F475573
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 692 | 356 | 1384 | 324 |
Family's Representative Sequence
| Representative Sequence | 3300006038|Ga0075365_10048639|Ga0075365_100486392 |
| Length | 323 |
| Sequence | MKHIKLRDLDVSRIGLGAMGMSFGYTGAGSDDAESIRTIHRALELGVTFIDTAEVYGPYTNEELVGQALKGRRDEVVVATKFGFISHTGRDGLDSSPASIRAAVEGSLRRLGTDYIDLYYQHRVDPNTPIEDTVGALADLVTAGKVRHIGLSEAGVNTIRRANAVHPITALQSEYSLWTRDPEDGILAVTRELGIGFVPYSPLGHGFLTGHIRSMDDLADDDWRKTNPRFMGENFQRNLGIADEVEAIAKEVGATPAQIAIAWLLAQGDDIAPIPGTKRVSRVEENVAAGEIELTAGQLEKLNNLTPPEGDHHNEAQMQMLDR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 2 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 3 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 4 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 5 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 6 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 34 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 41 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 49 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 50 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 51 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 53 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 54 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 55 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 56 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 57 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 58 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 59 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 60 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 62 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 63 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 66 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 68 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 69 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 70 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 71 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 72 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 74 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 154 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 155 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 156 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 157 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 158 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 159 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 160 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 161 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 162 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 163 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 164 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 165 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 166 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 167 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 168 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 169 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 170 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 171 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 172 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 173 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 174 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 175 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 176 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 177 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 178 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 179 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 180 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 181 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 182 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 183 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 184 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 185 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 186 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 187 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 188 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 189 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 190 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 191 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 192 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 193 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 194 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 195 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 196 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 197 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 252 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 253 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 254 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 255 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 256 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 257 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 258 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 259 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 260 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 261 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 262 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 263 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 264 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 265 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 266 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 267 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 268 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 269 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 270 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 272 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 285 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 286 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 287 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 288 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 289 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 290 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 291 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 294 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 295 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 297 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 298 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 299 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 300 | 3300053100 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere | Metagenome | Endosphere |
| 301 | 3300053101 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere | Metagenome | Endosphere |
| 302 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 303 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 304 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 305 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 306 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 307 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 308 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 309 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 310 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 311 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 312 | 2508501039 | Frankia saprophytica CN3 | Isolate | Nodule |
| 313 | 2582581314 | Streptomyces mirabilis YR139 | Isolate | Rhizosphere |
| 314 | 2619618881 | Frankia sp. ACN1ag | Isolate | Unclassified |
| 315 | 2619619003 | Frankia sp. CpI1-P | Isolate | Nodule |
| 316 | 2643221549 | Agromyces sp. Root1464 | Isolate | Unclassified |
| 317 | 2643221619 | Agromyces sp. Root81 | Isolate | Unclassified |
| 318 | 2643221647 | Streptomyces sp. Root369 | Isolate | Unclassified |
| 319 | 2643221678 | Streptomyces sp. Root1310 | Isolate | Unclassified |
| 320 | 2643221687 | Mycobacterium sp. Root135 | Isolate | Unclassified |
| 321 | 2643221714 | Streptomyces sp. Root264 | Isolate | Unclassified |
| 322 | 2643221715 | Mycobacterium sp. Root265 | Isolate | Unclassified |
| 323 | 2687453737 | Frankia sp. BMG5.36 | Isolate | Nodule |
| 324 | 2738541264 | Mycobacterium sp. OK889 | Isolate | Unclassified |
| 325 | 2738541272 | Promicromonospora sp. AC04 | Isolate | Unclassified |
| 326 | 2738541274 | Mycobacterium sp. YR708 | Isolate | Unclassified |
| 327 | 2738541356 | Mycobacterium sp. OK887 | Isolate | Unclassified |
| 328 | 2738543011 | Rhodococcus sp. OK611 | Isolate | Unclassified |
| 329 | 2738543027 | Promicromonospora sp. CF082 | Isolate | Unclassified |
| 330 | 2738543028 | Mycobacterium sp. YR782 | Isolate | Unclassified |
| 331 | 2808606357 | Arthrobacter sp. SLBN-122 | Isolate | Unclassified |
| 332 | 2808606359 | Streptomyces sp. RJA2910 | Isolate | Unclassified |
| 333 | 2811994878 | Nocardioides sp. SLBN-169 | Isolate | Unclassified |
| 334 | 2855670206 | Micromonospora noduli Lupac 07 | Isolate | Nodule |
| 335 | 2857288857 | Micromonospora noduli ONO23 | Isolate | Unclassified |
| 336 | 2858882152 | Micromonospora noduli MED15 | Isolate | Nodule |
| 337 | 2862382967 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 338 | 2867302475 | Micromonospora globbae WPS1-2 | Isolate | Unclassified |
| 339 | 2867312974 | Micromonospora musae NGC1-4 | Isolate | Unclassified |
| 340 | 2867319477 | Micromonospora musae MS1-9 | Isolate | Unclassified |
| 341 | 2869061728 | Micromonospora noduli ONO86 | Isolate | Unclassified |
| 342 | 2869068681 | Micromonospora noduli GUI43 | Isolate | Unclassified |
