 Bacteria 1651
171 Ga0157369_10010878 3300013105 Bacteria 10364
172 Ga0157374_10045383 3300013296 Bacteria 4067
173 Ga0157378_10020149 3300013297 Bacteria 5865
174 Ga0157378_10031170 3300013297 Bacteria 4710
175 Ga0157378_10038379 3300013297 Bacteria 4245
176 Ga0163162_10001045 3300013306 Bacteria 25754
177 Ga0163162_10027013 3300013306 Bacteria 5677
178 Ga0163162_10090848 3300013306 Bacteria 3136
179 Ga0157372_10052553 3300013307 Bacteria 4538
180 Ga0157375_10022778 3300013308 Bacteria 5768
181 Ga0157375_10036004 3300013308 Bacteria 4730
182 Ga0157375_10159208 3300013308 Bacteria 2399
183 Ga0157375_10273016 3300013308 Bacteria 1853
184 Ga0163163_10001130 3300014325 Bacteria 22677
185 Ga0163163_10003778 3300014325 Bacteria 12901
186 Ga0163163_10435863 3300014325 Bacteria 1370
187 Ga0163163_10906303 3300014325 Bacteria 945
188 Ga0157380_10038599 3300014326 Bacteria 3709
189 Ga0157380_10332107 3300014326 Bacteria 1414
190 Ga0182008_10017627 3300014497 Bacteria 3703
191 Ga0157377_10036573 3300014745 Bacteria 2702
192 Ga0157379_10000910 3300014968 Bacteria 23882
193 Ga0157379_10027181 3300014968 Bacteria 5094
194 Ga0157379_10051847 3300014968 Bacteria 3663
195 Ga0157376_10079504 3300014969 Bacteria 2811
196 Ga0182007_10008539 3300015262 Bacteria 4200
197 Ga0213874_10089484 3300021377 Bacteria 1009
198 Ga0209435_100144 3300025206 Bacteria 24090
199 Ga0209436_104224 3300025208 Bacteria 3593
200 Ga0209437_100023 3300025233 Bacteria 614195
201 Ga0209437_100341 3300025233 Bacteria 56114
202 Ga0207425_1000706 3300025245 Bacteria 18059
203 Ga0209646_1000417 3300025246 Bacteria 24090
204 Ga0209646_1013585 3300025246 Bacteria 1235
205 Ga0209646_1020113 3300025246 Bacteria 966
206 Ga0209026_1000576 3300025250 Bacteria 24236
207 Ga0209677_100626 3300025253 Bacteria 18962
208 Ga0209148_1019926 3300025254 Bacteria 1109
209 Ga0209759_1000837 3300025256 Bacteria 24172
210 Ga0209129_1000276 3300025258 Bacteria 49188
211 Ga0209233_1000062 3300025261 Bacteria 399685
212 Ga0209233_1000334 3300025261 Bacteria 48025
213 Ga0209233_1000355 3300025261 Bacteria 42800
214 Ga0209130_1000035 3300025284 Bacteria 296161
215 Ga0209130_1000271 3300025284 Bacteria 64956
216 Ga0209676_1001011 3300025292 Bacteria 32875
217 Ga0209676_1004121 3300025292 Bacteria 8282
218 Ga0209676_1033450 3300025292 Bacteria 1531
219 Ga0209025_1000558 3300025294 Bacteria 68589
220 Ga0209025_1001687 3300025294 Bacteria 26984
221 Ga0209564_1000537 3300025295 Bacteria 61336
222 Ga0209758_1000236 3300025297 Bacteria 115906
223 Ga0209758_1000503 3300025297 Bacteria 63354
224 Ga0209758_1031900 3300025297 Bacteria 2151
225 Ga0209050_1002264 3300025298 Bacteria 17080
226 Ga0209050_1014515 3300025298 Bacteria 3385
227 Ga0209256_1000089 3300025299 Bacteria 214426
228 Ga0209256_1003012 3300025299 Bacteria 12468
229 Ga0207426_1000017 3300025302 Bacteria 577913
230 Ga0207426_1000454 3300025302 Bacteria 64956
231 Ga0209051_1001676 3300025303 Bacteria 17854
232 Ga0209051_1002225 3300025303 Bacteria 14314
233 Ga0209051_1008098 3300025303 Bacteria 5620
234 Ga0209257_1004340 3300025304 Bacteria 11078
235 Ga0209257_1012526 3300025304 Bacteria 3905
236 Ga0209257_1029893 3300025304 Bacteria 1766
237 Ga0209257_1032255 3300025304 Bacteria 1663
238 Ga0207697_10024554 3300025315 Bacteria 2467
239 Ga0207656_10060519 3300025321 Bacteria 1660
240 Ga0207682_10004720 3300025893 Bacteria 5653
241 Ga0207682_10005376 3300025893 Bacteria 5219
242 Ga0207692_10001198 3300025898 Bacteria 9619
243 Ga0207688_10131070 3300025901 Bacteria 1470
244 Ga0207680_10033575 3300025903 Bacteria 2928
245 Ga0207680_10101773 3300025903 Bacteria 1847
246 Ga0207680_10305322 3300025903 Bacteria 1110
247 Ga0207699_10002099 3300025906 Bacteria 9425
248 Ga0207645_10083304 3300025907 Bacteria 2051
249 Ga0207645_10127574 3300025907 Bacteria 1654
250 Ga0207643_10003872 3300025908 Bacteria 8051
251 Ga0207643_10138546 3300025908 Bacteria 1452
252 Ga0207705_10088432 3300025909 Bacteria 2266
253 Ga0207707_10121200 3300025912 Bacteria 2287
254 Ga0207695_10000385 3300025913 Bacteria 99958
255 Ga0207695_10110712 3300025913 Bacteria 2726
256 Ga0207671_10001213 3300025914 Bacteria 30631
257 Ga0207693_10048355 3300025915 Bacteria 3340
258 Ga0207663_10170817 3300025916 Bacteria 1544
259 Ga0207660_10328801 3300025917 Unclassified 1222
260 Ga0207649_10010224 3300025920 Bacteria 5151
261 Ga0207649_10489118 3300025920 Bacteria 934
262 Ga0207681_10116036 3300025923 Bacteria 1955
263 Ga0207694_10002311 3300025924 Bacteria 15592
264 Ga0207650_10000395 3300025925 Bacteria 39717
265 Ga0207650_10011031 3300025925 Bacteria 6213
266 Ga0207650_10083371 3300025925 Bacteria 2428
267 Ga0207650_10217836 3300025925 Bacteria 1535
268 Ga0207659_10005943 3300025926 Bacteria 7447
269 Ga0207659_10321670 3300025926 Bacteria 1276
270 Ga0207700_10004196 3300025928 Bacteria 8460
271 Ga0207700_10569570 3300025928 Bacteria 1006
272 Ga0207664_10069740 3300025929 Bacteria 2827
273 Ga0207664_10088265 3300025929 Bacteria 2537
274 Ga0207664_10275512 3300025929 Unclassified 1475
275 Ga0207644_10041513 3300025931 Bacteria 3255
276 Ga0207644_10099139 3300025931 Bacteria 2185
277 Ga0207644_10104122 3300025931 Bacteria 2136
278 Ga0207644_10376268 3300025931 Bacteria 1157
279 Ga0207690_10010611 3300025932 Bacteria 5484
