F475530
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 691 | 270 | 1382 | 121 |
Family's Representative Sequence
| Representative Sequence | 3300026041|Ga0207639_10834763|Ga0207639_108347631 |
| Length | 135 |
| Sequence | MNDIHDHGNCAVAATAEIIATKWTPLIVHDLSEGPRRFMQLEKACPGISPRTLSERLDMLERQGVLVRRSYPESPPRVEYELTEKGRALLPIIREMRKFGRSWMIPAPAKRSNRPRTRGRERHGSHGAPGSVCRA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 5 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 30 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 35 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 37 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 38 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 39 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 40 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 41 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 42 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 47 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 48 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 49 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 50 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 69 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 70 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 71 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 72 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 73 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 74 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 75 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 116 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 117 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 118 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 119 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 120 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 121 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 122 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 123 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 124 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 125 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 126 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 127 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 128 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 129 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 130 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 131 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 132 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 133 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 134 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 135 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 136 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 137 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 138 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 139 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 140 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 141 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 142 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 143 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 144 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 145 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 146 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 147 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 148 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 149 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 150 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 151 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 152 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 153 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 154 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 155 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 156 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 157 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 158 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 159 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 160 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 161 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 162 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 163 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 164 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 165 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 166 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 167 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 168 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 169 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 170 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 171 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 172 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 173 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 174 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 175 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 234 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 235 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 236 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 237 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 238 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 239 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 240 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 241 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 242 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 243 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 244 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 245 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 246 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 247 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 248 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 249 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 254 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 263 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 264 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 265 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.67 |
| Metatranscriptomes | 3.33 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 8.25 |
| Rhizosphere | 90.88 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.97 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207639_10834763 | 3300026041 | Bacteria | 860 |
| 2 | Ga0070658_10005736 | 3300005327 | Bacteria | 10067 |
| 3 | Ga0070658_10076636 | 3300005327 | Bacteria | 2742 |
| 4 | Ga0070658_10195725 | 3300005327 | Bacteria | 1704 |
| 5 | Ga0070658_10389010 | 3300005327 | Bacteria | 1197 |
| 6 | Ga0070658_11050574 | 3300005327 | Bacteria | 708 |
| 7 | Ga0070683_100006690 | 3300005329 | Bacteria | 9677 |
| 8 | Ga0070683_100038654 | 3300005329 | Bacteria | 4375 |
| 9 | Ga0070683_100163623 | 3300005329 | Bacteria | 2111 |
| 10 | Ga0070683_101329732 | 3300005329 | Bacteria | 691 |
| 11 | Ga0070680_100146179 | 3300005336 | Bacteria | 1983 |
| 12 | Ga0070680_100224030 | 3300005336 | Bacteria | 1587 |
| 13 | Ga0070682_100034507 | 3300005337 | Bacteria | 3082 |
| 14 | Ga0070682_100338087 | 3300005337 | Bacteria | 1118 |
| 15 | Ga0070682_100403939 | 3300005337 | Bacteria | 1034 |
| 16 | Ga0070660_100038088 | 3300005339 | Bacteria | 3648 |
| 17 | Ga0070660_100117890 | 3300005339 | Bacteria | 2117 |
| 18 | Ga0070660_100322293 | 3300005339 | Bacteria | 1270 |
| 19 | Ga0070661_100017594 | 3300005344 | Bacteria | 5073 |
| 20 | Ga0070661_100018666 | 3300005344 | Bacteria | 4934 |
| 21 | Ga0070661_100052516 | 3300005344 | Bacteria | 2983 |
| 22 | Ga0070661_100246424 | 3300005344 | Bacteria | 1377 |
| 23 | Ga0070661_101530751 | 3300005344 | Unclassified | 563 |
| 24 | Ga0070671_100093695 | 3300005355 | Bacteria | 2517 |
| 25 | Ga0070671_100631288 | 3300005355 | Bacteria | 927 |
| 26 | Ga0070674_100018739 | 3300005356 | Bacteria | 4384 |
| 27 | Ga0070673_101063254 | 3300005364 | Bacteria | 755 |
| 28 | Ga0070659_100096084 | 3300005366 | Bacteria | 2380 |
| 29 | Ga0070659_100183319 | 3300005366 | Bacteria | 1719 |
| 30 | Ga0070667_100011565 | 3300005367 | Bacteria | 7296 |
| 31 | Ga0070709_10116137 | 3300005434 | Bacteria | 1806 |
| 32 | Ga0070709_10431954 | 3300005434 | Bacteria | 989 |
| 33 | Ga0070709_11525562 | 3300005434 | Unclassified | 543 |
| 34 | Ga0070714_100201043 | 3300005435 | Bacteria | 1823 |
| 35 | Ga0070714_100462783 | 3300005435 | Bacteria | 1206 |
| 36 | Ga0070714_100692811 | 3300005435 | Bacteria | 983 |
| 37 | Ga0070714_101578520 | 3300005435 | Bacteria | 641 |
| 38 | Ga0070713_100141189 | 3300005436 | Bacteria | 2134 |
| 39 | Ga0070713_102225938 | 3300005436 | Bacteria | 531 |
| 40 | Ga0070710_11346181 | 3300005437 | Unclassified | 532 |
| 41 | Ga0070711_100101164 | 3300005439 | Bacteria | 2097 |
| 42 | Ga0070711_100225127 | 3300005439 | Bacteria | 1460 |
| 43 | Ga0070711_100452687 | 3300005439 | Bacteria | 1051 |
| 44 | Ga0070700_100100930 | 3300005441 | Bacteria | 1901 |
| 45 | Ga0070708_100033087 | 3300005445 | Bacteria | 4491 |
| 46 | Ga0070663_100022986 | 3300005455 | Bacteria | 4174 |