| 343 | 2889300758 | Rhodococcus sp. PvR099 | Isolate | Rhizosphere |
| 344 | 2895427314 | Nonomuraea sp. PA05 | Isolate | Unclassified |
| 345 | 2902837492 | Mycolicibacterium sp. P1-18 | Isolate | Unclassified |
| 346 | 2919443155 | Agromyces sp. 3263 | Isolate | Rhizosphere |
| 347 | 2929212328 | Mycolicibacterium sp. R-73050 Hybrid assembly | Isolate | Unclassified |
| 348 | 2935409751 | Agromyces sp. PvR057 | Isolate | Rhizosphere |
| 349 | 2946064051 | Streptomyces luteogriseus W4I19-1 | Isolate | Rhizosphere |
| 350 | 2954380949 | Streptomyces ciscaucasicus W1I15 | Isolate | Rhizosphere |
| 351 | 2954691527 | Streptomyces sp. SAI-127 | Isolate | Rhizosphere |
| 352 | 2954701450 | Streptomyces sp. SAI-144 | Isolate | Rhizosphere |
| 353 | 2966921586 | Rathayibacter agropyri 617 | Isolate | Rhizosphere |
| 354 | 8003870546 | Micromonospora tarensis STR1s_6 | Isolate | Rhizosphere |
| 355 | 8054913762 | Frankia gtarii Agncl-10 | Isolate | Nodule |
| 356 | 8054920844 | Frankia tisae Agncl-8 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.35 |
| Metatranscriptomes | 0 |
| Isolates | 6.65 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.5 |
| Nodule | 1.45 |
| Rhizoplane | 7.95 |
| Rhizosphere | 77.75 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0075365_10048639 | 3300006038 | Bacteria | 2792 |
| 2 | JGI24746J21847_1004018 | 3300001977 | Bacteria | 2325 |
| 3 | JGI24743J22301_10001378 | 3300001991 | Bacteria | 3342 |
| 4 | JGI24744J21845_10000396 | 3300002077 | Bacteria | 7497 |
| 5 | JGI24744J21845_10005179 | 3300002077 | Bacteria | 2698 |
| 6 | JGI24034J26672_10001333 | 3300002239 | Bacteria | 3261 |
| 7 | Ga0055540_1006181 | 3300003792 | Bacteria | 4817 |
| 8 | Ga0055540_1010612 | 3300003792 | Bacteria | 3048 |
| 9 | Ga0070658_10039986 | 3300005327 | Bacteria | 3783 |
| 10 | Ga0070658_10069482 | 3300005327 | Bacteria | 2882 |
| 11 | Ga0068869_100212835 | 3300005334 | Bacteria | 1529 |
| 12 | Ga0070666_10068643 | 3300005335 | Bacteria | 2409 |
| 13 | Ga0070682_100004757 | 3300005337 | Bacteria | 7545 |
| 14 | Ga0070682_100115187 | 3300005337 | Bacteria | 1797 |
| 15 | Ga0070682_100180864 | 3300005337 | Bacteria | 1473 |
| 16 | Ga0070682_100183975 | 3300005337 | Bacteria | 1462 |
| 17 | Ga0070682_100223157 | 3300005337 | Bacteria | 1343 |
| 18 | Ga0068868_100035174 | 3300005338 | Bacteria | 3871 |
| 19 | Ga0068868_100064616 | 3300005338 | Bacteria | 2905 |
| 20 | Ga0068868_100071203 | 3300005338 | Bacteria | 2773 |
| 21 | Ga0070660_100009501 | 3300005339 | Bacteria | 6843 |
| 22 | Ga0070660_100099540 | 3300005339 | Bacteria | 2302 |
| 23 | Ga0070691_10008091 | 3300005341 | Bacteria | 4813 |
| 24 | Ga0070691_10028420 | 3300005341 | Bacteria | 2613 |
| 25 | Ga0070668_100000877 | 3300005347 | Bacteria | 20899 |
| 26 | Ga0070668_100004512 | 3300005347 | Bacteria | 10325 |
| 27 | Ga0070669_100017305 | 3300005353 | Bacteria | 5142 |
| 28 | Ga0070671_100038422 | 3300005355 | Bacteria | 3974 |
| 29 | Ga0070674_100013754 | 3300005356 | Bacteria | 5009 |
| 30 | Ga0070674_100119660 | 3300005356 | Bacteria | 1948 |
| 31 | Ga0070673_100211019 | 3300005364 | Bacteria | 1677 |
| 32 | Ga0070688_100009305 | 3300005365 | Bacteria | 5367 |
| 33 | Ga0070688_100121418 | 3300005365 | Bacteria | 1751 |
| 34 | Ga0070659_100000460 | 3300005366 | Bacteria | 30067 |
| 35 | Ga0070659_100009238 | 3300005366 | Bacteria | 7238 |
| 36 | Ga0070659_100145606 | 3300005366 | Bacteria | 1930 |
| 37 | Ga0070667_100008396 | 3300005367 | Bacteria | 8564 |
| 38 | Ga0070709_10008866 | 3300005434 | Bacteria | 5537 |
| 39 | Ga0070713_100058022 | 3300005436 | Bacteria | 3226 |
| 40 | Ga0070710_10006172 | 3300005437 | Bacteria | 5736 |
| 41 | Ga0070710_10020408 | 3300005437 | Bacteria | 3437 |
| 42 | Ga0070710_10092833 | 3300005437 | Bacteria | 1783 |
| 43 | Ga0070701_10001539 | 3300005438 | Bacteria | 8552 |
| 44 | Ga0070711_100024067 | 3300005439 | Bacteria | 3968 |
| 45 | Ga0070711_100032930 | 3300005439 | Bacteria | 3449 |
| 46 | Ga0070711_100088733 | 3300005439 | Bacteria | 2223 |
| 47 | Ga0070711_100163043 | 3300005439 | Bacteria | 1692 |
| 48 | Ga0070705_100028889 | 3300005440 | Bacteria | 3042 |
| 49 | Ga0070700_100002146 | 3300005441 | Bacteria | 10002 |
| 50 | Ga0070708_100048426 | 3300005445 | Bacteria | 3756 |
| 51 | Ga0070678_100005182 | 3300005456 | Bacteria | 7496 |
| 52 | Ga0070678_100294755 | 3300005456 | Bacteria | 1376 |
| 53 | Ga0070662_100009005 | 3300005457 | Bacteria | 6512 |
| 54 | Ga0070681_10190499 | 3300005458 | Bacteria | 1970 |
| 55 | Ga0068867_100005560 | 3300005459 | Bacteria | 8930 |
| 56 | Ga0068867_100208624 | 3300005459 | Bacteria | 1568 |
| 57 | Ga0070685_10008795 | 3300005466 | Bacteria | 5201 |
| 58 | Ga0070706_100001776 | 3300005467 | Bacteria | 22331 |
| 59 | Ga0070706_100228017 | 3300005467 | Bacteria | 1739 |
| 60 | Ga0070707_100017720 | 3300005468 | Bacteria | 6697 |
| 61 | Ga0070707_100037452 | 3300005468 | Bacteria | 4628 |
| 62 | Ga0070707_100053501 | 3300005468 | Bacteria | 3871 |
| 63 | Ga0070698_100010183 | 3300005471 | Bacteria | 10044 |
| 64 | Ga0070698_100027792 | 3300005471 | Bacteria | 5878 |
| 65 | Ga0070698_100333161 | 3300005471 | Bacteria | 1449 |
| 66 | Ga0070679_100369904 | 3300005530 | Bacteria | 1380 |
| 67 | Ga0070697_100113743 | 3300005536 | Bacteria | 2258 |
| 68 | Ga0068853_100029032 | 3300005539 | Bacteria | 4657 |
| 69 | Ga0070672_100012458 | 3300005543 | Bacteria | 5970 |
| 70 | Ga0070672_100012953 | 3300005543 | Bacteria | 5877 |
| 71 | Ga0070686_100066304 | 3300005544 | Bacteria | 2348 |
| 72 | Ga0070686_100071543 | 3300005544 | Bacteria | 2271 |
| 73 | Ga0070695_100004382 | 3300005545 | Bacteria | 8282 |
| 74 | Ga0070695_100076111 | 3300005545 | Bacteria | 2210 |
| 75 | Ga0070696_100013642 | 3300005546 | Bacteria | 5454 |
| 76 | Ga0070696_100018482 | 3300005546 | Bacteria | 4711 |
| 77 | Ga0070696_100104160 | 3300005546 | Bacteria | 2037 |
| 78 | Ga0070693_100005918 | 3300005547 | Bacteria | 5912 |
| 79 | Ga0070693_100076006 | 3300005547 | Bacteria | 1990 |
| 80 | Ga0070665_100034827 | 3300005548 | Bacteria | 5065 |
| 81 | Ga0070665_100080265 | 3300005548 | Bacteria | 3268 |
| 82 | Ga0070665_100081204 | 3300005548 | Bacteria | 3248 |
| 83 | Ga0070665_100130843 | 3300005548 | Bacteria | 2512 |
| 84 | Ga0070704_100007162 | 3300005549 | Bacteria | 6625 |
| 85 | Ga0070704_100082303 | 3300005549 | Bacteria | 2373 |
| 86 | Ga0068855_100007830 | 3300005563 | Bacteria | 12910 |
| 87 | Ga0068855_100029191 | 3300005563 | Bacteria | 6596 |
| 88 | Ga0068855_100117049 | 3300005563 | Bacteria | 3054 |
| 89 | Ga0068855_100345438 | 3300005563 | Bacteria | 1640 |
| 90 | Ga0068854_100004882 | 3300005578 | Bacteria | 8460 |
| 91 | Ga0068854_100015163 | 3300005578 | Bacteria | 5099 |
| 92 | Ga0068854_100079740 | 3300005578 | Bacteria | 2414 |
| 93 | Ga0068854_100086548 | 3300005578 | Bacteria | 2323 |
| 94 | Ga0068856_100117288 | 3300005614 | Bacteria | 2662 |
| 95 | Ga0068856_100123078 | 3300005614 | Bacteria | 2596 |
| 96 | Ga0068856_100239558 | 3300005614 | Bacteria | 1829 |
| 97 | Ga0070702_100002136 | 3300005615 | Bacteria | 8395 |
| 98 | Ga0068852_100033810 | 3300005616 | Bacteria | 4250 |
| 99 | Ga0068852_100609587 | 3300005616 | Bacteria | 1097 |
| 100 | Ga0068859_100100625 | 3300005617 | Bacteria | 2946 |
| 101 | Ga0068859_100274320 | 3300005617 | Bacteria | 1779 |
| 102 | Ga0068864_100095757 | 3300005618 | Bacteria | 2626 |
| 103 | Ga0068866_10002868 | 3300005718 | Bacteria | 7102 |
| 104 | Ga0068866_10036800 | 3300005718 | Bacteria | 2399 |
| 105 | Ga0068866_10094261 | 3300005718 | Bacteria | 1637 |
| 106 | Ga0068861_100007622 | 3300005719 | Bacteria | 7427 |
| 107 | Ga0068858_100000114 | 3300005842 | Bacteria | 84795 |
| 108 | Ga0068858_100021306 | 3300005842 | Bacteria | 6054 |
| 109 | Ga0068858_100283168 | 3300005842 | Bacteria | 1579 |
| 110 | Ga0068860_100012104 | 3300005843 | Bacteria | 8498 |
| 111 | Ga0068862_100076633 | 3300005844 | Bacteria | 2894 |
| 112 | Ga0070717_10015514 | 3300006028 | Bacteria | 5888 |
| 113 | Ga0075365_10028655 | 3300006038 | Bacteria | 3552 |
| 114 | Ga0075363_100013546 | 3300006048 | Bacteria | 3957 |
| 115 | Ga0075363_100036438 | 3300006048 | Bacteria | 2580 |
| 116 | Ga0075363_100070975 | 3300006048 | Bacteria | 1892 |
| 117 | Ga0075364_10000224 | 3300006051 | Bacteria | 26796 |
| 118 | Ga0075364_10065098 | 3300006051 | Bacteria | 2393 |
| 119 | Ga0075364_10174801 | 3300006051 | Bacteria | 1452 |
| 120 | Ga0070715_10002080 | 3300006163 | Bacteria | 6046 |
| 121 | Ga0070712_100003305 | 3300006175 | Bacteria | 9919 |
| 122 | Ga0070712_100003517 | 3300006175 | Bacteria | 9637 |
| 123 | Ga0070712_100073957 | 3300006175 | Bacteria | 2446 |
| 124 | Ga0070712_100208606 | 3300006175 | Bacteria | 1539 |
| 125 | Ga0075369_10011815 | 3300006186 | Bacteria | 3439 |
| 126 | Ga0097621_100023301 | 3300006237 | Bacteria | 4819 |
| 127 | Ga0075428_100044048 | 3300006844 | Bacteria | 4905 |
| 128 | Ga0075431_100130276 | 3300006847 | Bacteria | 2595 |
| 129 | Ga0075434_100000118 | 3300006871 | Bacteria | 45934 |
| 130 | Ga0068865_100023640 | 3300006881 | Bacteria | 4026 |
| 131 | Ga0068865_100068415 | 3300006881 | Bacteria | 2511 |
| 132 | Ga0075436_100008163 | 3300006914 | Bacteria | 7167 |
| 133 | Ga0075436_100053369 | 3300006914 | Bacteria | 2791 |
| 134 | Ga0097620_100100626 | 3300006931 | Bacteria | 2946 |
| 135 | Ga0097620_100274284 | 3300006931 | Bacteria | 1779 |
| 136 | Ga0099826_10171946 | 3300006948 | Bacteria | 1215 |
| 137 | Ga0105240_10009788 | 3300009093 | Bacteria | 13534 |
| 138 | Ga0105245_10003899 | 3300009098 | Bacteria | 13259 |