280 Ga0207706_10011964 3300025933 Bacteria 7902
281 Ga0207706_10554168 3300025933 Bacteria 989
282 Ga0207686_10262519 3300025934 Bacteria 1267
283 Ga0207709_10124537 3300025935 Bacteria 1746
284 Ga0207670_10127019 3300025936 Bacteria 1862
285 Ga0207669_10002091 3300025937 Bacteria 8463
286 Ga0207669_10014221 3300025937 Bacteria 3984
287 Ga0207669_10144563 3300025937 Bacteria 1656
288 Ga0207669_10465707 3300025937 Bacteria 1004
289 Ga0207704_10001633 3300025938 Bacteria 10052
290 Ga0207704_10008252 3300025938 Bacteria 4966
291 Ga0207665_10002946 3300025939 Bacteria 11406
292 Ga0207691_10001565 3300025940 Bacteria 22717
293 Ga0207691_10007092 3300025940 Bacteria 10819
294 Ga0207691_10035729 3300025940 Bacteria 4609
295 Ga0207711_10013035 3300025941 Bacteria 6905
296 Ga0207711_10110750 3300025941 Bacteria 2442
297 Ga0207689_10000049 3300025942 Bacteria 88948
298 Ga0207689_10043665 3300025942 Bacteria 3706
299 Ga0207679_10026243 3300025945 Bacteria 4016
300 Ga0207667_10025609 3300025949 Bacteria 6454
301 Ga0207667_10145119 3300025949 Bacteria 2443
302 Ga0207668_10017098 3300025972 Bacteria 4538
303 Ga0207668_10212733 3300025972 Bacteria 1547
304 Ga0207668_10282173 3300025972 Bacteria 1362
305 Ga0207668_10742656 3300025972 Bacteria 865
306 Ga0207658_10035112 3300025986 Bacteria 3589
307 Ga0207658_10054636 3300025986 Bacteria 2955
308 Ga0207677_10021191 3300026023 Bacteria 3965
309 Ga0207677_10022978 3300026023 Bacteria 3842
310 Ga0207677_10026487 3300026023 Bacteria 3638
311 Ga0207703_10003906 3300026035 Bacteria 12376
312 Ga0207703_10044254 3300026035 Bacteria 3577
313 Ga0207639_10470852 3300026041 Bacteria 1144
314 Ga0207708_10297466 3300026075 Bacteria 1312
315 Ga0207702_10010905 3300026078 Bacteria 7580
316 Ga0207702_10123865 3300026078 Bacteria 2317
317 Ga0207641_10001628 3300026088 Bacteria 21895
318 Ga0207641_10009424 3300026088 Bacteria 8044
319 Ga0207641_10031679 3300026088 Bacteria 4386
320 Ga0207648_10000487 3300026089 Bacteria 44153
321 Ga0207648_10002306 3300026089 Bacteria 20605
322 Ga0207648_10004053 3300026089 Bacteria 15203
323 Ga0207648_10071316 3300026089 Bacteria 3027
324 Ga0207676_10004825 3300026095 Bacteria 9564
325 Ga0207676_10012619 3300026095 Bacteria 6060
326 Ga0207674_10000155 3300026116 Bacteria 80715
327 Ga0207674_10003275 3300026116 Bacteria 19914
328 Ga0207675_100000368 3300026118 Bacteria 43073
329 Ga0207675_100003946 3300026118 Bacteria 14398
330 Ga0207683_10004829 3300026121 Bacteria 11608
331 Ga0207683_10009549 3300026121 Bacteria 8269
332 Ga0207683_10223225 3300026121 Bacteria 1717
333 Ga0207683_10235218 3300026121 Bacteria 1671
334 Ga0209371_1000225 3300027312 Bacteria 73767
335 Ga0209371_1002417 3300027312 Bacteria 10478
336 Ga0268266_10237769 3300028379 Bacteria 1680
337 Ga0268266_10273661 3300028379 Bacteria 1568
338 Ga0268265_10002358 3300028380 Bacteria 14304
339 Ga0268265_10004246 3300028380 Bacteria 10003
340 Ga0268265_10604345 3300028380 Bacteria 1048
341 Ga0268264_10000624 3300028381 Bacteria 42120
342 Ga0268264_10000850 3300028381 Bacteria 32562
343 Ga0268264_10034838 3300028381 Bacteria 4143
344 Ga0268264_10117669 3300028381 Bacteria 2337
345 Ga0268256_1000179 3300030500 Bacteria 74966
346 Ga0268256_1001637 3300030500 Bacteria 12932
347 Ga0265327_10000186 3300031251 Bacteria 131420
348 Ga0307513_10015075 3300031456 Bacteria 9380
349 Ga0307408_100279906 3300031548 Bacteria 1389
350 Ga0307405_10036390 3300031731 Bacteria 2949
351 Ga0307405_10132656 3300031731 Bacteria 1724
352 Ga0307413_10015566 3300031824 Bacteria 3902
353 Ga0307410_10012401 3300031852 Bacteria 4928
354 Ga0307406_10054354 3300031901 Bacteria 2555
355 Ga0307412_10064074 3300031911 Bacteria 2482
356 Ga0307409_100038266 3300031995 Bacteria 3546
357 Ga0307409_100183626 3300031995 Bacteria 1854
358 Ga0307416_100267631 3300032002 Bacteria 1675
359 Ga0307414_10460896 3300032004 Bacteria 1117
360 Ga0307414_10802156 3300032004 Bacteria 859
361 Ga0307415_100084726 3300032126 Bacteria 2275
362 Ga0373932_0025191 3300035112 Bacteria 1608
363 Ga0373943_0146383 3300035170 Bacteria 1277
364 Ga0373942_0098105 3300035207 Bacteria 892
365 Ga0373947_0013567 3300035725 Bacteria 4668
366 Ga0373937_0026334 3300036401 Bacteria 5255
367 Ga0373925_0026938 3300037068 Bacteria 4208
368 Ga0395900_0184084 3300037418 Bacteria 2121
369 Ga0395901_0014056 3300038443 Bacteria 8149
370 Ga0400483_139504 3300039062 Bacteria 3357
371 Ga0400483_182941 3300039062 Bacteria 3049
372 Ga0436363_1497704 3300039450 Bacteria 8549
373 Ga0439436_0009273 3300041404 Bacteria 3016
374 Ga0439438_011928 3300041405 Bacteria 2686
375 Ga0439439_0001406 3300041406 Bacteria 4774
376 Ga0439465_0000828 3300041413 Bacteria 9727
377 Ga0451802_0902584 3300041460 Bacteria 1050
378 Ga0451833_0047358 3300041491 Bacteria 993
379 Ga0451837_0181046 3300041494 Bacteria 2727
380 Ga0451841_0401568 3300041498 Bacteria 2644
381 Ga0451845_0201617 3300041501 Bacteria 2161
382 Ga0451847_0435010 3300041503 Bacteria 4794
383 Ga0451849_0452182 3300041505 Bacteria 3631
384 Ga0451851_0585368 3300041507 Bacteria 4506
385 Ga0451855_1734518 3300041511 Bacteria 3728
386 Ga0451853_3420142 3300041512 Bacteria 1543
387 Ga0439442_034955 3300042002 Bacteria 1050
388 Ga0439432_021996 3300042006 Bacteria 2109
389 Ga0439452_008863 3300042010 Bacteria 3000
390 Ga0439457_012904 3300042014 Bacteria 1880
391 Ga0439462_0005777 3300042015 Bacteria 3062
392 Ga0450894_008873 3300042131 Bacteria 1302
393 Ga0450898_000954 3300042134 Bacteria 3632
394 Ga0450906_012008 3300042145 Bacteria 1610
395 Ga0439434_0059775 3300042435 Bacteria 1190
396 Ga0466965_0024561 3300044683 Bacteria 2916
397 Ga0451576_0500071 3300045051 Bacteria 1277
398 Ga0495592_0150449 3300046454 Bacteria 1610
399 Ga0495603_0011274 3300046455 Bacteria 5416
400 Ga0495603_0077046 3300046455 Bacteria 1956
401 Ga0495603_0177048 3300046455 Bacteria 1235
402 Ga0495629_0000042 3300046459 Bacteria 112605
403 Ga0495629_0009772 3300046459 Bacteria 7002
404 Ga0495629_0016766 3300046459 Bacteria 5257
405 Ga0495638_0019667 3300046460 Bacteria 4466
406 Ga0495653_0013257 3300046463 Bacteria 6720
407 Ga0495653_0043801 3300046463 Bacteria 3476
408 Ga0495650_0024031 3300046471 Bacteria 2887
409 Ga0495580_0000479 3300046472 Bacteria 33347
410 Ga0495580_0004586 3300046472 Bacteria 11598
411 Ga0495580_0014603 3300046472 Bacteria 5952
412 Ga0495580_0032222 3300046472 Bacteria 3784
413 Ga0495580_0049848 3300046472 Bacteria 2961
414 Ga0495580_0148034 3300046472 Bacteria 1627
415 Ga0495582_0000778 3300046473 Bacteria 17668
416 Ga0495582_0026493 3300046473 Bacteria 3178
417 Ga0495605_0002559 3300046474 Bacteria 11180
418 Ga0495605_0013110 3300046474 Bacteria 4580
419 Ga0495662_0064786 3300046476 Bacteria 1766
420 Ga0495664_0000344 3300046477 Bacteria 22543
421 Ga0495664_0039719 3300046477 Bacteria 2781
422 Ga0495664_0041532 3300046477 Bacteria 2721
423 Ga0495584_0077597 3300046491 Bacteria 1671
424 Ga0495585_0043322 3300046492 Bacteria 2518
425 Ga0495594_0007150 3300046499 Bacteria 5744
426 Ga0495596_0056281 3300046500 Bacteria 1536
427 Ga0495607_0068032 3300046501 Bacteria 1999
428 Ga0495607_0111860 3300046501 Bacteria 1447
429 Ga0495583_0004161 3300046506 Bacteria 10547
430 Ga0495583_0011018 3300046506 Bacteria 5214
431 Ga0495583_0037996 3300046506 Bacteria 2278
432 Ga0495606_0171664 3300046507 Bacteria 1257
433 Ga0495606_0221989 3300046507 Bacteria 1064
434 Ga0495616_0077185 3300046513 Bacteria 1599
435 Ga0495616_0090851 3300046513 Bacteria 1446
436 Ga0495618_0006127 3300046514 Bacteria 7295
437 Ga0495628_0003840 3300046516 Bacteria 13397
438 Ga0495628_0021909 3300046516 Bacteria 5251
439 Ga0495628_0022620 3300046516 Bacteria 5163
440 Ga0495630_0001703 3300046517 Bacteria 15354
441 Ga0495630_0006855 3300046517 Bacteria 8118
442 Ga0495643_0010277 3300046522 Bacteria 5764
443 Ga0495648_0000909 3300046524 Bacteria 30910
444 Ga0495648_0004253 3300046524 Bacteria 12282
445 Ga0495648_0029227 3300046524 Bacteria 3661
446 Ga0495648_0034657 3300046524 Bacteria 3282
447 Ga0495666_0001722 3300046526 Bacteria 10792
448 Ga0495666_0010850 3300046526 Bacteria 4543
449 Ga0495666_0147719 3300046526 Bacteria 1094
450 Ga0495652_0016109 3300046529 Bacteria 6687
451 Ga0495652_0022042 3300046529 Bacteria 5657
452 Ga0495654_0105686 3300046530 Bacteria 1290
453 Ga0495665_0007323 3300046531 Bacteria 5962
454 Ga0495665_0025738 3300046531 Bacteria 3159
455 Ga0495665_0031641 3300046531 Bacteria 2831
456 Ga0495640_0002326 3300046533 Bacteria 15238
457 Ga0495586_0003517 3300046535 Bacteria 8396
458 Ga0495587_0001881 3300046536 Bacteria 13965
459 Ga0495621_0168995 3300046539 Bacteria 868
460 Ga0495597_0004407 3300046542 Bacteria 7743
461 Ga0495597_0153369 3300046542 Bacteria 944
462 Ga0495645_0005460 3300046543 Bacteria 8729
463 Ga0495622_0011054 3300046557 Bacteria 4167
464 Ga0495634_0002290 3300046642 Bacteria 16016
465 Ga0495611_0087594 3300046648 Bacteria 1437
466 Ga0495635_0007409 3300046663 Bacteria 7657
467 Ga0495661_0003670 3300046665 Bacteria 11274
468 Ga0495661_0239276 3300046665 Bacteria 932
469 Ga0495588_0006224 3300046674 Bacteria 5364
470 Ga0495599_0013555 3300046678 Bacteria 5036
471 Ga0495599_0131619 3300046678 Bacteria 1553
472 Ga0495623_0010059 3300046679 Bacteria 6124
473 Ga0495623_0027377 3300046679 Bacteria 3667
474 Ga0495623_0034052 3300046679 Bacteria 3267
475 Ga0495646_0003765 3300046680 Bacteria 9481
476 Ga0495646_0014462 3300046680 Bacteria 5019
477 Ga0495646_0138888 3300046680 Bacteria 1361
478 Ga0495658_0042888 3300046683 Bacteria 2528
479 Ga0495658_0200910 3300046683 Bacteria 1242
480 Ga0495658_0216906 3300046683 Bacteria 1197
481 Ga0495669_0015016 3300046684 Bacteria 3312
482 Ga0495669_0042644 3300046684 Bacteria 2018
483 Ga0495613_0076793 3300046689 Bacteria 2430
484 Ga0495613_0077984 3300046689 Bacteria 2410
485 Ga0495613_0184025 3300046689 Bacteria 1479
486 Ga0495624_0000075 3300046690 Bacteria 64684
487 Ga0495624_0009522 3300046690 Bacteria 6728
488 Ga0495624_0027453 3300046690 Bacteria 3727
489 Ga0495624_0052342 3300046690 Bacteria 2580
490 Ga0495670_0015387 3300046691 Bacteria 3760
491 Ga0495671_0043258 3300046692 Bacteria 2261
492 Ga0495671_0071233 3300046692 Bacteria 1708
493 Ga0495671_0167885 3300046692 Bacteria 1067
494 Ga0495649_0003850 3300046694 Bacteria 9937
495 Ga0495589_0015981 3300046794 Bacteria 3858
496 Ga0495600_0020766 3300046809 Bacteria 4202
497 Ga0495600_0049456 3300046809 Bacteria 2743
498 Ga0495660_0119335 3300046810 Bacteria 1336
499 Ga0495604_0004823 3300047317 Bacteria 10692