| 139 | Ga0105245_10016597 | 3300009098 | Bacteria | 6426 |
| 140 | Ga0105245_10017795 | 3300009098 | Bacteria | 6203 |
| 141 | Ga0105245_10042499 | 3300009098 | Bacteria | 4056 |
| 142 | Ga0105247_10006675 | 3300009101 | Bacteria | 7124 |
| 143 | Ga0105247_10028242 | 3300009101 | Bacteria | 3394 |
| 144 | Ga0105247_10032544 | 3300009101 | Bacteria | 3168 |
| 145 | Ga0105247_10074856 | 3300009101 | Bacteria | 2124 |
| 146 | Ga0105247_10102455 | 3300009101 | Bacteria | 1832 |
| 147 | Ga0114129_10008246 | 3300009147 | Bacteria | 14857 |
| 148 | Ga0114129_10368379 | 3300009147 | Bacteria | 1900 |
| 149 | Ga0105243_10018545 | 3300009148 | Bacteria | 5273 |
| 150 | Ga0105243_10025624 | 3300009148 | Bacteria | 4508 |
| 151 | Ga0105243_10153447 | 3300009148 | Bacteria | 1978 |
| 152 | Ga0105243_10173478 | 3300009148 | Bacteria | 1870 |
| 153 | Ga0105243_10254595 | 3300009148 | Bacteria | 1569 |
| 154 | Ga0105241_10009956 | 3300009174 | Bacteria | 6983 |
| 155 | Ga0105241_10143278 | 3300009174 | Bacteria | 1948 |
| 156 | Ga0105242_10006090 | 3300009176 | Bacteria | 9297 |
| 157 | Ga0105248_10000876 | 3300009177 | Bacteria | 33746 |
| 158 | Ga0105248_10014504 | 3300009177 | Bacteria | 8675 |
| 159 | Ga0105248_10074045 | 3300009177 | Bacteria | 3828 |
| 160 | Ga0105248_10265373 | 3300009177 | Bacteria | 1933 |
| 161 | Ga0105237_10009391 | 3300009545 | Bacteria | 10474 |
| 162 | Ga0105237_10042786 | 3300009545 | Bacteria | 4565 |
| 163 | Ga0105237_10057338 | 3300009545 | Bacteria | 3898 |
| 164 | Ga0105238_10008923 | 3300009551 | Bacteria | 10035 |
| 165 | Ga0105238_10039603 | 3300009551 | Bacteria | 4779 |
| 166 | Ga0105238_10308270 | 3300009551 | Bacteria | 1568 |
| 167 | Ga0105249_10008447 | 3300009553 | Bacteria | 8972 |
| 168 | Ga0105249_10039528 | 3300009553 | Bacteria | 4284 |
| 169 | Ga0105239_10147169 | 3300010375 | Bacteria | 2628 |
| 170 | Ga0105239_10171194 | 3300010375 | Bacteria | 2428 |
| 171 | Ga0105239_10242708 | 3300010375 | Bacteria | 2022 |
| 172 | Ga0105246_10003717 | 3300011119 | Bacteria | 9239 |
| 173 | Ga0105246_10024534 | 3300011119 | Bacteria | 3919 |
| 174 | Ga0105246_10051051 | 3300011119 | Bacteria | 2838 |
| 175 | Ga0105246_10114205 | 3300011119 | Bacteria | 1989 |
| 176 | Ga0157369_10090746 | 3300013105 | Bacteria | 3262 |
| 177 | Ga0157369_10131276 | 3300013105 | Bacteria | 2654 |
| 178 | Ga0157369_10150894 | 3300013105 | Bacteria | 2456 |
| 179 | Ga0157374_10020548 | 3300013296 | Bacteria | 5861 |
| 180 | Ga0157374_10080116 | 3300013296 | Bacteria | 3096 |
| 181 | Ga0157374_10251049 | 3300013296 | Bacteria | 1741 |
| 182 | Ga0157378_10013394 | 3300013297 | Bacteria | 7168 |
| 183 | Ga0157378_10036552 | 3300013297 | Bacteria | 4346 |
| 184 | Ga0163162_10009043 | 3300013306 | Bacteria | 9683 |
| 185 | Ga0157372_10007765 | 3300013307 | Bacteria | 11390 |
| 186 | Ga0157372_10017699 | 3300013307 | Bacteria | 7649 |
| 187 | Ga0157372_10476897 | 3300013307 | Bacteria | 1454 |
| 188 | Ga0157375_10006557 | 3300013308 | Bacteria | 10131 |
| 189 | Ga0157375_10047810 | 3300013308 | Bacteria | 4180 |
| 190 | Ga0157375_10051046 | 3300013308 | Bacteria | 4060 |
| 191 | Ga0157375_10119587 | 3300013308 | Bacteria | 2742 |
| 192 | Ga0157375_10555053 | 3300013308 | Bacteria | 1310 |
| 193 | Ga0163163_10003761 | 3300014325 | Bacteria | 12924 |
| 194 | Ga0163163_10003936 | 3300014325 | Bacteria | 12671 |
| 195 | Ga0163163_10095408 | 3300014325 | Bacteria | 2994 |
| 196 | Ga0157380_10011225 | 3300014326 | Bacteria | 6468 |
| 197 | Ga0157380_10265484 | 3300014326 | Bacteria | 1561 |
| 198 | Ga0157377_10027866 | 3300014745 | Bacteria | 3036 |
| 199 | Ga0157377_10028708 | 3300014745 | Bacteria | 2997 |
| 200 | Ga0157379_10004758 | 3300014968 | Bacteria | 11660 |
| 201 | Ga0157379_10106882 | 3300014968 | Bacteria | 2512 |
| 202 | Ga0157376_10038115 | 3300014969 | Bacteria | 3908 |
| 203 | Ga0163161_10003863 | 3300017792 | Bacteria | 10505 |
| 204 | Ga0209051_1000425 | 3300025303 | Bacteria | 57815 |
| 205 | Ga0209051_1009005 | 3300025303 | Bacteria | 5198 |
| 206 | Ga0207692_10011204 | 3300025898 | Bacteria | 3805 |
| 207 | Ga0207692_10089953 | 3300025898 | Bacteria | 1663 |
| 208 | Ga0207642_10000963 | 3300025899 | Bacteria | 8998 |
| 209 | Ga0207710_10001082 | 3300025900 | Bacteria | 14018 |
| 210 | Ga0207710_10023802 | 3300025900 | Bacteria | 2633 |
| 211 | Ga0207688_10000065 | 3300025901 | Bacteria | 38587 |
| 212 | Ga0207688_10003328 | 3300025901 | Bacteria | 8788 |
| 213 | Ga0207688_10021854 | 3300025901 | Bacteria | 3499 |
| 214 | Ga0207680_10062341 | 3300025903 | Bacteria | 2277 |
| 215 | Ga0207647_10003115 | 3300025904 | Bacteria | 12457 |
| 216 | Ga0207647_10105443 | 3300025904 | Bacteria | 1670 |
| 217 | Ga0207647_10157861 | 3300025904 | Bacteria | 1324 |
| 218 | Ga0207685_10006603 | 3300025905 | Bacteria | 3172 |
| 219 | Ga0207643_10080596 | 3300025908 | Bacteria | 1886 |
| 220 | Ga0207705_10216088 | 3300025909 | Bacteria | 1455 |
| 221 | Ga0207684_10000007 | 3300025910 | Bacteria | 612969 |
| 222 | Ga0207684_10000015 | 3300025910 | Bacteria | 427232 |
| 223 | Ga0207684_10191526 | 3300025910 | Bacteria | 1764 |
| 224 | Ga0207654_10104246 | 3300025911 | Bacteria | 1753 |
| 225 | Ga0207695_10046416 | 3300025913 | Bacteria | 4605 |
| 226 | Ga0207695_10163719 | 3300025913 | Bacteria | 2154 |
| 227 | Ga0207671_10011607 | 3300025914 | Bacteria | 7152 |
| 228 | Ga0207693_10001867 | 3300025915 | Bacteria | 18448 |
| 229 | Ga0207693_10002565 | 3300025915 | Bacteria | 15793 |
| 230 | Ga0207693_10006857 | 3300025915 | Bacteria | 9405 |
| 231 | Ga0207693_10086316 | 3300025915 | Bacteria | 2459 |
| 232 | Ga0207693_10098145 | 3300025915 | Bacteria | 2297 |
| 233 | Ga0207663_10033822 | 3300025916 | Bacteria | 3050 |
| 234 | Ga0207663_10039232 | 3300025916 | Bacteria | 2868 |
| 235 | Ga0207657_10000854 | 3300025919 | Bacteria | 32159 |
| 236 | Ga0207646_10004478 | 3300025922 | Bacteria | 15146 |
| 237 | Ga0207681_10005765 | 3300025923 | Bacteria | 7597 |
| 238 | Ga0207694_10011460 | 3300025924 | Bacteria | 6691 |
| 239 | Ga0207694_10100795 | 3300025924 | Bacteria | 2288 |
| 240 | Ga0207694_10217500 | 3300025924 | Bacteria | 1558 |
| 241 | Ga0207687_10003786 | 3300025927 | Bacteria | 10165 |
| 242 | Ga0207687_10006239 | 3300025927 | Bacteria | 7889 |
| 243 | Ga0207687_10027689 | 3300025927 | Bacteria | 3804 |
| 244 | Ga0207687_10028608 | 3300025927 | Bacteria | 3745 |
| 245 | Ga0207644_10063384 | 3300025931 | Bacteria | 2684 |
| 246 | Ga0207690_10005530 | 3300025932 | Bacteria | 7457 |
| 247 | Ga0207690_10005863 | 3300025932 | Bacteria | 7271 |
| 248 | Ga0207690_10161721 | 3300025932 | Bacteria | 1670 |
| 249 | Ga0207706_10015156 | 3300025933 | Bacteria | 6977 |
| 250 | Ga0207706_10033740 | 3300025933 | Bacteria | 4554 |
| 251 | Ga0207686_10003068 | 3300025934 | Bacteria | 8987 |
| 252 | Ga0207709_10003258 | 3300025935 | Bacteria | 9733 |
| 253 | Ga0207709_10175475 | 3300025935 | Bacteria | 1508 |
| 254 | Ga0207669_10000196 | 3300025937 | Bacteria | 27615 |
| 255 | Ga0207669_10084238 | 3300025937 | Bacteria | 2048 |
| 256 | Ga0207669_10094556 | 3300025937 | Bacteria | 1956 |
| 257 | Ga0207704_10001017 | 3300025938 | Bacteria | 12443 |
| 258 | Ga0207665_10005485 | 3300025939 | Bacteria | 8467 |
| 259 | Ga0207691_10093682 | 3300025940 | Bacteria | 2689 |
| 260 | Ga0207691_10166549 | 3300025940 | Bacteria | 1931 |
| 261 | Ga0207711_10003792 | 3300025941 | Bacteria | 13002 |
| 262 | Ga0207711_10029154 | 3300025941 | Bacteria | 4651 |
| 263 | Ga0207711_10146716 | 3300025941 | Bacteria | 2126 |
| 264 | Ga0207711_10311377 | 3300025941 | Bacteria | 1454 |
| 265 | Ga0207689_10017082 | 3300025942 | Bacteria | 6140 |
| 266 | Ga0207689_10062836 | 3300025942 | Bacteria | 3054 |
| 267 | Ga0207661_10038467 | 3300025944 | Bacteria | 3750 |
| 268 | Ga0207661_10168587 | 3300025944 | Bacteria | 1905 |
| 269 | Ga0207667_10002967 | 3300025949 | Bacteria | 21074 |
| 270 | Ga0207667_10007536 | 3300025949 | Bacteria | 13060 |
| 271 | Ga0207667_10043851 | 3300025949 | Bacteria | 4745 |
| 272 | Ga0207667_10061208 | 3300025949 | Bacteria | 3939 |
| 273 | Ga0207667_10312311 | 3300025949 | Bacteria | 1606 |
| 274 | Ga0207651_10117218 | 3300025960 | Bacteria | 2012 |
| 275 | Ga0207712_10012441 | 3300025961 | Bacteria | 5437 |
| 276 | Ga0207712_10039536 | 3300025961 | Bacteria | 3232 |
| 277 | Ga0207668_10000677 | 3300025972 | Bacteria | 20935 |
| 278 | Ga0207668_10015960 | 3300025972 | Bacteria | 4677 |
| 279 | Ga0207640_10007461 | 3300025981 | Bacteria | 6040 |
| 280 | Ga0207640_10007659 | 3300025981 | Bacteria | 5967 |
| 281 | Ga0207640_10019537 | 3300025981 | Bacteria | 4005 |
| 282 | Ga0207658_10035339 | 3300025986 | Bacteria | 3578 |
| 283 | Ga0207658_10228593 | 3300025986 | Bacteria | 1569 |
| 284 | Ga0207677_10009436 | 3300026023 | Bacteria | 5494 |
| 285 | Ga0207677_10023380 | 3300026023 | Bacteria | 3817 |
| 286 | Ga0207703_10006652 | 3300026035 | Bacteria | 9221 |
| 287 | Ga0207703_10011047 | 3300026035 | Bacteria | 7037 |
| 288 | Ga0207703_10061533 | 3300026035 | Bacteria | 3073 |
| 289 | Ga0207703_10084538 | 3300026035 | Bacteria | 2654 |
| 290 | Ga0207703_10292856 | 3300026035 | Bacteria | 1482 |
| 291 | Ga0207639_10022736 | 3300026041 | Bacteria | 4519 |
| 292 | Ga0207639_10040755 | 3300026041 | Bacteria | 3468 |
| 293 | Ga0207678_10036101 | 3300026067 | Bacteria | 4302 |
| 294 | Ga0207678_10117905 | 3300026067 | Bacteria | 2265 |
| 295 | Ga0207708_10000667 | 3300026075 | Bacteria | 26347 |
| 296 | Ga0207708_10071960 | 3300026075 | Bacteria | 2649 |
| 297 | Ga0207702_10584071 | 3300026078 | Bacteria | 1095 |
| 298 | Ga0207641_10307170 | 3300026088 | Bacteria | 1500 |
| 299 | Ga0207641_10484049 | 3300026088 | Bacteria | 1200 |
| 300 | Ga0207648_10008461 | 3300026089 | Bacteria | 9960 |
| 301 | Ga0207648_10189151 | 3300026089 | Bacteria | 1824 |
| 302 | Ga0207676_10249817 | 3300026095 | Bacteria | 1596 |
| 303 | Ga0207674_10043557 | 3300026116 | Bacteria | 4627 |
| 304 | Ga0207675_100009171 | 3300026118 | Bacteria | 9282 |
| 305 | Ga0207675_100019497 | 3300026118 | Bacteria | 6329 |
| 306 | Ga0207683_10002485 | 3300026121 | Bacteria | 16082 |
| 307 | Ga0207683_10030265 | 3300026121 | Bacteria | 4690 |
| 308 | Ga0207683_10034500 | 3300026121 | Bacteria | 4397 |
| 309 | Ga0207698_10000489 | 3300026142 | Bacteria | 23073 |
| 310 | Ga0207698_10039914 | 3300026142 | Bacteria | 3482 |
| 311 | Ga0207698_10262804 | 3300026142 | Bacteria | 1586 |
| 312 | Ga0268266_10067096 | 3300028379 | Bacteria | 3104 |
| 313 | Ga0268266_10098014 | 3300028379 | Bacteria | 2579 |
| 314 | Ga0268266_10099741 | 3300028379 | Bacteria | 2557 |
| 315 | Ga0268266_10106202 | 3300028379 | Bacteria | 2482 |
| 316 | Ga0268266_10195860 | 3300028379 | Bacteria | 1847 |
| 317 | Ga0268264_10006935 | 3300028381 | Bacteria | 9504 |
| 318 | Ga0265336_10002530 | 3300028666 | Bacteria | 7480 |
| 319 | Ga0307515_10003890 | 3300028794 | Bacteria | 31178 |
| 320 | Ga0265338_10176333 | 3300028800 | Bacteria | 1633 |
| 321 | Ga0307511_10041814 | 3300030521 | Bacteria | 3862 |
| 322 | Ga0265327_10013223 | 3300031251 | Bacteria | 5495 |
| 323 | Ga0307408_100019291 | 3300031548 | Bacteria | 4590 |
| 324 | Ga0307408_100097860 | 3300031548 | Bacteria | 2229 |
| 325 | Ga0307408_100112681 | 3300031548 | Bacteria | 2092 |
| 326 | Ga0307508_10005959 | 3300031616 | Bacteria | 11498 |
| 327 | Ga0307514_10024568 | 3300031649 | Bacteria | 4876 |
| 328 | Ga0307516_10003823 | 3300031730 | Bacteria | 19076 |
| 329 | Ga0307405_10041084 | 3300031731 | Bacteria | 2805 |
| 330 | Ga0307413_10301067 | 3300031824 | Bacteria | 1216 |
| 331 | Ga0307518_10061748 | 3300031838 | Bacteria | 2721 |
| 332 | Ga0307518_10138388 | 3300031838 | Bacteria | 1701 |
| 333 | Ga0307406_10008248 | 3300031901 | Bacteria | 5807 |
| 334 | Ga0307412_10128826 | 3300031911 | Bacteria | 1835 |
| 335 | Ga0307409_100070035 | 3300031995 | Bacteria | 2782 |
| 336 | Ga0307409_100389624 | 3300031995 | Bacteria | 1327 |
| 337 | Ga0307416_100219846 | 3300032002 | Bacteria | 1820 |
| 338 | Ga0307414_10352425 | 3300032004 | Bacteria | 1264 |
| 339 | Ga0307415_100124572 | 3300032126 | Bacteria | 1939 |
| 340 | Ga0307415_100431797 | 3300032126 | Bacteria | 1133 |
| 341 | Ga0307507_10088896 | 3300033179 | Bacteria | 2662 |
| 342 | Ga0307507_10097456 | 3300033179 | Bacteria | 2481 |
| 343 | Ga0307510_10001109 | 3300033180 | Bacteria | 28779 |
| 344 | Ga0373926_0010701 | 3300035083 | Bacteria | 3078 |
| 345 | Ga0373934_0062535 | 3300035086 | Bacteria | 1484 |
| 346 | Ga0373923_0045697 | 3300035111 | Bacteria | 1819 |
| 347 | Ga0373936_0033783 | 3300035113 | Bacteria | 2029 |
| 348 | Ga0373946_0035475 | 3300035171 | Bacteria | 2018 |
| 349 | Ga0373955_0048699 | 3300035172 | Bacteria | 2299 |
| 350 | Ga0373931_0021878 | 3300035691 | Bacteria | 3212 |
| 351 | Ga0373935_0057572 | 3300035692 | Bacteria | 2479 |
| 352 | Ga0373947_0042841 | 3300035725 | Bacteria | 2702 |
| 353 | Ga0373947_0091659 | 3300035725 | Bacteria | 1896 |
| 354 | Ga0373947_0281312 | 3300035725 | Bacteria | 1106 |
| 355 | Ga0373937_0080132 | 3300036401 | Bacteria | 3019 |
| 356 | Ga0373937_0324618 | 3300036401 | Bacteria | 1456 |
| 357 | Ga0373925_0329104 | 3300037068 | Bacteria | 1237 |
| 358 | Ga0395900_0234303 | 3300037418 | Bacteria | 1845 |
| 359 | Ga0395898_0241224 | 3300037466 | Bacteria | 1724 |
| 360 | Ga0436364_0537053 | 3300037853 | Bacteria | 7725 |
| 361 | Ga0395901_0002712 | 3300038443 | Bacteria | 17830 |
| 362 | Ga0436365_1207048 | 3300039437 | Bacteria | 5587 |
| 363 | Ga0439448_0037382 | 3300042005 | Bacteria | 1559 |
| 364 | Ga0439448_0054352 | 3300042005 | Bacteria | 1316 |
| 365 | Ga0439449_0005151 | 3300042007 | Bacteria | 5021 |
| 366 | Ga0439455_0000583 | 3300042012 | Bacteria | 5248 |
| 367 | Ga0450903_000032 | 3300042138 | Bacteria | 27593 |
| 368 | Ga0439458_0000080 | 3300042157 | Bacteria | 18120 |
| 369 | Ga0450901_007387 | 3300042533 | Bacteria | 1131 |
| 370 | Ga0453684_0453003 | 3300044712 | Bacteria | 1428 |
| 371 | Ga0466967_0006022 | 3300045976 | Bacteria | 8521 |
| 372 | Ga0466967_0017065 | 3300045976 | Bacteria | 5748 |
| 373 | Ga0466967_0768194 | 3300045976 | Bacteria | 956 |
| 374 | Ga0495592_0000011 | 3300046454 | Bacteria | 156647 |
| 375 | Ga0495592_0002498 | 3300046454 | Bacteria | 13001 |
| 376 | Ga0495603_0004683 | 3300046455 | Bacteria | 8170 |
| 377 | Ga0495629_0000252 | 3300046459 | Bacteria | 46609 |
| 378 | Ga0495629_0002865 | 3300046459 | Bacteria | 13178 |
| 379 | Ga0495629_0031636 | 3300046459 | Bacteria | 3745 |
| 380 | Ga0495638_0015739 | 3300046460 | Bacteria | 5069 |
| 381 | Ga0495638_0089936 | 3300046460 | Bacteria | 1851 |
| 382 | Ga0495638_0141034 | 3300046460 | Bacteria | 1407 |
| 383 | Ga0495651_0004365 | 3300046462 | Bacteria | 10821 |
| 384 | Ga0495651_0007039 | 3300046462 | Bacteria | 8601 |
| 385 | Ga0495651_0026723 | 3300046462 | Bacteria | 4495 |
| 386 | Ga0495653_0000345 | 3300046463 | Bacteria | 37856 |
| 387 | Ga0495653_0001114 | 3300046463 | Bacteria | 20668 |
| 388 | Ga0495580_0042034 | 3300046472 | Bacteria | 3258 |
| 389 | Ga0495582_0009584 | 3300046473 | Bacteria | 5332 |
| 390 | Ga0495582_0094176 | 3300046473 | Bacteria | 1672 |
| 391 | Ga0495639_0021265 | 3300046475 | Bacteria | 2839 |
| 392 | Ga0495662_0000141 | 3300046476 | Bacteria | 27833 |
| 393 | Ga0495662_0005261 | 3300046476 | Bacteria | 6485 |
| 394 | Ga0495662_0133180 | 3300046476 | Bacteria | 1222 |
| 395 | Ga0495662_0173473 | 3300046476 | Bacteria | 1062 |
| 396 | Ga0495664_0000222 | 3300046477 | Bacteria | 27094 |
| 397 | Ga0495664_0000520 | 3300046477 | Bacteria | 19243 |
| 398 | Ga0495664_0002146 | 3300046477 | Bacteria | 10552 |
| 399 | Ga0495664_0148631 | 3300046477 | Bacteria | 1421 |
| 400 | Ga0495585_0007625 | 3300046492 | Bacteria | 6613 |
| 401 | Ga0495594_0000146 | 3300046499 | Bacteria | 33823 |
| 402 | Ga0495594_0211478 | 3300046499 | Bacteria | 1106 |
| 403 | Ga0495608_0009576 | 3300046511 | Bacteria | 6765 |
| 404 | Ga0495608_0024041 | 3300046511 | Bacteria | 4169 |
| 405 | Ga0495618_0012341 | 3300046514 | Bacteria | 5187 |
| 406 | Ga0495620_0073565 | 3300046515 | Bacteria | 1393 |
| 407 | Ga0495628_0000064 | 3300046516 | Bacteria | 85991 |
| 408 | Ga0495628_0005049 | 3300046516 | Bacteria | 11601 |
| 409 | Ga0495628_0017396 | 3300046516 | Bacteria | 5987 |
| 410 | Ga0495628_0121703 | 3300046516 | Bacteria | 2001 |
| 411 | Ga0495630_0000035 | 3300046517 | Bacteria | 118545 |
| 412 | Ga0495630_0018638 | 3300046517 | Bacteria | 5099 |
| 413 | Ga0495630_0039976 | 3300046517 | Bacteria | 3505 |
| 414 | Ga0495630_0082056 | 3300046517 | Bacteria | 2433 |
| 415 | Ga0495630_0214507 | 3300046517 | Bacteria | 1469 |
| 416 | Ga0495666_0000539 | 3300046526 | Bacteria | 16851 |
| 417 | Ga0495666_0011056 | 3300046526 | Bacteria | 4503 |
| 418 | Ga0495666_0099933 | 3300046526 | Bacteria | 1367 |
| 419 | Ga0495652_0000169 | 3300046529 | Bacteria | 74610 |
| 420 | Ga0495652_0002735 | 3300046529 | Bacteria | 17852 |
| 421 | Ga0495652_0082434 | 3300046529 | Bacteria | 2650 |
| 422 | Ga0495652_0140402 | 3300046529 | Bacteria | 1900 |
| 423 | Ga0495652_0141304 | 3300046529 | Bacteria | 1893 |
| 424 | Ga0495665_0038608 | 3300046531 | Bacteria | 2545 |
| 425 | Ga0495640_0002459 | 3300046533 | Bacteria | 14887 |
| 426 | Ga0495640_0010908 | 3300046533 | Bacteria | 7003 |
| 427 | Ga0495640_0031012 | 3300046533 | Bacteria | 3821 |
| 428 | Ga0495640_0193068 | 3300046533 | Bacteria | 1293 |
| 429 | Ga0495586_0002691 | 3300046535 | Bacteria | 9609 |
| 430 | Ga0495586_0032133 | 3300046535 | Bacteria | 2814 |
| 431 | Ga0495587_0000064 | 3300046536 | Bacteria | 90007 |
| 432 | Ga0495587_0003751 | 3300046536 | Bacteria | 10077 |
| 433 | Ga0495587_0041299 | 3300046536 | Bacteria | 2752 |
| 434 | Ga0495645_0000042 | 3300046543 | Bacteria | 91093 |
| 435 | Ga0495645_0002575 | 3300046543 | Bacteria | 12332 |
| 436 | Ga0495645_0026231 | 3300046543 | Bacteria | 4229 |
| 437 | Ga0495622_0004175 | 3300046557 | Bacteria | 6740 |
| 438 | Ga0495622_0076759 | 3300046557 | Bacteria | 1539 |
| 439 | Ga0495667_0002691 | 3300046559 | Bacteria | 11886 |
| 440 | Ga0495667_0005356 | 3300046559 | Bacteria | 8669 |
| 441 | Ga0495667_0246380 | 3300046559 | Bacteria | 1137 |
| 442 | Ga0495634_0000126 | 3300046642 | Bacteria | 65545 |
| 443 | Ga0495634_0000148 | 3300046642 | Bacteria | 62329 |
| 444 | Ga0495634_0004619 | 3300046642 | Bacteria | 10743 |
| 445 | Ga0495634_0022306 | 3300046642 | Bacteria | 4461 |
| 446 | Ga0495634_0051243 | 3300046642 | Bacteria | 2770 |
| 447 | Ga0495634_0072474 | 3300046642 | Bacteria | 2265 |
| 448 | Ga0495611_0010749 | 3300046648 | Bacteria | 3877 |
| 449 | Ga0495625_0318806 | 3300046660 | Bacteria | 990 |
| 450 | Ga0495635_0000032 | 3300046663 | Bacteria | 109069 |
| 451 | Ga0495635_0002172 | 3300046663 | Bacteria | 13332 |
| 452 | Ga0495635_0002919 | 3300046663 | Bacteria | 11736 |
| 453 | Ga0495635_0021294 | 3300046663 | Bacteria | 4518 |
| 454 | Ga0495635_0037826 | 3300046663 | Bacteria | 3341 |
| 455 | Ga0495588_0014028 | 3300046674 | Bacteria | 3829 |
| 456 | Ga0495657_0005794 | 3300046675 | Bacteria | 9733 |
| 457 | Ga0495657_0007861 | 3300046675 | Bacteria | 8184 |
| 458 | Ga0495657_0009247 | 3300046675 | Bacteria | 7478 |
| 459 | Ga0495657_0009699 | 3300046675 | Bacteria | 7279 |