500 Ga0495604_0006838 3300047317 Bacteria 9035
501 Ga0495604_0032724 3300047317 Bacteria 4119
502 Ga0495604_0049253 3300047317 Bacteria 3274
503 Ga0495636_0013819 3300047318 Bacteria 3205
504 Ga0495674_0009080 3300047319 Bacteria 9443
505 Ga0495674_0014689 3300047319 Bacteria 7327
506 Ga0495674_0043688 3300047319 Bacteria 3987
507 Ga0495674_0074087 3300047319 Bacteria 2933
508 Ga0495674_0132048 3300047319 Bacteria 2103
509 Ga0495674_0443718 3300047319 Bacteria 1043
510 Ga0495674_0617843 3300047319 Bacteria 857
511 Ga0495672_0007830 3300047320 Bacteria 7979
512 Ga0495672_0051961 3300047320 Bacteria 2410
513 Ga0495672_0078227 3300047320 Bacteria 1851
514 Ga0495676_0051317 3300047321 Bacteria 3301
515 Ga0495680_0003981 3300047322 Bacteria 14271
516 Ga0495680_0014609 3300047322 Bacteria 6795
517 Ga0495680_0071796 3300047322 Bacteria 2634
518 Ga0495687_000147 3300047443 Bacteria 107007
519 Ga0495687_021603 3300047443 Bacteria 3109
520 Ga0495675_0022124 3300047444 Bacteria 4052
521 Ga0495675_0195496 3300047444 Bacteria 1233
522 Ga0495677_0078687 3300047445 Bacteria 1234
523 Ga0495679_001149 3300047446 Bacteria 15834
524 Ga0495673_0035017 3300047469 Bacteria 2317
525 Ga0495673_0055377 3300047469 Bacteria 1720
526 Ga0495673_0085675 3300047469 Bacteria 1296
527 Ga0495684_0013565 3300047471 Bacteria 6274
528 Ga0495684_0073010 3300047471 Bacteria 2607
529 Ga0495593_0001649 3300047673 Bacteria 13211
530 Ga0495593_0001848 3300047673 Bacteria 12592
531 Ga0495593_0003306 3300047673 Bacteria 9659
532 Ga0495593_0074073 3300047673 Bacteria 1766
533 Ga0495602_0005852 3300048088 Bacteria 12905
534 Ga0495602_0020836 3300048088 Bacteria 6470
535 Ga0495602_0028183 3300048088 Bacteria 5379
536 Ga0495614_0006482 3300048089 Bacteria 5251
537 Ga0495626_0051788 3300048091 Bacteria 1893
538 Ga0496100_0025833 3300048903 Bacteria 3594
539 Ga0496100_0175316 3300048903 Bacteria 1547
540 Ga0496101_0048884 3300048904 Bacteria 3041
541 Ga0496101_0054911 3300048904 Bacteria 2875
542 Ga0496101_0073423 3300048904 Bacteria 2513
543 Ga0496101_0201257 3300048904 Bacteria 1540
544 Ga0496101_0352077 3300048904 Bacteria 1157
545 Ga0496102_0015420 3300048905 Bacteria 6656
546 Ga0496102_0091223 3300048905 Bacteria 2820
547 Ga0496102_0255386 3300048905 Bacteria 1652
548 Ga0496103_0089788 3300048906 Bacteria 1938
549 Ga0496103_0330355 3300048906 Bacteria 981
550 Ga0496104_0018029 3300048907 Bacteria 6436
551 Ga0496104_0026129 3300048907 Bacteria 5387
552 Ga0496104_0047120 3300048907 Bacteria 4062
553 Ga0496104_0221881 3300048907 Bacteria 1802
554 Ga0496104_0685787 3300048907 Bacteria 932
555 Ga0496105_0002350 3300048908 Bacteria 13708
556 Ga0496105_0066697 3300048908 Bacteria 2972
557 Ga0496105_0127991 3300048908 Bacteria 2094
558 Ga0496106_0073491 3300048909 Bacteria 2616
559 Ga0496106_0276125 3300048909 Bacteria 1346
560 Ga0496107_0046070 3300048910 Bacteria 3138
561 Ga0496107_0220759 3300048910 Bacteria 1410
562 Ga0496108_0010142 3300048911 Bacteria 7645
563 Ga0496108_0515488 3300048911 Bacteria 1044
564 Ga0496109_0012474 3300048912 Bacteria 7338
565 Ga0496109_0585360 3300048912 Bacteria 1052
566 Ga0496110_0400497 3300048913 Bacteria 1251
567 Ga0496111_0069869 3300048914 Bacteria 2554
568 Ga0496111_0502117 3300048914 Bacteria 893
569 Ga0496112_0004400 3300048915 Bacteria 11918
570 Ga0496112_0172294 3300048915 Bacteria 2129
571 Ga0496113_0001673 3300048916 Bacteria 12543
572 Ga0496113_0042546 3300048916 Bacteria 3358
573 Ga0496113_0169669 3300048916 Bacteria 1728
574 Ga0496114_0130328 3300048917 Bacteria 2171
575 Ga0496117_0014859 3300048920 Bacteria 6680
576 Ga0496117_0052334 3300048920 Bacteria 2877
577 Ga0496118_0008375 3300048921 Bacteria 10696
578 Ga0496118_0055322 3300048921 Bacteria 2996
579 Ga0496118_0075068 3300048921 Bacteria 2413
580 Ga0496118_0202153 3300048921 Bacteria 1175
581 Ga0496119_0014868 3300048922 Bacteria 6051
582 Ga0496119_0015651 3300048922 Bacteria 5821
583 Ga0496120_0036007 3300048923 Bacteria 2951
584 Ga0496120_0046765 3300048923 Bacteria 2499
585 Ga0496121_0000084 3300048924 Bacteria 225942
586 Ga0496121_0003493 3300048924 Bacteria 22347
587 Ga0496121_0011485 3300048924 Bacteria 9820
588 Ga0496121_0161132 3300048924 Bacteria 1640
589 Ga0496122_0006869 3300048925 Bacteria 12885
590 Ga0496122_0010408 3300048925 Bacteria 9596
591 Ga0496122_0019831 3300048925 Bacteria 6120
592 Ga0496123_0036994 3300048926 Bacteria 3452
593 Ga0496123_0045033 3300048926 Bacteria 3010
594 Ga0496123_0065170 3300048926 Bacteria 2317
595 Ga0496124_0004794 3300048927 Bacteria 15575
596 Ga0496124_0077643 3300048927 Bacteria 2738
597 Ga0496124_0242962 3300048927 Bacteria 1337
598 Ga0496125_0002566 3300048928 Bacteria 23401
599 Ga0496125_0007675 3300048928 Bacteria 11435
600 Ga0496126_0039588 3300048929 Bacteria 4373
601 Ga0496126_0425527 3300048929 Bacteria 1072
602 Ga0496126_0444324 3300048929 Bacteria 1045
603 Ga0495678_062278 3300049459 Bacteria 1397
604 Ga0495682_0015622 3300049460 Bacteria 2876
605 Ga0501034_0000379 3300049571 Bacteria 75837
606 Ga0501072_0209185 3300049588 Bacteria 1555
607 nmdc:mga0yw44_19495_c1 3300050492 Bacteria 3742
608 nmdc:mga0k408_55510_c1 3300050493 Bacteria 2297
609 nmdc:mga0k408_75047_c1 3300050493 Bacteria 1976
610 nmdc:mga06z11_173760_c1 3300050494 Bacteria 1238