| 460 | Ga0495657_0043888 | 3300046675 | Bacteria | 3045 |
| 461 | Ga0495599_0000044 | 3300046678 | Bacteria | 89350 |
| 462 | Ga0495599_0036827 | 3300046678 | Bacteria | 3073 |
| 463 | Ga0495599_0189852 | 3300046678 | Bacteria | 1264 |
| 464 | Ga0495623_0001203 | 3300046679 | Bacteria | 17541 |
| 465 | Ga0495646_0000028 | 3300046680 | Bacteria | 92735 |
| 466 | Ga0495646_0000262 | 3300046680 | Bacteria | 26668 |
| 467 | Ga0495646_0004903 | 3300046680 | Bacteria | 8453 |
| 468 | Ga0495646_0017062 | 3300046680 | Bacteria | 4609 |
| 469 | Ga0495647_0004926 | 3300046681 | Bacteria | 4371 |
| 470 | Ga0495658_0019820 | 3300046683 | Bacteria | 3516 |
| 471 | Ga0495658_0021840 | 3300046683 | Bacteria | 3379 |
| 472 | Ga0495658_0039380 | 3300046683 | Bacteria | 2622 |
| 473 | Ga0495613_0001824 | 3300046689 | Bacteria | 16189 |
| 474 | Ga0495613_0003748 | 3300046689 | Bacteria | 11396 |
| 475 | Ga0495613_0084797 | 3300046689 | Bacteria | 2300 |
| 476 | Ga0495613_0114344 | 3300046689 | Bacteria | 1942 |
| 477 | Ga0495624_0051905 | 3300046690 | Bacteria | 2593 |
| 478 | Ga0495624_0167605 | 3300046690 | Bacteria | 1340 |
| 479 | Ga0495600_0000044 | 3300046809 | Bacteria | 71943 |
| 480 | Ga0495600_0001980 | 3300046809 | Bacteria | 11510 |
| 481 | Ga0495600_0008148 | 3300046809 | Bacteria | 6432 |
| 482 | Ga0495600_0012004 | 3300046809 | Bacteria | 5409 |
| 483 | Ga0495600_0028544 | 3300046809 | Bacteria | 3610 |
| 484 | Ga0495660_0055845 | 3300046810 | Bacteria | 2136 |
| 485 | Ga0495581_0001951 | 3300047315 | Bacteria | 11554 |
| 486 | Ga0495581_0008584 | 3300047315 | Bacteria | 5919 |
| 487 | Ga0495581_0176773 | 3300047315 | Bacteria | 1248 |
| 488 | Ga0495604_0000162 | 3300047317 | Bacteria | 59086 |
| 489 | Ga0495604_0000268 | 3300047317 | Bacteria | 46321 |
| 490 | Ga0495604_0002629 | 3300047317 | Bacteria | 14423 |
| 491 | Ga0495604_0005093 | 3300047317 | Bacteria | 10406 |
| 492 | Ga0495604_0072473 | 3300047317 | Bacteria | 2603 |
| 493 | Ga0495674_0000036 | 3300047319 | Bacteria | 103830 |
| 494 | Ga0495674_0008471 | 3300047319 | Bacteria | 9794 |
| 495 | Ga0495674_0038152 | 3300047319 | Bacteria | 4314 |
| 496 | Ga0495674_0040443 | 3300047319 | Bacteria | 4170 |
| 497 | Ga0495674_0062850 | 3300047319 | Bacteria | 3231 |
| 498 | Ga0495674_0084883 | 3300047319 | Bacteria | 2713 |
| 499 | Ga0495674_0186961 | 3300047319 | Bacteria | 1723 |
| 500 | Ga0495676_0002642 | 3300047321 | Bacteria | 16025 |
| 501 | Ga0495676_0008319 | 3300047321 | Bacteria | 9513 |
| 502 | Ga0495676_0009530 | 3300047321 | Bacteria | 8840 |
| 503 | Ga0495676_0046986 | 3300047321 | Bacteria | 3496 |
| 504 | Ga0495676_0065891 | 3300047321 | Bacteria | 2809 |
| 505 | Ga0495676_0164282 | 3300047321 | Bacteria | 1568 |
| 506 | Ga0495680_0003113 | 3300047322 | Bacteria | 16515 |
| 507 | Ga0495680_0091273 | 3300047322 | Bacteria | 2283 |
| 508 | Ga0495680_0178341 | 3300047322 | Bacteria | 1535 |
| 509 | Ga0495680_0260815 | 3300047322 | Bacteria | 1226 |
| 510 | Ga0495683_0001134 | 3300047323 | Bacteria | 18352 |
| 511 | Ga0495675_0000126 | 3300047444 | Bacteria | 54783 |
| 512 | Ga0495685_018793 | 3300047447 | Bacteria | 2373 |
| 513 | Ga0495684_0000474 | 3300047471 | Bacteria | 32805 |
| 514 | Ga0495684_0006608 | 3300047471 | Bacteria | 8993 |
| 515 | Ga0495684_0022687 | 3300047471 | Bacteria | 4828 |
| 516 | Ga0495684_0034099 | 3300047471 | Bacteria | 3906 |
| 517 | Ga0495684_0201971 | 3300047471 | Bacteria | 1465 |
| 518 | Ga0495593_0002507 | 3300047673 | Bacteria | 11040 |
| 519 | Ga0495593_0012644 | 3300047673 | Bacteria | 4821 |
| 520 | Ga0495593_0032413 | 3300047673 | Bacteria | 2849 |
| 521 | Ga0495593_0122837 | 3300047673 | Bacteria | 1321 |
| 522 | Ga0495602_0000078 | 3300048088 | Bacteria | 94384 |
| 523 | Ga0495602_0013750 | 3300048088 | Bacteria | 8253 |
| 524 | Ga0495602_0017865 | 3300048088 | Bacteria | 7099 |
| 525 | Ga0495614_0001782 | 3300048089 | Bacteria | 9409 |
| 526 | Ga0495614_0009344 | 3300048089 | Bacteria | 4337 |
| 527 | Ga0495614_0021115 | 3300048089 | Bacteria | 2814 |
| 528 | Ga0496100_0000320 | 3300048903 | Bacteria | 23674 |
| 529 | Ga0496100_0002169 | 3300048903 | Bacteria | 9889 |
| 530 | Ga0496100_0027292 | 3300048903 | Bacteria | 3510 |
| 531 | Ga0496100_0064239 | 3300048903 | Bacteria | 2428 |
| 532 | Ga0496100_0211548 | 3300048903 | Bacteria | 1418 |
| 533 | Ga0496101_0001345 | 3300048904 | Bacteria | 14727 |
| 534 | Ga0496101_0003035 | 3300048904 | Bacteria | 10356 |
| 535 | Ga0496101_0006148 | 3300048904 | Bacteria | 7707 |
| 536 | Ga0496101_0009943 | 3300048904 | Bacteria | 6268 |
| 537 | Ga0496102_0015279 | 3300048905 | Bacteria | 6684 |
| 538 | Ga0496102_0037193 | 3300048905 | Bacteria | 4389 |
| 539 | Ga0496102_0074045 | 3300048905 | Bacteria | 3130 |
| 540 | Ga0496103_0007441 | 3300048906 | Bacteria | 6527 |
| 541 | Ga0496103_0054006 | 3300048906 | Bacteria | 2490 |
| 542 | Ga0496104_0011864 | 3300048907 | Bacteria | 7822 |
| 543 | Ga0496104_0014877 | 3300048907 | Bacteria | 7033 |
| 544 | Ga0496104_0058457 | 3300048907 | Bacteria | 3650 |
| 545 | Ga0496104_0662692 | 3300048907 | Bacteria | 952 |
| 546 | Ga0496105_0010304 | 3300048908 | Bacteria | 7348 |
| 547 | Ga0496105_0056786 | 3300048908 | Bacteria | 3232 |
| 548 | Ga0496105_0091001 | 3300048908 | Bacteria | 2520 |
| 549 | Ga0496106_0001251 | 3300048909 | Bacteria | 19027 |
| 550 | Ga0496106_0003667 | 3300048909 | Bacteria | 11449 |
| 551 | Ga0496106_0004404 | 3300048909 | Bacteria | 10439 |
| 552 | Ga0496106_0010435 | 3300048909 | Bacteria | 6860 |
| 553 | Ga0496106_0114213 | 3300048909 | Bacteria | 2105 |
| 554 | Ga0496107_0001939 | 3300048910 | Bacteria | 13139 |
| 555 | Ga0496107_0009236 | 3300048910 | Bacteria | 6834 |
| 556 | Ga0496107_0031642 | 3300048910 | Bacteria | 3777 |
| 557 | Ga0496107_0034462 | 3300048910 | Bacteria | 3626 |
| 558 | Ga0496108_0001696 | 3300048911 | Bacteria | 17467 |
| 559 | Ga0496108_0001836 | 3300048911 | Bacteria | 16962 |
| 560 | Ga0496108_0038437 | 3300048911 | Bacteria | 3987 |
| 561 | Ga0496108_0159792 | 3300048911 | Bacteria | 1947 |
| 562 | Ga0496109_0003536 | 3300048912 | Bacteria | 13041 |
| 563 | Ga0496109_0008556 | 3300048912 | Bacteria | 8705 |
| 564 | Ga0496109_0025474 | 3300048912 | Bacteria | 5272 |
| 565 | Ga0496110_0040553 | 3300048913 | Bacteria | 4057 |
| 566 | Ga0496111_0025301 | 3300048914 | Bacteria | 4188 |
| 567 | Ga0496112_0000439 | 3300048915 | Bacteria | 27602 |
| 568 | Ga0496112_0026454 | 3300048915 | Bacteria | 5583 |
| 569 | Ga0496112_0037916 | 3300048915 | Bacteria | 4706 |
| 570 | Ga0496112_0059511 | 3300048915 | Bacteria | 3764 |
| 571 | Ga0496112_0119790 | 3300048915 | Bacteria | 2602 |
| 572 | Ga0496112_0312789 | 3300048915 | Bacteria | 1516 |
| 573 | Ga0496113_0010467 | 3300048916 | Bacteria | 6131 |
| 574 | Ga0496113_0061227 | 3300048916 | Bacteria | 2840 |
| 575 | Ga0496113_0223506 | 3300048916 | Bacteria | 1501 |
| 576 | Ga0496114_0000999 | 3300048917 | Bacteria | 21168 |
| 577 | Ga0496114_0005908 | 3300048917 | Bacteria | 9619 |
| 578 | Ga0496114_0029383 | 3300048917 | Bacteria | 4517 |
| 579 | Ga0496115_0000491 | 3300048918 | Bacteria | 31231 |
| 580 | Ga0496115_0010359 | 3300048918 | Bacteria | 6962 |
| 581 | Ga0496115_0011304 | 3300048918 | Bacteria | 6689 |
| 582 | Ga0496115_0024795 | 3300048918 | Bacteria | 4664 |
| 583 | Ga0496118_0001434 | 3300048921 | Bacteria | 35889 |
| 584 | Ga0496122_0003293 | 3300048925 | Bacteria | 21383 |
| 585 | Ga0496126_0000036 | 3300048929 | Bacteria | 354901 |
| 586 | Ga0496126_0004061 | 3300048929 | Bacteria | 17762 |
| 587 | Ga0496126_0086778 | 3300048929 | Bacteria | 2758 |
| 588 | Ga0501032_0006305 | 3300049569 | Bacteria | 8736 |
| 589 | Ga0501032_0007147 | 3300049569 | Bacteria | 8177 |
| 590 | Ga0501033_0067831 | 3300049570 | Bacteria | 2623 |
| 591 | Ga0501034_0000819 | 3300049571 | Bacteria | 46254 |
| 592 | Ga0501034_0036672 | 3300049571 | Bacteria | 4965 |
| 593 | Ga0501034_0352891 | 3300049571 | Bacteria | 1399 |
| 594 | Ga0501036_0007783 | 3300049572 | Bacteria | 8763 |
| 595 | Ga0501037_0000702 | 3300049573 | Bacteria | 25462 |
| 596 | Ga0501038_0070993 | 3300049574 | Bacteria | 2955 |
| 597 | Ga0501039_0013632 | 3300049575 | Bacteria | 6216 |
| 598 | Ga0501046_0001146 | 3300049580 | Bacteria | 25795 |
| 599 | Ga0501047_0001633 | 3300049581 | Bacteria | 21884 |
| 600 | Ga0501048_0017268 | 3300049582 | Bacteria | 5317 |
| 601 | Ga0501070_0000188 | 3300049586 | Bacteria | 58075 |
| 602 | Ga0501073_0257626 | 3300049589 | Bacteria | 1204 |
| 603 | Ga0501035_0000466 | 3300049822 | Bacteria | 45324 |
| 604 | Ga0501044_0000865 | 3300049823 | Bacteria | 36445 |
| 605 | Ga0501044_0003325 | 3300049823 | Bacteria | 18121 |
| 606 | nmdc:mga03n38_54876_c1 | 3300050490 | Bacteria | 1793 |
| 607 | nmdc:mga03n38_6827_c1 | 3300050490 | Bacteria | 3999 |
| 608 | nmdc:mga00v17_6150_c1 | 3300050491 | Bacteria | 6363 |
| 609 | nmdc:mga00v17_73393_c1 | 3300050491 | Bacteria | 2125 |
| 610 | nmdc:mga00v17_93586_c1 | 3300050491 | Bacteria | 1890 |
| 611 | nmdc:mga0yw44_33968_c1 | 3300050492 | Bacteria | 2985 |
| 612 | nmdc:mga06z11_113360_c1 | 3300050494 | Bacteria | 1504 |
| 613 | nmdc:mga04h51_79661_c1 | 3300050495 | Bacteria | 1160 |
| 614 | nmdc:mga08x19_24440_c1 | 3300050514 | Bacteria | 3755 |
| 615 | nmdc:mga0sz30_954_c1 | 3300050516 | Bacteria | 10363 |
| 616 | Ga0495601_0006963 | 3300053077 | Bacteria | 6622 |
| 617 | Ga0495601_0010343 | 3300053077 | Bacteria | 5550 |
| 618 | Ga0495601_0069982 | 3300053077 | Bacteria | 2239 |
| 619 | Ga0495601_0151425 | 3300053077 | Bacteria | 1514 |
| 620 | Ga0495612_0002175 | 3300053078 | Bacteria | 8074 |
| 621 | Ga0495612_0073197 | 3300053078 | Bacteria | 1431 |
| 622 | Ga0500610_0002844 | 3300053079 | Bacteria | 6494 |
| 623 | Ga0500635_0000823 | 3300053080 | Bacteria | 7657 |
| 624 | Ga0495619_0051713 | 3300053085 | Bacteria | 2716 |
| 625 | Ga0495619_0065577 | 3300053085 | Bacteria | 2422 |
| 626 | Ga0500643_001819 | 3300053087 | Bacteria | 11666 |
| 627 | Ga0500643_020043 | 3300053087 | Bacteria | 2194 |
| 628 | Ga0500644_0102333 | 3300053088 | Bacteria | 1090 |
| 629 | Ga0500651_0001015 | 3300053093 | Bacteria | 13799 |
| 630 | Ga0500640_003397 | 3300053095 | Bacteria | 5553 |
| 631 | Ga0500660_118381 | 3300053100 | Bacteria | 1109 |
| 632 | Ga0500553_050109 | 3300053101 | Bacteria | 2006 |
| 633 | Ga0500556_0062293 | 3300053104 | Bacteria | 1376 |
| 634 | Ga0500560_023200 | 3300053107 | Bacteria | 1797 |
| 635 | Ga0500572_023282 | 3300053111 | Bacteria | 1661 |
| 636 | Ga0500559_0000537 | 3300053136 | Bacteria | 26393 |
| 637 | Ga0500559_0014581 | 3300053136 | Bacteria | 3322 |
| 638 | Ga0500568_0055987 | 3300053139 | Bacteria | 1537 |
| 639 | Ga0500573_0012184 | 3300053140 | Bacteria | 4827 |
| 640 | Ga0500573_0115202 | 3300053140 | Bacteria | 1501 |
| 641 | Ga0500573_0176606 | 3300053140 | Bacteria | 1151 |
| 642 | Ga0500590_008180 | 3300053148 | Bacteria | 5209 |
| 643 | Ga0500600_0112077 | 3300053149 | Bacteria | 1420 |
| 644 | Ga0500624_004784 | 3300053157 | Bacteria | 1789 |
| 645 | Ga0500645_001076 | 3300053730 | Bacteria | 15080 |
| 646 | Ga0500645_005400 | 3300053730 | Bacteria | 4711 |
| 647 | 2508673339 | 2508501039 | Bacteria | 9978592 |
| 648 | 2585318379 | 2582581314 | Bacteria | 11452267 |
| 649 | 2619858033 | 2619618881 | Bacteria | 7521104 |
| 650 | 2620353923 | 2619619003 | Bacteria | 7619552 |
| 651 | 2643767514 | 2643221549 | Bacteria | 4042819 |
| 652 | 2644110833 | 2643221619 | Bacteria | 4158469 |
| 653 | 2644268936 | 2643221647 | Bacteria | 10741251 |
| 654 | 2644439055 | 2643221678 | Bacteria | 9540101 |
| 655 | 2644490276 | 2643221687 | Bacteria | 6500351 |
| 656 | 2644627656 | 2643221714 | Bacteria | 9015452 |
| 657 | 2644635445 | 2643221715 | Bacteria | 6671032 |
| 658 | 2689961794 | 2687453737 | Bacteria | 11203906 |
| 659 | 2738664757 | 2738541264 | Bacteria | 5935393 |
| 660 | 2738696416 | 2738541272 | Bacteria | 6848551 |
| 661 | 2738707441 | 2738541274 | Bacteria | 6909446 |
| 662 | 2739143891 | 2738541356 | Bacteria | 5935017 |
| 663 | 2739238494 | 2738543011 | Bacteria | 5731169 |
| 664 | 2739325564 | 2738543027 | Bacteria | 6409078 |
| 665 | 2739333931 | 2738543028 | Bacteria | 6917070 |
| 666 | 2808830242 | 2808606357 | Bacteria | 4466944 |
| 667 | 2808841071 | 2808606359 | Bacteria | 9866990 |
| 668 | 2812348958 | 2811994878 | Bacteria | 5992952 |
| 669 | 2855672945 | 2855670206 | Bacteria | 7120389 |
| 670 | 2857293866 | 2857288857 | Bacteria | 7189066 |
| 671 | 2858884326 | 2858882152 | Bacteria | 7230291 |
| 672 | 2862386252 | 2862382967 | Bacteria | 10317375 |
| 673 | 2862386261 | 2862382967 | Bacteria | 10317375 |
| 674 | 2867305912 | 2867302475 | Bacteria | 7087181 |
| 675 | 2867315277 | 2867312974 | Bacteria | 7058875 |
| 676 | 2867319726 | 2867319477 | Bacteria | 7069771 |
| 677 | 2869063070 | 2869061728 | Bacteria | 7112407 |
| 678 | 2869069255 | 2869068681 | Bacteria | 7205615 |
| 679 | 2889305154 | 2889300758 | Bacteria | 5690814 |
| 680 | 2895429839 | 2895427314 | Bacteria | 13147766 |
| 681 | 2902839909 | 2902837492 | Bacteria | 6697721 |
| 682 | 2919444204 | 2919443155 | Bacteria | 4072969 |
| 683 | 2929213021 | 2929212328 | Bacteria | 7708288 |
| 684 | 2935412210 | 2935409751 | Bacteria | 4179611 |
| 685 | 2946064281 | 2946064051 | Bacteria | 8957905 |
| 686 | 2954387380 | 2954380949 | Bacteria | 10050426 |
| 687 | 2954698211 | 2954691527 | Bacteria | 10720516 |
| 688 | 2954704016 | 2954701450 | Bacteria | 10834262 |
| 689 | 2966924015 | 2966921586 | Bacteria | 3092803 |
| 690 | 8003874793 | 8003870546 | Bacteria | 7396674 |
| 691 | 8054916812 | 8054913762 | Bacteria | 7713009 |
| 692 | 8054927029 | 8054920844 | Bacteria | 7068637 |
| 693 | Ga0075365_10048639 | |||
| 694 | JGI24746J21847_1004018 | |||
| 695 | JGI24743J22301_10001378 | |||
| 696 | JGI24744J21845_10000396 | |||
| 697 | JGI24744J21845_10005179 | |||
| 698 | JGI24034J26672_10001333 | |||
| 699 | Ga0055540_1006181 | |||
| 700 | Ga0055540_1010612 | |||
| 701 | Ga0070658_10039986 | |||
| 702 | Ga0070658_10069482 | |||
| 703 | Ga0068869_100212835 | |||
| 704 | Ga0070666_10068643 | |||
| 705 | Ga0070682_100004757 | |||
| 706 | Ga0070682_100115187 | |||
| 707 | Ga0070682_100180864 | |||
| 708 | Ga0070682_100183975 | |||
| 709 | Ga0070682_100223157 | |||
| 710 | Ga0068868_100035174 | |||
| 711 | Ga0068868_100064616 | |||
| 712 | Ga0068868_100071203 | |||
| 713 | Ga0070660_100009501 | |||
| 714 | Ga0070660_100099540 | |||
| 715 | Ga0070691_10008091 | |||
| 716 | Ga0070691_10028420 | |||
| 717 | Ga0070668_100000877 | |||
| 718 | Ga0070668_100004512 | |||
| 719 | Ga0070669_100017305 | |||
| 720 | Ga0070671_100038422 | |||
| 721 | Ga0070674_100013754 | |||
| 722 | Ga0070674_100119660 | |||
| 723 | Ga0070673_100211019 | |||
| 724 | Ga0070688_100009305 | |||
| 725 | Ga0070688_100121418 | |||
| 726 | Ga0070659_100000460 | |||
| 727 | Ga0070659_100009238 | |||
| 728 | Ga0070659_100145606 | |||
| 729 | Ga0070667_100008396 | |||
| 730 | Ga0070709_10008866 | |||
| 731 | Ga0070713_100058022 | |||
| 732 | Ga0070710_10006172 | |||
| 733 | Ga0070710_10020408 | |||
| 734 | Ga0070710_10092833 | |||
| 735 | Ga0070701_10001539 | |||
| 736 | Ga0070711_100024067 | |||
| 737 | Ga0070711_100032930 | |||
| 738 | Ga0070711_100088733 | |||
| 739 | Ga0070711_100163043 | |||
| 740 | Ga0070705_100028889 | |||
| 741 | Ga0070700_100002146 | |||
| 742 | Ga0070708_100048426 | |||
| 743 | Ga0070678_100005182 | |||
| 744 | Ga0070678_100294755 | |||
| 745 | Ga0070662_100009005 | |||
| 746 | Ga0070681_10190499 | |||
| 747 | Ga0068867_100005560 | |||
| 748 | Ga0068867_100208624 | |||
| 749 | Ga0070685_10008795 | |||
| 750 | Ga0070706_100001776 | |||
| 751 | Ga0070706_100228017 | |||
| 752 | Ga0070707_100017720 | |||
| 753 | Ga0070707_100037452 | |||
| 754 | Ga0070707_100053501 | |||
| 755 | Ga0070698_100010183 | |||
| 756 | Ga0070698_100027792 | |||
| 757 | Ga0070698_100333161 | |||
| 758 | Ga0070679_100369904 | |||
| 759 | Ga0070697_100113743 | |||
| 760 | Ga0068853_100029032 | |||
| 761 | Ga0070672_100012458 | |||
| 762 | Ga0070672_100012953 | |||
| 763 | Ga0070686_100066304 | |||
| 764 | Ga0070686_100071543 | |||
| 765 | Ga0070695_100004382 | |||
| 766 | Ga0070695_100076111 | |||
| 767 | Ga0070696_100013642 | |||
| 768 | Ga0070696_100018482 | |||
| 769 | Ga0070696_100104160 | |||
| 770 | Ga0070693_100005918 | |||
| 771 | Ga0070693_100076006 | |||
| 772 | Ga0070665_100034827 | |||
| 773 | Ga0070665_100080265 | |||
| 774 | Ga0070665_100081204 | |||
| 775 | Ga0070665_100130843 | |||
| 776 | Ga0070704_100007162 | |||
| 777 | Ga0070704_100082303 | |||
| 778 | Ga0068855_100007830 | |||
| 779 | Ga0068855_100029191 | |||
| 780 | Ga0068855_100117049 | |||
| 781 | Ga0068855_100345438 | |||
| 782 | Ga0068854_100004882 | |||
| 783 | Ga0068854_100015163 | |||
| 784 | Ga0068854_100079740 | |||
| 785 | Ga0068854_100086548 | |||
| 786 | Ga0068856_100117288 | |||
| 787 | Ga0068856_100123078 | |||
| 788 | Ga0068856_100239558 | |||
| 789 | Ga0070702_100002136 | |||
| 790 | Ga0068852_100033810 | |||
| 791 | Ga0068852_100609587 | |||
| 792 | Ga0068859_100100625 | |||
| 793 | Ga0068859_100274320 | |||
| 794 | Ga0068864_100095757 | |||
| 795 | Ga0068866_10002868 | |||
| 796 | Ga0068866_10036800 | |||
| 797 | Ga0068866_10094261 | |||
| 798 | Ga0068861_100007622 | |||
| 799 | Ga0068858_100000114 | |||
| 800 | Ga0068858_100021306 | |||
| 801 | Ga0068858_100283168 | |||
| 802 | Ga0068860_100012104 | |||
| 803 | Ga0068862_100076633 | |||
| 804 | Ga0070717_10015514 | |||
| 805 | Ga0075365_10028655 | |||
| 806 | Ga0075363_100013546 | |||
| 807 | Ga0075363_100036438 | |||
| 808 | Ga0075363_100070975 | |||
| 809 | Ga0075364_10000224 | |||
| 810 | Ga0075364_10065098 | |||
| 811 | Ga0075364_10174801 | |||
| 812 | Ga0070715_10002080 | |||
| 813 | Ga0070712_100003305 | |||
| 814 | Ga0070712_100003517 | |||
| 815 | Ga0070712_100073957 | |||
| 816 | Ga0070712_100208606 | |||
| 817 | Ga0075369_10011815 | |||
| 818 | Ga0097621_100023301 | |||
| 819 | Ga0075428_100044048 | |||
| 820 | Ga0075431_100130276 | |||
| 821 | Ga0075434_100000118 | |||
| 822 | Ga0068865_100023640 | |||
| 823 | Ga0068865_100068415 | |||
| 824 | Ga0075436_100008163 | |||
| 825 | Ga0075436_100053369 | |||
| 826 | Ga0097620_100100626 | |||
| 827 | Ga0097620_100274284 | |||
| 828 | Ga0099826_10171946 | |||
| 829 | Ga0105240_10009788 | |||
| 830 | Ga0105245_10003899 | |||
| 831 | Ga0105245_10016597 | |||
| 832 | Ga0105245_10017795 | |||
| 833 | Ga0105245_10042499 | |||
| 834 | Ga0105247_10006675 | |||
| 835 | Ga0105247_10028242 | |||
| 836 | Ga0105247_10032544 | |||
| 837 | Ga0105247_10074856 | |||
| 838 | Ga0105247_10102455 | |||
| 839 | Ga0114129_10008246 | |||
| 840 | Ga0114129_10368379 | |||
| 841 | Ga0105243_10018545 | |||
| 842 | Ga0105243_10025624 | |||
| 843 | Ga0105243_10153447 | |||
| 844 | Ga0105243_10173478 | |||
| 845 | Ga0105243_10254595 | |||
| 846 | Ga0105241_10009956 | |||
| 847 | Ga0105241_10143278 | |||
| 848 | Ga0105242_10006090 | |||
| 849 | Ga0105248_10000876 | |||
| 850 | Ga0105248_10014504 | |||
| 851 | Ga0105248_10074045 | |||
| 852 | Ga0105248_10265373 | |||
| 853 | Ga0105237_10009391 | |||
| 854 | Ga0105237_10042786 | |||
| 855 | Ga0105237_10057338 | |||