611 nmdc:mga06z11_35045_c1 3300050494 Bacteria 2467
612 nmdc:mga07m45_22018_c1 3300050496 Bacteria 3478
613 nmdc:mga0n895_95971_c1 3300050512 Bacteria 2970
614 nmdc:mga0rr50_182132_c1 3300050513 Bacteria 1718
615 nmdc:mga0sz30_151397_c1 3300050516 Bacteria 1026
616 Ga0500644_0005593 3300053088 Bacteria 3179
617 Ga0500562_014336 3300053108 Bacteria 2030
618 Ga0500642_0061725 3300053130 Bacteria 1685
619 Ga0500568_0001090 3300053139 Bacteria 18264
620 Ga0500586_123601 3300053145 Bacteria 899
621 Ga0500616_0000203 3300053153 Bacteria 97028
622 Ga0500616_0000294 3300053153 Bacteria 72551
623 Ga0500634_0064221 3300053161 Bacteria 1940
624 Ga0501082_0501570 3300060353 Bacteria 1061
625 2510899945 2510461076 Bacteria 8618824
626 2510900541 2510461076 Bacteria 8618824
627 2511131768 2510917022 Bacteria 6504556
628 2511170888 2510917026 Bacteria 7046020
629 2511194184 2510917030 Bacteria 7460662
630 2513631664 2513237093 Bacteria 7545552
631 2514021405 2513237162 Bacteria 7468464
632 2514591190 2513237351 Bacteria 6968952
633 2515115364 2515075009 Bacteria 7288508
634 2515636093 2515154113 Bacteria 7807172
635 2515644750 2515154114 Bacteria 7848616
636 2515658050 2515154116 Bacteria 7552979
637 2517041638 2516653077 Bacteria 7555578
638 2563065009 2562617112 Bacteria 10918404
639 2585278015 2582581308 Bacteria 7413247
640 2585328311 2582581315 Bacteria 7318924
641 2585332092 2582581316 Bacteria 7774528
642 2585536934 2585427527 Bacteria 7273426
643 2585554570 2585427530 Bacteria 7383882
644 2585564477 2585427531 Bacteria 6992870
645 2585996417 2585427633 Bacteria 6413184
646 2586001027 2585427634 Bacteria 6455027
647 2600197593 2599185352 Bacteria 7228948
648 2616309063 2615840626 Bacteria 7921970
649 2616552589 2615840698 Bacteria 7319877
650 2617383190 2617270742 Bacteria 6808054
651 2643808898 2643221557 Bacteria 7184309
652 2643811235 2643221558 Bacteria 5460675
653 2644064336 2643221610 Bacteria 7480339
654 2644105190 2643221618 Bacteria 7717186
655 2644309602 2643221655 Bacteria 7722067
656 2644335229 2643221659 Bacteria 7890716
657 2644379711 2643221668 Bacteria 7306521
658 2644416167 2643221675 Bacteria 7473456
659 2644449208 2643221680 Bacteria 7473610
660 2644540816 2643221698 Bacteria 7756764
661 2644616127 2643221712 Bacteria 7729434
662 2644674088 2643221723 Bacteria 7095460
663 2644691967 2643221726 Bacteria 7455827
664 2671116723 2667528174 Bacteria 6435400
665 2713482002 2711768613 Bacteria 11048459
666 2725945640 2724679232 Bacteria 7646494
667 2776910901 2775507049 Bacteria 6284736
668 2778178835 2775507266 Bacteria 7392367
669 2819644018 2818991453 Bacteria 7181617
670 2842114609 2842110456 Bacteria 7656360
671 2842223096 2842217011 Bacteria 7497767
672 2842485733 2842482326 Bacteria 7212537
673 2852394752 2852387548 Bacteria 8025568
674 2858697617 2858688981 Bacteria 8184122
675 2885278793 2885270888 Bacteria 9831543
676 2919104745 2919100787 Bacteria 7710546
677 2919174500 2919171160 Bacteria 6499771
678 2919414138 2919408235 Bacteria 6149349
679 2920827443 2920822456 Bacteria 6897201
680 2933590535 2933586486 Bacteria 7667493
681 2941505275 2941499720 Bacteria 7599444
682 2996312339 2996310559 Bacteria 6357320
683 3005423493 3005416602 Bacteria 7064308
684 639651373 639633055 Bacteria 7751309
685 8005321007 8005314921 Bacteria 7072929
686 8005466589 8005460587 Bacteria 7157962
687 8005486339 8005484373 Bacteria 6297373
688 8005683952 8005682033 Bacteria 6726518
689 8018151196 8018150411 Bacteria 5549903
690 8046771299 8046767195 Bacteria 7547379
691 8057576095 8057575449 Bacteria 7367519
692 8057880800 8057874678 Bacteria 7494653
693 Ga0307515_10140162
694 JGI24740J21852_10000448
695 JGI25155J39150_1000242
696 JGI25156J39149_1000561
697 JGI25162J39368_1000317
698 JGI25162J39368_1000864
699 JGI25154J39366_1000464
700 JGI25157J39369_1000598
701 JGI25152J39213_1000690
702 JGI25159J45721_1000141
703 JGI25159J45721_1001217
704 JGI25165J46597_1000432
705 JGI25165J46597_1000576
706 JGI25165J46597_1009404
707 JGI25153J46596_10000205
708 JGI25153J46596_10041607
709 rootH1_10149566
710 JGI25160J50197_1000018
711 JGI25160J50197_1000318
712 JGI25161J50226_1000088
713 JGI25161J50226_1001492
714 Ga0055526_1005835
715 Ga0055524_1001298
716 Ga0055524_1037304
717 Ga0055536_1001378
718 Ga0055536_1032940
719 Ga0055530_10013202
720 Ga0055531_10013324
721 Ga0055531_10037059
722 Ga0058692_1005198
723 Ga0055543_1000004
724 Ga0055543_1000414
725 Ga0065165_1000065
726 Ga0065165_1002809
727 Ga0070658_10104778
728 Ga0070676_10123030
729 Ga0070676_10164342
730 Ga0070683_100069609
731 Ga0070683_100400408
732 Ga0070690_100007793
733 Ga0070670_100001858
734 Ga0070670_100002742
735 Ga0070670_100058771
736 Ga0070677_10027515
737 Ga0070677_10126050
738 Ga0068869_100000178
739 Ga0068869_100028538
740 Ga0070666_10003416
741 Ga0070666_10028053
742 Ga0068868_100007519
743 Ga0068868_100042099
744 Ga0068868_100109326
745 Ga0070687_100058068
746 Ga0070661_100004971
747 Ga0070668_100012507
748 Ga0070668_100014910
749 Ga0070668_100090004
750 Ga0070668_100235008
751 Ga0070668_100328005
752 Ga0070669_100006527
753 Ga0070669_100059883
754 Ga0070675_100002209
755 Ga0070675_100126869
756 Ga0070671_100003475
757 Ga0070671_100008025
758 Ga0070671_100019353