| 856 | Ga0105238_10008923 | |||
| 857 | Ga0105238_10039603 | |||
| 858 | Ga0105238_10308270 | |||
| 859 | Ga0105249_10008447 | |||
| 860 | Ga0105249_10039528 | |||
| 861 | Ga0105239_10147169 | |||
| 862 | Ga0105239_10171194 | |||
| 863 | Ga0105239_10242708 | |||
| 864 | Ga0105246_10003717 | |||
| 865 | Ga0105246_10024534 | |||
| 866 | Ga0105246_10051051 | |||
| 867 | Ga0105246_10114205 | |||
| 868 | Ga0157369_10090746 | |||
| 869 | Ga0157369_10131276 | |||
| 870 | Ga0157369_10150894 | |||
| 871 | Ga0157374_10020548 | |||
| 872 | Ga0157374_10080116 | |||
| 873 | Ga0157374_10251049 | |||
| 874 | Ga0157378_10013394 | |||
| 875 | Ga0157378_10036552 | |||
| 876 | Ga0163162_10009043 | |||
| 877 | Ga0157372_10007765 | |||
| 878 | Ga0157372_10017699 | |||
| 879 | Ga0157372_10476897 | |||
| 880 | Ga0157375_10006557 | |||
| 881 | Ga0157375_10047810 | |||
| 882 | Ga0157375_10051046 | |||
| 883 | Ga0157375_10119587 | |||
| 884 | Ga0157375_10555053 | |||
| 885 | Ga0163163_10003761 | |||
| 886 | Ga0163163_10003936 | |||
| 887 | Ga0163163_10095408 | |||
| 888 | Ga0157380_10011225 | |||
| 889 | Ga0157380_10265484 | |||
| 890 | Ga0157377_10027866 | |||
| 891 | Ga0157377_10028708 | |||
| 892 | Ga0157379_10004758 | |||
| 893 | Ga0157379_10106882 | |||
| 894 | Ga0157376_10038115 | |||
| 895 | Ga0163161_10003863 | |||
| 896 | Ga0209051_1000425 | |||
| 897 | Ga0209051_1009005 | |||
| 898 | Ga0207692_10011204 | |||
| 899 | Ga0207692_10089953 | |||
| 900 | Ga0207642_10000963 | |||
| 901 | Ga0207710_10001082 | |||
| 902 | Ga0207710_10023802 | |||
| 903 | Ga0207688_10000065 | |||
| 904 | Ga0207688_10003328 | |||
| 905 | Ga0207688_10021854 | |||
| 906 | Ga0207680_10062341 | |||
| 907 | Ga0207647_10003115 | |||
| 908 | Ga0207647_10105443 | |||
| 909 | Ga0207647_10157861 | |||
| 910 | Ga0207685_10006603 | |||
| 911 | Ga0207643_10080596 | |||
| 912 | Ga0207705_10216088 | |||
| 913 | Ga0207684_10000007 | |||
| 914 | Ga0207684_10000015 | |||
| 915 | Ga0207684_10191526 | |||
| 916 | Ga0207654_10104246 | |||
| 917 | Ga0207695_10046416 | |||
| 918 | Ga0207695_10163719 | |||
| 919 | Ga0207671_10011607 | |||
| 920 | Ga0207693_10001867 | |||
| 921 | Ga0207693_10002565 | |||
| 922 | Ga0207693_10006857 | |||
| 923 | Ga0207693_10086316 | |||
| 924 | Ga0207693_10098145 | |||
| 925 | Ga0207663_10033822 | |||
| 926 | Ga0207663_10039232 | |||
| 927 | Ga0207657_10000854 | |||
| 928 | Ga0207646_10004478 | |||
| 929 | Ga0207681_10005765 | |||
| 930 | Ga0207694_10011460 | |||
| 931 | Ga0207694_10100795 | |||
| 932 | Ga0207694_10217500 | |||
| 933 | Ga0207687_10003786 | |||
| 934 | Ga0207687_10006239 | |||
| 935 | Ga0207687_10027689 | |||
| 936 | Ga0207687_10028608 | |||
| 937 | Ga0207644_10063384 | |||
| 938 | Ga0207690_10005530 | |||
| 939 | Ga0207690_10005863 | |||
| 940 | Ga0207690_10161721 | |||
| 941 | Ga0207706_10015156 | |||
| 942 | Ga0207706_10033740 | |||
| 943 | Ga0207686_10003068 | |||
| 944 | Ga0207709_10003258 | |||
| 945 | Ga0207709_10175475 | |||
| 946 | Ga0207669_10000196 | |||
| 947 | Ga0207669_10084238 | |||
| 948 | Ga0207669_10094556 | |||
| 949 | Ga0207704_10001017 | |||
| 950 | Ga0207665_10005485 | |||
| 951 | Ga0207691_10093682 | |||
| 952 | Ga0207691_10166549 | |||
| 953 | Ga0207711_10003792 | |||
| 954 | Ga0207711_10029154 | |||
| 955 | Ga0207711_10146716 | |||
| 956 | Ga0207711_10311377 | |||
| 957 | Ga0207689_10017082 | |||
| 958 | Ga0207689_10062836 | |||
| 959 | Ga0207661_10038467 | |||
| 960 | Ga0207661_10168587 | |||
| 961 | Ga0207667_10002967 | |||
| 962 | Ga0207667_10007536 | |||
| 963 | Ga0207667_10043851 | |||
| 964 | Ga0207667_10061208 | |||
| 965 | Ga0207667_10312311 | |||
| 966 | Ga0207651_10117218 | |||
| 967 | Ga0207712_10012441 | |||
| 968 | Ga0207712_10039536 | |||
| 969 | Ga0207668_10000677 | |||
| 970 | Ga0207668_10015960 | |||
| 971 | Ga0207640_10007461 | |||
| 972 | Ga0207640_10007659 | |||
| 973 | Ga0207640_10019537 | |||
| 974 | Ga0207658_10035339 | |||
| 975 | Ga0207658_10228593 | |||
| 976 | Ga0207677_10009436 | |||
| 977 | Ga0207677_10023380 | |||
| 978 | Ga0207703_10006652 | |||
| 979 | Ga0207703_10011047 | |||
| 980 | Ga0207703_10061533 | |||
| 981 | Ga0207703_10084538 | |||
| 982 | Ga0207703_10292856 | |||
| 983 | Ga0207639_10022736 | |||
| 984 | Ga0207639_10040755 | |||
| 985 | Ga0207678_10036101 | |||
| 986 | Ga0207678_10117905 | |||
| 987 | Ga0207708_10000667 | |||
| 988 | Ga0207708_10071960 | |||
| 989 | Ga0207702_10584071 | |||
| 990 | Ga0207641_10307170 | |||
| 991 | Ga0207641_10484049 | |||
| 992 | Ga0207648_10008461 | |||
| 993 | Ga0207648_10189151 | |||
| 994 | Ga0207676_10249817 | |||
| 995 | Ga0207674_10043557 | |||
| 996 | Ga0207675_100009171 | |||
| 997 | Ga0207675_100019497 | |||
| 998 | Ga0207683_10002485 | |||
| 999 | Ga0207683_10030265 | |||
| 1000 | Ga0207683_10034500 | |||
| 1001 | Ga0207698_10000489 | |||
| 1002 | Ga0207698_10039914 | |||
| 1003 | Ga0207698_10262804 | |||
| 1004 | Ga0268266_10067096 | |||
| 1005 | Ga0268266_10098014 | |||
| 1006 | Ga0268266_10099741 | |||
| 1007 | Ga0268266_10106202 | |||
| 1008 | Ga0268266_10195860 | |||
| 1009 | Ga0268264_10006935 | |||
| 1010 | Ga0265336_10002530 | |||
| 1011 | Ga0307515_10003890 | |||
| 1012 | Ga0265338_10176333 | |||
| 1013 | Ga0307511_10041814 | |||
| 1014 | Ga0265327_10013223 | |||
| 1015 | Ga0307408_100019291 | |||
| 1016 | Ga0307408_100097860 | |||
| 1017 | Ga0307408_100112681 | |||
| 1018 | Ga0307508_10005959 | |||
| 1019 | Ga0307514_10024568 | |||
| 1020 | Ga0307516_10003823 | |||
| 1021 | Ga0307405_10041084 | |||
| 1022 | Ga0307413_10301067 | |||
| 1023 | Ga0307518_10061748 | |||
| 1024 | Ga0307518_10138388 | |||
| 1025 | Ga0307406_10008248 | |||
| 1026 | Ga0307412_10128826 | |||
| 1027 | Ga0307409_100070035 | |||
| 1028 | Ga0307409_100389624 | |||
| 1029 | Ga0307416_100219846 | |||
| 1030 | Ga0307414_10352425 | |||
| 1031 | Ga0307415_100124572 | |||
| 1032 | Ga0307415_100431797 | |||
| 1033 | Ga0307507_10088896 | |||
| 1034 | Ga0307507_10097456 | |||
| 1035 | Ga0307510_10001109 | |||
| 1036 | Ga0373926_0010701 | |||
| 1037 | Ga0373934_0062535 | |||
| 1038 | Ga0373923_0045697 | |||
| 1039 | Ga0373936_0033783 | |||
| 1040 | Ga0373946_0035475 | |||
| 1041 | Ga0373955_0048699 | |||
| 1042 | Ga0373931_0021878 | |||
| 1043 | Ga0373935_0057572 | |||
| 1044 | Ga0373947_0042841 | |||
| 1045 | Ga0373947_0091659 | |||
| 1046 | Ga0373947_0281312 | |||
| 1047 | Ga0373937_0080132 | |||
| 1048 | Ga0373937_0324618 | |||
| 1049 | Ga0373925_0329104 | |||
| 1050 | Ga0395900_0234303 | |||
| 1051 | Ga0395898_0241224 | |||
| 1052 | Ga0436364_0537053 | |||
| 1053 | Ga0395901_0002712 | |||
| 1054 | Ga0436365_1207048 | |||
| 1055 | Ga0439448_0037382 | |||
| 1056 | Ga0439448_0054352 | |||
| 1057 | Ga0439449_0005151 | |||
| 1058 | Ga0439455_0000583 | |||
| 1059 | Ga0450903_000032 | |||
| 1060 | Ga0439458_0000080 | |||
| 1061 | Ga0450901_007387 | |||
| 1062 | Ga0453684_0453003 | |||
| 1063 | Ga0466967_0006022 | |||
| 1064 | Ga0466967_0017065 | |||
| 1065 | Ga0466967_0768194 | |||
| 1066 | Ga0495592_0000011 | |||
| 1067 | Ga0495592_0002498 | |||
| 1068 | Ga0495603_0004683 | |||
| 1069 | Ga0495629_0000252 | |||
| 1070 | Ga0495629_0002865 | |||
| 1071 | Ga0495629_0031636 | |||
| 1072 | Ga0495638_0015739 | |||
| 1073 | Ga0495638_0089936 | |||
| 1074 | Ga0495638_0141034 | |||
| 1075 | Ga0495651_0004365 | |||
| 1076 | Ga0495651_0007039 | |||
| 1077 | Ga0495651_0026723 | |||
| 1078 | Ga0495653_0000345 | |||
| 1079 | Ga0495653_0001114 | |||
| 1080 | Ga0495580_0042034 | |||
| 1081 | Ga0495582_0009584 | |||
| 1082 | Ga0495582_0094176 | |||
| 1083 | Ga0495639_0021265 | |||
| 1084 | Ga0495662_0000141 | |||
| 1085 | Ga0495662_0005261 | |||
| 1086 | Ga0495662_0133180 | |||
| 1087 | Ga0495662_0173473 | |||
| 1088 | Ga0495664_0000222 | |||
| 1089 | Ga0495664_0000520 | |||
| 1090 | Ga0495664_0002146 | |||
| 1091 | Ga0495664_0148631 | |||
| 1092 | Ga0495585_0007625 | |||
| 1093 | Ga0495594_0000146 | |||
| 1094 | Ga0495594_0211478 | |||
| 1095 | Ga0495608_0009576 | |||
| 1096 | Ga0495608_0024041 | |||
| 1097 | Ga0495618_0012341 | |||
| 1098 | Ga0495620_0073565 | |||
| 1099 | Ga0495628_0000064 | |||
| 1100 | Ga0495628_0005049 | |||
| 1101 | Ga0495628_0017396 | |||
| 1102 | Ga0495628_0121703 | |||
| 1103 | Ga0495630_0000035 | |||
| 1104 | Ga0495630_0018638 | |||
| 1105 | Ga0495630_0039976 | |||
| 1106 | Ga0495630_0082056 | |||
| 1107 | Ga0495630_0214507 | |||
| 1108 | Ga0495666_0000539 | |||
| 1109 | Ga0495666_0011056 | |||
| 1110 | Ga0495666_0099933 | |||
| 1111 | Ga0495652_0000169 | |||
| 1112 | Ga0495652_0002735 | |||
| 1113 | Ga0495652_0082434 | |||
| 1114 | Ga0495652_0140402 | |||
| 1115 | Ga0495652_0141304 | |||
| 1116 | Ga0495665_0038608 | |||
| 1117 | Ga0495640_0002459 | |||
| 1118 | Ga0495640_0010908 | |||
| 1119 | Ga0495640_0031012 | |||
| 1120 | Ga0495640_0193068 | |||
| 1121 | Ga0495586_0002691 | |||
| 1122 | Ga0495586_0032133 | |||
| 1123 | Ga0495587_0000064 | |||
| 1124 | Ga0495587_0003751 | |||
| 1125 | Ga0495587_0041299 | |||
| 1126 | Ga0495645_0000042 | |||
| 1127 | Ga0495645_0002575 | |||
| 1128 | Ga0495645_0026231 | |||
| 1129 | Ga0495622_0004175 | |||
| 1130 | Ga0495622_0076759 | |||
| 1131 | Ga0495667_0002691 | |||
| 1132 | Ga0495667_0005356 | |||
| 1133 | Ga0495667_0246380 | |||
| 1134 | Ga0495634_0000126 | |||
| 1135 | Ga0495634_0000148 | |||
| 1136 | Ga0495634_0004619 | |||
| 1137 | Ga0495634_0022306 | |||
| 1138 | Ga0495634_0051243 | |||
| 1139 | Ga0495634_0072474 | |||
| 1140 | Ga0495611_0010749 | |||
| 1141 | Ga0495625_0318806 | |||
| 1142 | Ga0495635_0000032 | |||
| 1143 | Ga0495635_0002172 | |||
| 1144 | Ga0495635_0002919 | |||