759 Ga0070671_100136998
760 Ga0070674_100012576
761 Ga0070674_100024901
762 Ga0070674_100061174
763 Ga0070673_100007554
764 Ga0070673_100029140
765 Ga0070673_100580438
766 Ga0070688_100020269
767 Ga0070659_100010938
768 Ga0070667_100001198
769 Ga0070667_100004710
770 Ga0070667_100066233
771 Ga0070667_100396890
772 Ga0070667_100509310
773 Ga0070714_100002111
774 Ga0070714_100029168
775 Ga0070714_100223066
776 Ga0070714_100268630
777 Ga0070713_100003455
778 Ga0070713_100337257
779 Ga0070710_10000193
780 Ga0070701_10134940
781 Ga0070711_100000687
782 Ga0070705_100112034
783 Ga0070694_100084208
784 Ga0070678_100003099
785 Ga0070678_100007564
786 Ga0070662_100010850
787 Ga0068867_100000273
788 Ga0068867_100003231
789 Ga0068867_100007980
790 Ga0068867_100060518
791 Ga0068853_100173358
792 Ga0068853_100669605
793 Ga0070672_100000495
794 Ga0070672_100006786
795 Ga0070672_100022728
796 Ga0070672_100150917
797 Ga0070695_100102727
798 Ga0070695_100161745
799 Ga0070696_100156367
800 Ga0068855_100009005
801 Ga0068855_100032192
802 Ga0070664_100040340
803 Ga0068857_100001689
804 Ga0068854_100044953
805 Ga0068856_100014753
806 Ga0068856_100015860
807 Ga0068852_100428487
808 Ga0068859_100007644
809 Ga0068859_100146845
810 Ga0068864_100000199
811 Ga0068864_100000873
812 Ga0068864_100112665
813 Ga0068864_100471845
814 Ga0068866_10023797
815 Ga0068861_100001618
816 Ga0068861_100018943
817 Ga0068870_10012094
818 Ga0068870_10102805
819 Ga0068863_100001289
820 Ga0068863_100011193
821 Ga0068863_100346699
822 Ga0068858_100000413
823 Ga0068858_100008196
824 Ga0068858_100060477
825 Ga0068860_100002069
826 Ga0068860_100011743
827 Ga0068860_100046991
828 Ga0068860_100109849
829 Ga0068862_100004502
830 Ga0068862_100339231
831 Ga0070716_100003662
832 Ga0070712_100041172
833 Ga0075367_10321505
834 Ga0075366_10004099
835 Ga0075366_10015971
836 Ga0075366_10138688
837 Ga0075370_10003981
838 Ga0075430_100301532
839 Ga0075434_100061513
840 Ga0068865_100003699
841 Ga0068865_100071709
842 Ga0068865_100482604
843 Ga0097620_100007644
844 Ga0097620_100146845
845 Ga0075435_100007006
846 Ga0075435_100739025
847 Ga0105240_10000290
848 Ga0105240_10017596
849 Ga0105240_10031112
850 Ga0105243_10033029
851 Ga0105242_10166777
852 Ga0105248_10003661
853 Ga0105248_10034653
854 Ga0105248_10188727
855 Ga0105248_10811012
856 Ga0105237_10003258
857 Ga0105238_10519249
858 Ga0105239_10000202
859 Ga0105246_10132002
860 Ga0157370_10001158
861 Ga0157370_10037327
862 Ga0157370_10246996
863 Ga0157369_10010878
864 Ga0157374_10045383
865 Ga0157378_10020149
866 Ga0157378_10031170
867 Ga0157378_10038379
868 Ga0163162_10001045
869 Ga0163162_10027013
870 Ga0163162_10090848
871 Ga0157372_10052553
872 Ga0157375_10022778
873 Ga0157375_10036004
874 Ga0157375_10159208
875 Ga0157375_10273016
876 Ga0163163_10001130
877 Ga0163163_10003778
878 Ga0163163_10435863
879 Ga0163163_10906303
880 Ga0157380_10038599
881 Ga0157380_10332107
882 Ga0182008_10017627
883 Ga0157377_10036573
884 Ga0157379_10000910
885 Ga0157379_10027181
886 Ga0157379_10051847
887 Ga0157376_10079504
888 Ga0182007_10008539
889 Ga0213874_10089484
890 Ga0209435_100144
891 Ga0209436_104224
892 Ga0209437_100023
893 Ga0209437_100341
894 Ga0207425_1000706
895 Ga0209646_1000417
896 Ga0209646_1013585
897 Ga0209646_1020113
898 Ga0209026_1000576
899 Ga0209677_100626
900 Ga0209148_1019926
901 Ga0209759_1000837
902 Ga0209129_1000276
903 Ga0209233_1000062
904 Ga0209233_1000334
905 Ga0209233_1000355
906 Ga0209130_1000035
907 Ga0209130_1000271
908 Ga0209676_1001011
909 Ga0209676_1004121
910 Ga0209676_1033450
911 Ga0209025_1000558
912 Ga0209025_1001687
913 Ga0209564_1000537
914 Ga0209758_1000236
915 Ga0209758_1000503
916 Ga0209758_1031900
917 Ga0209050_1002264
918 Ga0209050_1014515
919 Ga0209256_1000089
920 Ga0209256_1003012
921 Ga0207426_1000017
922 Ga0207426_1000454
923 Ga0209051_1001676
924 Ga0209051_1002225
925 Ga0209051_1008098
926 Ga0209257_1004340
927 Ga0209257_1012526
928 Ga0209257_1029893
929 Ga0209257_1032255
930 Ga0207697_10024554
931 Ga0207656_10060519
932 Ga0207682_10004720
933 Ga0207682_10005376
934 Ga0207692_10001198
935 Ga0207688_10131070
936 Ga0207680_10033575
937 Ga0207680_10101773
938 Ga0207680_10305322
939 Ga0207699_10002099
940 Ga0207645_10083304
941 Ga0207645_10127574
942 Ga0207643_10003872
943 Ga0207643_10138546
944 Ga0207705_10088432
945 Ga0207707_10121200
946 Ga0207695_10000385
947 Ga0207695_10110712
948 Ga0207671_10001213
949 Ga0207693_10048355
950 Ga0207663_10170817
951 Ga0207660_10328801
952 Ga0207649_10010224
953 Ga0207649_10489118
954 Ga0207681_10116036
955 Ga0207694_10002311
956 Ga0207650_10000395
957 Ga0207650_10011031
958 Ga0207650_10083371
959 Ga0207650_10217836
960 Ga0207659_10005943
961 Ga0207659_10321670
962 Ga0207700_10004196
963 Ga0207700_10569570
964 Ga0207664_10069740
965 Ga0207664_10088265
966 Ga0207664_10275512
967 Ga0207644_10041513
968 Ga0207644_10099139
969 Ga0207644_10104122
970 Ga0207644_10376268
971 Ga0207690_10010611
972 Ga0207706_10011964
973 Ga0207706_10554168
974 Ga0207686_10262519
975 Ga0207709_10124537
976 Ga0207670_10127019
977 Ga0207669_10002091
978 Ga0207669_10014221
979 Ga0207669_10144563
980 Ga0207669_10465707
981 Ga0207704_10001633
982 Ga0207704_10008252
983 Ga0207665_10002946
984 Ga0207691_10001565
985 Ga0207691_10007092
986 Ga0207691_10035729
987 Ga0207711_10013035
988 Ga0207711_10110750
989 Ga0207689_10000049
990 Ga0207689_10043665
991 Ga0207679_10026243
992 Ga0207667_10025609
993 Ga0207667_10145119
994 Ga0207668_10017098
995 Ga0207668_10212733
996 Ga0207668_10282173
997 Ga0207668_10742656
998 Ga0207658_10035112
999 Ga0207658_10054636
1000 Ga0207677_10021191
1001 Ga0207677_10022978
1002 Ga0207677_10026487
1003 Ga0207703_10003906
1004 Ga0207703_10044254
1005 Ga0207639_10470852
1006 Ga0207708_10297466
1007 Ga0207702_10010905
1008 Ga0207702_10123865
1009 Ga0207641_10001628
1010 Ga0207641_10009424
1011 Ga0207641_10031679
1012 Ga0207648_10000487
1013 Ga0207648_10002306
1014 Ga0207648_10004053
1015 Ga0207648_10071316
1016 Ga0207676_10004825
1017 Ga0207676_10012619
1018 Ga0207674_10000155
1019 Ga0207674_10003275
1020 Ga0207675_100000368
1021 Ga0207675_100003946
1022 Ga0207683_10004829
1023 Ga0207683_10009549
1024 Ga0207683_10223225
1025 Ga0207683_10235218
1026 Ga0209371_1000225
1027 Ga0209371_1002417
1028 Ga0268266_10237769
1029 Ga0268266_10273661
1030 Ga0268265_10002358
1031 Ga0268265_10004246
1032 Ga0268265_10604345
1033 Ga0268264_10000624
1034 Ga0268264_10000850
1035 Ga0268264_10034838
1036 Ga0268264_10117669
1037 Ga0268256_1000179
1038 Ga0268256_1001637
1039 Ga0265327_10000186
1040 Ga0307513_10015075
1041 Ga0307408_100279906
1042 Ga0307405_10036390
1043 Ga0307405_10132656
1044 Ga0307413_10015566
1045 Ga0307410_10012401
1046 Ga0307406_10054354
1047 Ga0307412_10064074
1048 Ga0307409_100038266
1049 Ga0307409_100183626
1050 Ga0307416_100267631
1051 Ga0307414_10460896
1052 Ga0307414_10802156
1053 Ga0307415_100084726
1054 Ga0373932_0025191
1055 Ga0373943_0146383
1056 Ga0373942_0098105
1057 Ga0373947_0013567
1058 Ga0373937_0026334
1059 Ga0373925_0026938
1060 Ga0395900_0184084
1061 Ga0395901_0014056
1062 Ga0400483_139504
1063 Ga0400483_182941
1064 Ga0436363_1497704
1065 Ga0439436_0009273
1066 Ga0439438_011928
1067 Ga0439439_0001406
1068 Ga0439465_0000828
1069 Ga0451802_0902584
1070 Ga0451833_0047358
1071 Ga0451837_0181046
1072 Ga0451841_0401568
1073 Ga0451845_0201617
1074 Ga0451847_0435010
1075 Ga0451849_0452182
1076 Ga0451851_0585368
1077 Ga0451855_1734518
1078 Ga0451853_3420142
1079 Ga0439442_034955
1080 Ga0439432_021996
1081 Ga0439452_008863
1082 Ga0439457_012904
1083 Ga0439462_0005777
1084 Ga0450894_008873
1085 Ga0450898_000954
1086 Ga0450906_012008
1087 Ga0439434_0059775
1088 Ga0466965_0024561
1089 Ga0451576_0500071
1090 Ga0495592_0150449
1091 Ga0495603_0011274
1092 Ga0495603_0077046
1093 Ga0495603_0177048
1094 Ga0495629_0000042
1095 Ga0495629_0009772
1096 Ga0495629_0016766
1097 Ga0495638_0019667
1098 Ga0495653_0013257
1099 Ga0495653_0043801
1100 Ga0495650_0024031
1101 Ga0495580_0000479
1102 Ga0495580_0004586
1103 Ga0495580_0014603
1104 Ga0495580_0032222
1105 Ga0495580_0049848
1106 Ga0495580_0148034
1107 Ga0495582_0000778
1108 Ga0495582_0026493
1109 Ga0495605_0002559
1110 Ga0495605_0013110
1111 Ga0495662_0064786
1112 Ga0495664_0000344
1113 Ga0495664_0039719
1114 Ga0495664_0041532
1115 Ga0495584_0077597
1116 Ga0495585_0043322
1117 Ga0495594_0007150
1118 Ga0495596_0056281
1119 Ga0495607_0068032
1120 Ga0495607_0111860
1121 Ga0495583_0004161
1122 Ga0495583_0011018
1123 Ga0495583_0037996
1124 Ga0495606_0171664
1125 Ga0495606_0221989
1126 Ga0495616_0077185
1127 Ga0495616_0090851
1128 Ga0495618_0006127
1129 Ga0495628_0003840
1130 Ga0495628_0021909
1131 Ga0495628_0022620
1132 Ga0495630_0001703
1133 Ga0495630_0006855
1134 Ga0495643_0010277
1135 Ga0495648_0000909
1136 Ga0495648_0004253
1137 Ga0495648_0029227
1138 Ga0495648_0034657
1139 Ga0495666_0001722
1140 Ga0495666_0010850
1141 Ga0495666_0147719
1142 Ga0495652_0016109
1143 Ga0495652_0022042
1144 Ga0495654_0105686
1145 Ga0495665_0007323
1146 Ga0495665_0025738
1147 Ga0495665_0031641
1148 Ga0495640_0002326
1149 Ga0495586_0003517
1150 Ga0495587_0001881
1151 Ga0495621_0168995
1152 Ga0495597_0004407
1153 Ga0495597_0153369
1154 Ga0495645_0005460
1155 Ga0495622_0011054
1156 Ga0495634_0002290
1157 Ga0495611_0087594
1158 Ga0495635_0007409
1159 Ga0495661_0003670
1160 Ga0495661_0239276
1161 Ga0495588_0006224
1162 Ga0495599_0013555
1163 Ga0495599_0131619
1164 Ga0495623_0010059
1165 Ga0495623_0027377
1166 Ga0495623_0034052
1167 Ga0495646_0003765
1168 Ga0495646_0014462
1169 Ga0495646_0138888
1170 Ga0495658_0042888
1171 Ga0495658_0200910
1172 Ga0495658_0216906
1173 Ga0495669_0015016
1174 Ga0495669_0042644
1175 Ga0495613_0076793
1176 Ga0495613_0077984
1177 Ga0495613_0184025
1178 Ga0495624_0000075
1179 Ga0495624_0009522
1180 Ga0495624_0027453
1181 Ga0495624_0052342
1182 Ga0495670_0015387
1183 Ga0495671_0043258
1184 Ga0495671_0071233
1185 Ga0495671_0167885
1186 Ga0495649_0003850
1187 Ga0495589_0015981
1188 Ga0495600_0020766
1189 Ga0495600_0049456
1190 Ga0495660_0119335
1191 Ga0495604_0004823
1192 Ga0495604_0006838
1193 Ga0495604_0032724
1194 Ga0495604_0049253
1195 Ga0495636_0013819
1196 Ga0495674_0009080
1197 Ga0495674_0014689
1198 Ga0495674_0043688
1199 Ga0495674_0074087
1200 Ga0495674_0132048
1201 Ga0495674_0443718
1202 Ga0495674_0617843
1203 Ga0495672_0007830
1204 Ga0495672_0051961
1205 Ga0495672_0078227
1206 Ga0495676_0051317
1207 Ga0495680_0003981
1208 Ga0495680_0014609
1209 Ga0495680_0071796
1210 Ga0495687_000147