| 1145 | Ga0495635_0021294 | |||
| 1146 | Ga0495635_0037826 | |||
| 1147 | Ga0495588_0014028 | |||
| 1148 | Ga0495657_0005794 | |||
| 1149 | Ga0495657_0007861 | |||
| 1150 | Ga0495657_0009247 | |||
| 1151 | Ga0495657_0009699 | |||
| 1152 | Ga0495657_0043888 | |||
| 1153 | Ga0495599_0000044 | |||
| 1154 | Ga0495599_0036827 | |||
| 1155 | Ga0495599_0189852 | |||
| 1156 | Ga0495623_0001203 | |||
| 1157 | Ga0495646_0000028 | |||
| 1158 | Ga0495646_0000262 | |||
| 1159 | Ga0495646_0004903 | |||
| 1160 | Ga0495646_0017062 | |||
| 1161 | Ga0495647_0004926 | |||
| 1162 | Ga0495658_0019820 | |||
| 1163 | Ga0495658_0021840 | |||
| 1164 | Ga0495658_0039380 | |||
| 1165 | Ga0495613_0001824 | |||
| 1166 | Ga0495613_0003748 | |||
| 1167 | Ga0495613_0084797 | |||
| 1168 | Ga0495613_0114344 | |||
| 1169 | Ga0495624_0051905 | |||
| 1170 | Ga0495624_0167605 | |||
| 1171 | Ga0495600_0000044 | |||
| 1172 | Ga0495600_0001980 | |||
| 1173 | Ga0495600_0008148 | |||
| 1174 | Ga0495600_0012004 | |||
| 1175 | Ga0495600_0028544 | |||
| 1176 | Ga0495660_0055845 | |||
| 1177 | Ga0495581_0001951 | |||
| 1178 | Ga0495581_0008584 | |||
| 1179 | Ga0495581_0176773 | |||
| 1180 | Ga0495604_0000162 | |||
| 1181 | Ga0495604_0000268 | |||
| 1182 | Ga0495604_0002629 | |||
| 1183 | Ga0495604_0005093 | |||
| 1184 | Ga0495604_0072473 | |||
| 1185 | Ga0495674_0000036 | |||
| 1186 | Ga0495674_0008471 | |||
| 1187 | Ga0495674_0038152 | |||
| 1188 | Ga0495674_0040443 | |||
| 1189 | Ga0495674_0062850 | |||
| 1190 | Ga0495674_0084883 | |||
| 1191 | Ga0495674_0186961 | |||
| 1192 | Ga0495676_0002642 | |||
| 1193 | Ga0495676_0008319 | |||
| 1194 | Ga0495676_0009530 | |||
| 1195 | Ga0495676_0046986 | |||
| 1196 | Ga0495676_0065891 | |||
| 1197 | Ga0495676_0164282 | |||
| 1198 | Ga0495680_0003113 | |||
| 1199 | Ga0495680_0091273 | |||
| 1200 | Ga0495680_0178341 | |||
| 1201 | Ga0495680_0260815 | |||
| 1202 | Ga0495683_0001134 | |||
| 1203 | Ga0495675_0000126 | |||
| 1204 | Ga0495685_018793 | |||
| 1205 | Ga0495684_0000474 | |||
| 1206 | Ga0495684_0006608 | |||
| 1207 | Ga0495684_0022687 | |||
| 1208 | Ga0495684_0034099 | |||
| 1209 | Ga0495684_0201971 | |||
| 1210 | Ga0495593_0002507 | |||
| 1211 | Ga0495593_0012644 | |||
| 1212 | Ga0495593_0032413 | |||
| 1213 | Ga0495593_0122837 | |||
| 1214 | Ga0495602_0000078 | |||
| 1215 | Ga0495602_0013750 | |||
| 1216 | Ga0495602_0017865 | |||
| 1217 | Ga0495614_0001782 | |||
| 1218 | Ga0495614_0009344 | |||
| 1219 | Ga0495614_0021115 | |||
| 1220 | Ga0496100_0000320 | |||
| 1221 | Ga0496100_0002169 | |||
| 1222 | Ga0496100_0027292 | |||
| 1223 | Ga0496100_0064239 | |||
| 1224 | Ga0496100_0211548 | |||
| 1225 | Ga0496101_0001345 | |||
| 1226 | Ga0496101_0003035 | |||
| 1227 | Ga0496101_0006148 | |||
| 1228 | Ga0496101_0009943 | |||
| 1229 | Ga0496102_0015279 | |||
| 1230 | Ga0496102_0037193 | |||
| 1231 | Ga0496102_0074045 | |||
| 1232 | Ga0496103_0007441 | |||
| 1233 | Ga0496103_0054006 | |||
| 1234 | Ga0496104_0011864 | |||
| 1235 | Ga0496104_0014877 | |||
| 1236 | Ga0496104_0058457 | |||
| 1237 | Ga0496104_0662692 | |||
| 1238 | Ga0496105_0010304 | |||
| 1239 | Ga0496105_0056786 | |||
| 1240 | Ga0496105_0091001 | |||
| 1241 | Ga0496106_0001251 | |||
| 1242 | Ga0496106_0003667 | |||
| 1243 | Ga0496106_0004404 | |||
| 1244 | Ga0496106_0010435 | |||
| 1245 | Ga0496106_0114213 | |||
| 1246 | Ga0496107_0001939 | |||
| 1247 | Ga0496107_0009236 | |||
| 1248 | Ga0496107_0031642 | |||
| 1249 | Ga0496107_0034462 | |||
| 1250 | Ga0496108_0001696 | |||
| 1251 | Ga0496108_0001836 | |||
| 1252 | Ga0496108_0038437 | |||
| 1253 | Ga0496108_0159792 | |||
| 1254 | Ga0496109_0003536 | |||
| 1255 | Ga0496109_0008556 | |||
| 1256 | Ga0496109_0025474 | |||
| 1257 | Ga0496110_0040553 | |||
| 1258 | Ga0496111_0025301 | |||
| 1259 | Ga0496112_0000439 | |||
| 1260 | Ga0496112_0026454 | |||
| 1261 | Ga0496112_0037916 | |||
| 1262 | Ga0496112_0059511 | |||
| 1263 | Ga0496112_0119790 | |||
| 1264 | Ga0496112_0312789 | |||
| 1265 | Ga0496113_0010467 | |||
| 1266 | Ga0496113_0061227 | |||
| 1267 | Ga0496113_0223506 | |||
| 1268 | Ga0496114_0000999 | |||
| 1269 | Ga0496114_0005908 | |||
| 1270 | Ga0496114_0029383 | |||
| 1271 | Ga0496115_0000491 | |||
| 1272 | Ga0496115_0010359 | |||
| 1273 | Ga0496115_0011304 | |||
| 1274 | Ga0496115_0024795 | |||
| 1275 | Ga0496118_0001434 | |||
| 1276 | Ga0496122_0003293 | |||
| 1277 | Ga0496126_0000036 | |||
| 1278 | Ga0496126_0004061 | |||
| 1279 | Ga0496126_0086778 | |||
| 1280 | Ga0501032_0006305 | |||
| 1281 | Ga0501032_0007147 | |||
| 1282 | Ga0501033_0067831 | |||
| 1283 | Ga0501034_0000819 | |||
| 1284 | Ga0501034_0036672 | |||
| 1285 | Ga0501034_0352891 | |||
| 1286 | Ga0501036_0007783 | |||
| 1287 | Ga0501037_0000702 | |||
| 1288 | Ga0501038_0070993 | |||
| 1289 | Ga0501039_0013632 | |||
| 1290 | Ga0501046_0001146 | |||
| 1291 | Ga0501047_0001633 | |||
| 1292 | Ga0501048_0017268 | |||
| 1293 | Ga0501070_0000188 | |||
| 1294 | Ga0501073_0257626 | |||
| 1295 | Ga0501035_0000466 | |||
| 1296 | Ga0501044_0000865 | |||
| 1297 | Ga0501044_0003325 | |||
| 1298 | nmdc:mga03n38_54876_c1 | |||
| 1299 | nmdc:mga03n38_6827_c1 | |||
| 1300 | nmdc:mga00v17_6150_c1 | |||
| 1301 | nmdc:mga00v17_73393_c1 | |||
| 1302 | nmdc:mga00v17_93586_c1 | |||
| 1303 | nmdc:mga0yw44_33968_c1 | |||
| 1304 | nmdc:mga06z11_113360_c1 | |||
| 1305 | nmdc:mga04h51_79661_c1 | |||
| 1306 | nmdc:mga08x19_24440_c1 | |||
| 1307 | nmdc:mga0sz30_954_c1 | |||
| 1308 | Ga0495601_0006963 | |||
| 1309 | Ga0495601_0010343 | |||
| 1310 | Ga0495601_0069982 | |||
| 1311 | Ga0495601_0151425 | |||
| 1312 | Ga0495612_0002175 | |||
| 1313 | Ga0495612_0073197 | |||
| 1314 | Ga0500610_0002844 | |||
| 1315 | Ga0500635_0000823 | |||
| 1316 | Ga0495619_0051713 | |||
| 1317 | Ga0495619_0065577 | |||
| 1318 | Ga0500643_001819 | |||
| 1319 | Ga0500643_020043 | |||
| 1320 | Ga0500644_0102333 | |||
| 1321 | Ga0500651_0001015 | |||
| 1322 | Ga0500640_003397 | |||
| 1323 | Ga0500660_118381 | |||
| 1324 | Ga0500553_050109 | |||
| 1325 | Ga0500556_0062293 | |||
| 1326 | Ga0500560_023200 | |||
| 1327 | Ga0500572_023282 | |||
| 1328 | Ga0500559_0000537 | |||
| 1329 | Ga0500559_0014581 | |||
| 1330 | Ga0500568_0055987 | |||
| 1331 | Ga0500573_0012184 | |||
| 1332 | Ga0500573_0115202 | |||
| 1333 | Ga0500573_0176606 | |||
| 1334 | Ga0500590_008180 | |||
| 1335 | Ga0500600_0112077 | |||
| 1336 | Ga0500624_004784 | |||
| 1337 | Ga0500645_001076 | |||
| 1338 | Ga0500645_005400 | |||
| 1339 | 2508673339 | |||
| 1340 | 2585318379 | |||
| 1341 | 2619858033 | |||
| 1342 | 2620353923 | |||
| 1343 | 2643767514 | |||
| 1344 | 2644110833 | |||
| 1345 | 2644268936 | |||
| 1346 | 2644439055 | |||
| 1347 | 2644490276 | |||
| 1348 | 2644627656 | |||
| 1349 | 2644635445 | |||
| 1350 | 2689961794 | |||
| 1351 | 2738664757 | |||
| 1352 | 2738696416 | |||
| 1353 | 2738707441 | |||
| 1354 | 2739143891 | |||
| 1355 | 2739238494 | |||
| 1356 | 2739325564 | |||
| 1357 | 2739333931 | |||
| 1358 | 2808830242 | |||
| 1359 | 2808841071 | |||
| 1360 | 2812348958 | |||
| 1361 | 2855672945 | |||
| 1362 | 2857293866 | |||
| 1363 | 2858884326 | |||
| 1364 | 2862386252 | |||
| 1365 | 2862386261 | |||
| 1366 | 2867305912 | |||
| 1367 | 2867315277 | |||
| 1368 | 2867319726 | |||
| 1369 | 2869063070 | |||
| 1370 | 2869069255 | |||
| 1371 | 2889305154 | |||
| 1372 | 2895429839 | |||
| 1373 | 2902839909 | |||
| 1374 | 2919444204 | |||
| 1375 | 2929213021 | |||
| 1376 | 2935412210 | |||
| 1377 | 2946064281 | |||
| 1378 | 2954387380 | |||
| 1379 | 2954698211 | |||
| 1380 | 2954704016 | |||
| 1381 | 2966924015 | |||
| 1382 | 8003874793 | |||
| 1383 | 8054916812 | |||
| 1384 | 8054927029 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3v0t-assembly1.cif.gz_A | crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding | 0.9117 | 1 | 306 |
| 3v0u-assembly1.cif.gz_A | crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding | 0.9039 | 1 | 313 |
| 6ky6-assembly2.cif.gz_B | crystal structure of a thermostable aldo-keto reductase tm1743 in complexs with inhibitor epalrestat in space group p3221cc | 0.8988 | 1 | 308 |
| 6ovq-assembly2.cif.gz_B | crystal structure of mithramycin 3-side chain keto-reductase mtmw | 0.896 | 1 | 306 |
| 6ky6-assembly2.cif.gz_B | crystal structure of a thermostable aldo-keto reductase tm1743 in complexs with inhibitor epalrestat in space group p3221cc | 0.8957 | 1 | 308 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_F4HPY8_8_325_3.20.20.100 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.9385 | 1 | 317 | 3.20.20.100 |
| af_A0A0R0ETH2_7_234_3.20.20.100 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.9247 | 1 | 214 | 3.20.20.100 |
| af_A0A1D6KUU8_358_629_3.20.20.100 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.9213 | 73 | 322 | 3.20.20.100 |
| af_Q09923_6_337_3.20.20.100 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.9187 | 5 | 315 | 3.20.20.100 |
| af_P49249_9_269_3.20.20.100 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.9157 | 1 | 249 | 3.20.20.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W9XGC8-F1-model_v4 | Aryl-alcohol dehydrogenase-like predicted oxidoreductase | 0.9836 | 56 | 325 |
GO:0004033
GO:0005737 |
| AF-A0A543B050-F1-model_v4 | Aryl-alcohol dehydrogenase-like predicted oxidoreductase | 0.9826 | 2 | 325 |
GO:0004033
GO:0005737 |
| AF-A9WP92-F1-model_v4 | NADPH-dependent oxidoreductase | 0.9822 | 95 | 322 |
GO:0004033
GO:0005737 |
| AF-A0A1C6LEA1-F1-model_v4 | Predicted oxidoreductases (Related to aryl-alcohol dehydrogenases) | 0.9821 | 103 | 325 |
GO:0004033
GO:0005737 |
| AF-A0A7I9X5T2-F1-model_v4 | deleted | 0.9792 | 1 | 325 |
|