1211 Ga0495687_021603
1212 Ga0495675_0022124
1213 Ga0495675_0195496
1214 Ga0495677_0078687
1215 Ga0495679_001149
1216 Ga0495673_0035017
1217 Ga0495673_0055377
1218 Ga0495673_0085675
1219 Ga0495684_0013565
1220 Ga0495684_0073010
1221 Ga0495593_0001649
1222 Ga0495593_0001848
1223 Ga0495593_0003306
1224 Ga0495593_0074073
1225 Ga0495602_0005852
1226 Ga0495602_0020836
1227 Ga0495602_0028183
1228 Ga0495614_0006482
1229 Ga0495626_0051788
1230 Ga0496100_0025833
1231 Ga0496100_0175316
1232 Ga0496101_0048884
1233 Ga0496101_0054911
1234 Ga0496101_0073423
1235 Ga0496101_0201257
1236 Ga0496101_0352077
1237 Ga0496102_0015420
1238 Ga0496102_0091223
1239 Ga0496102_0255386
1240 Ga0496103_0089788
1241 Ga0496103_0330355
1242 Ga0496104_0018029
1243 Ga0496104_0026129
1244 Ga0496104_0047120
1245 Ga0496104_0221881
1246 Ga0496104_0685787
1247 Ga0496105_0002350
1248 Ga0496105_0066697
1249 Ga0496105_0127991
1250 Ga0496106_0073491
1251 Ga0496106_0276125
1252 Ga0496107_0046070
1253 Ga0496107_0220759
1254 Ga0496108_0010142
1255 Ga0496108_0515488
1256 Ga0496109_0012474
1257 Ga0496109_0585360
1258 Ga0496110_0400497
1259 Ga0496111_0069869
1260 Ga0496111_0502117
1261 Ga0496112_0004400
1262 Ga0496112_0172294
1263 Ga0496113_0001673
1264 Ga0496113_0042546
1265 Ga0496113_0169669
1266 Ga0496114_0130328
1267 Ga0496117_0014859
1268 Ga0496117_0052334
1269 Ga0496118_0008375
1270 Ga0496118_0055322
1271 Ga0496118_0075068
1272 Ga0496118_0202153
1273 Ga0496119_0014868
1274 Ga0496119_0015651
1275 Ga0496120_0036007
1276 Ga0496120_0046765
1277 Ga0496121_0000084
1278 Ga0496121_0003493
1279 Ga0496121_0011485
1280 Ga0496121_0161132
1281 Ga0496122_0006869
1282 Ga0496122_0010408
1283 Ga0496122_0019831
1284 Ga0496123_0036994
1285 Ga0496123_0045033
1286 Ga0496123_0065170
1287 Ga0496124_0004794
1288 Ga0496124_0077643
1289 Ga0496124_0242962
1290 Ga0496125_0002566
1291 Ga0496125_0007675
1292 Ga0496126_0039588
1293 Ga0496126_0425527
1294 Ga0496126_0444324
1295 Ga0495678_062278
1296 Ga0495682_0015622
1297 Ga0501034_0000379
1298 Ga0501072_0209185
1299 nmdc:mga0yw44_19495_c1
1300 nmdc:mga0k408_55510_c1
1301 nmdc:mga0k408_75047_c1
1302 nmdc:mga06z11_173760_c1
1303 nmdc:mga06z11_35045_c1
1304 nmdc:mga07m45_22018_c1
1305 nmdc:mga0n895_95971_c1
1306 nmdc:mga0rr50_182132_c1
1307 nmdc:mga0sz30_151397_c1
1308 Ga0500644_0005593
1309 Ga0500562_014336
1310 Ga0500642_0061725
1311 Ga0500568_0001090
1312 Ga0500586_123601
1313 Ga0500616_0000203
1314 Ga0500616_0000294
1315 Ga0500634_0064221
1316 Ga0501082_0501570
1317 2510899945
1318 2510900541
1319 2511131768
1320 2511170888
1321 2511194184
1322 2513631664
1323 2514021405
1324 2514591190
1325 2515115364
1326 2515636093
1327 2515644750
1328 2515658050
1329 2517041638
1330 2563065009
1331 2585278015
1332 2585328311
1333 2585332092
1334 2585536934
1335 2585554570
1336 2585564477
1337 2585996417
1338 2586001027
1339 2600197593
1340 2616309063
1341 2616552589
1342 2617383190
1343 2643808898
1344 2643811235
1345 2644064336
1346 2644105190
1347 2644309602
1348 2644335229
1349 2644379711
1350 2644416167
1351 2644449208
1352 2644540816
1353 2644616127
1354 2644674088
1355 2644691967
1356 2671116723
1357 2713482002
1358 2725945640
1359 2776910901
1360 2778178835
1361 2819644018
1362 2842114609
1363 2842223096
1364 2842485733
1365 2852394752
1366 2858697617
1367 2885278793
1368 2919104745
1369 2919174500
1370 2919414138
1371 2920827443
1372 2933590535
1373 2941505275
1374 2996312339
1375 3005423493
1376 639651373
1377 8005321007
1378 8005466589
1379 8005486339
1380 8005683952
1381 8018151196
1382 8046771299
1383 8057576095
1384 8057880800

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00378

ECH_1

Enoyl-CoA hydratase/isomerase

17

268

0.96

PF16113

ECH_2

Enoyl-CoA hydratase/isomerase

22

205

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3qxi-assembly1.cif.gz_A crystal structure of enoyl-coa hydratase echa1 from mycobacterium marinum 0.9328 1 258
3qxi-assembly1.cif.gz_A crystal structure of enoyl-coa hydratase echa1 from mycobacterium marinum 0.9291 1 258
5kjp-assembly1.cif.gz_A crystal structure of enoyl-coa hydratase from mycobacterium tuberculosis h37rv 0.925 2 258
3qxi-assembly1.cif.gz_C crystal structure of enoyl-coa hydratase echa1 from mycobacterium marinum 0.9245 2 258
3trr-assembly2.cif.gz_D crystal structure of a probable enoyl-coa hydratase/isomerase from mycobacterium abscessus 0.9217 1 258
ID Description Score Start End Superfamily
3rsiC01 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3; 0.9723 2 55 3.30.300.220
3rsiB02 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1; 0.9434 97 198 3.90.226.20
2ej5A01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9208 1 200 3.90.226.10
3qxiB01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9203 2 200 3.90.226.10
3hrxF01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9175 3 200 3.90.226.10
ID Description Score Start End GO Terms
AF-A0A1X9LR19-F1-model_v4 Crotonase 0.9662 2 256 GO:0003824
AF-A0A536TMJ6-F1-model_v4 Crotonase 0.9566 1 214 GO:0003824
GO:0006635
AF-A0A2V6PNF0-F1-model_v4 Enoyl-CoA hydratase 0.9516 2 258 GO:0006635
GO:0016829
AF-A0A1X9LR19-F1-model_v4 Crotonase 0.9515 2 256 GO:0003824
AF-A0A537J0F6-F1-model_v4 Crotonase 0.9491 2 258 GO:0006635
GO:0016836

Map