| 47 | Ga0070663_101038910 | 3300005455 | Bacteria | 714 |
| 48 | Ga0070678_100009047 | 3300005456 | Bacteria | 6003 |
| 49 | Ga0070678_100066918 | 3300005456 | Bacteria | 2672 |
| 50 | Ga0070678_100825741 | 3300005456 | Unclassified | 843 |
| 51 | Ga0070681_10000811 | 3300005458 | Bacteria | 26116 |
| 52 | Ga0070681_10018082 | 3300005458 | Bacteria | 7046 |
| 53 | Ga0070681_10025555 | 3300005458 | Bacteria | 5941 |
| 54 | Ga0070681_10084629 | 3300005458 | Bacteria | 3124 |
| 55 | Ga0070681_10211098 | 3300005458 | Bacteria | 1857 |
| 56 | Ga0070681_10835631 | 3300005458 | Bacteria | 839 |
| 57 | Ga0070685_10899494 | 3300005466 | Bacteria | 659 |
| 58 | Ga0070707_100671753 | 3300005468 | Bacteria | 999 |
| 59 | Ga0070707_101356391 | 3300005468 | Unclassified | 677 |
| 60 | Ga0070698_100446236 | 3300005471 | Bacteria | 1229 |
| 61 | Ga0070698_101363231 | 3300005471 | Bacteria | 660 |
| 62 | Ga0070699_100212994 | 3300005518 | Bacteria | 1720 |
| 63 | Ga0070699_100557897 | 3300005518 | Bacteria | 1043 |
| 64 | Ga0070679_100018749 | 3300005530 | Bacteria | 6717 |
| 65 | Ga0070679_100050681 | 3300005530 | Bacteria | 4135 |
| 66 | Ga0070679_100205588 | 3300005530 | Bacteria | 1933 |
| 67 | Ga0070679_100417215 | 3300005530 | Bacteria | 1288 |
| 68 | Ga0070679_100667314 | 3300005530 | Bacteria | 982 |
| 69 | Ga0070684_100007564 | 3300005535 | Bacteria | 8458 |
| 70 | Ga0070684_100097271 | 3300005535 | Bacteria | 2625 |
| 71 | Ga0070684_100186700 | 3300005535 | Bacteria | 1885 |
| 72 | Ga0070684_100261315 | 3300005535 | Bacteria | 1584 |
| 73 | Ga0070684_100583604 | 3300005535 | Bacteria | 1039 |
| 74 | Ga0070684_100586500 | 3300005535 | Bacteria | 1036 |
| 75 | Ga0070684_100888610 | 3300005535 | Bacteria | 835 |
| 76 | Ga0070684_100924431 | 3300005535 | Bacteria | 818 |
| 77 | Ga0068853_100270985 | 3300005539 | Bacteria | 1563 |
| 78 | Ga0068853_100690809 | 3300005539 | Bacteria | 973 |
| 79 | Ga0070672_100111106 | 3300005543 | Bacteria | 2234 |
| 80 | Ga0070696_100399003 | 3300005546 | Bacteria | 1076 |
| 81 | Ga0070665_100005864 | 3300005548 | Bacteria | 12595 |
| 82 | Ga0070704_100236161 | 3300005549 | Bacteria | 1494 |
| 83 | Ga0068855_100031342 | 3300005563 | Bacteria | 6349 |
| 84 | Ga0068855_100053400 | 3300005563 | Bacteria | 4754 |
| 85 | Ga0068855_100095958 | 3300005563 | Bacteria | 3417 |
| 86 | Ga0068855_100123914 | 3300005563 | Bacteria | 2956 |
| 87 | Ga0068855_100192176 | 3300005563 | Bacteria | 2302 |
| 88 | Ga0068855_101531712 | 3300005563 | Unclassified | 684 |
| 89 | Ga0070664_100419756 | 3300005564 | Bacteria | 1225 |
| 90 | Ga0068857_100012134 | 3300005577 | Bacteria | 7494 |
| 91 | Ga0068857_100102112 | 3300005577 | Bacteria | 2574 |
| 92 | Ga0068857_100148904 | 3300005577 | Bacteria | 2119 |
| 93 | Ga0068854_100427200 | 3300005578 | Bacteria | 1102 |
| 94 | Ga0068854_100496713 | 3300005578 | Bacteria | 1027 |
| 95 | Ga0068856_100099036 | 3300005614 | Bacteria | 2906 |
| 96 | Ga0068856_100134461 | 3300005614 | Bacteria | 2478 |
| 97 | Ga0068856_100273325 | 3300005614 | Bacteria | 1706 |
| 98 | Ga0068856_100494084 | 3300005614 | Bacteria | 1244 |
| 99 | Ga0068856_100549603 | 3300005614 | Bacteria | 1176 |
| 100 | Ga0068852_100035501 | 3300005616 | Bacteria | 4160 |
| 101 | Ga0068852_100058958 | 3300005616 | Bacteria | 3328 |
| 102 | Ga0068852_100082756 | 3300005616 | Bacteria | 2853 |
| 103 | Ga0068861_102417362 | 3300005719 | Unclassified | 528 |
| 104 | Ga0068870_10731906 | 3300005840 | Unclassified | 685 |
| 105 | Ga0070717_10298640 | 3300006028 | Bacteria | 1431 |
| 106 | Ga0070716_100500840 | 3300006173 | Bacteria | 896 |
| 107 | Ga0070712_100257636 | 3300006175 | Bacteria | 1397 |
| 108 | Ga0070712_100411423 | 3300006175 | Bacteria | 1119 |
| 109 | Ga0070712_100708520 | 3300006175 | Unclassified | 859 |
| 110 | Ga0070712_101546947 | 3300006175 | Unclassified | 580 |
| 111 | Ga0097621_101208052 | 3300006237 | Bacteria | 712 |
| 112 | Ga0097621_101944847 | 3300006237 | Unclassified | 561 |
| 113 | Ga0075430_101813808 | 3300006846 | Unclassified | 500 |
| 114 | Ga0075433_10858836 | 3300006852 | Bacteria | 792 |
| 115 | Ga0075434_100036196 | 3300006871 | Bacteria | 4883 |
| 116 | Ga0075435_100177202 | 3300007076 | Bacteria | 1800 |
| 117 | Ga0105240_10113039 | 3300009093 | Bacteria | 3281 |
| 118 | Ga0105240_10314715 | 3300009093 | Bacteria | 1786 |
| 119 | Ga0105240_10969513 | 3300009093 | Bacteria | 911 |
| 120 | Ga0105240_11462617 | 3300009093 | Bacteria | 717 |
| 121 | Ga0105240_12203134 | 3300009093 | Bacteria | 571 |
| 122 | Ga0105245_10193967 | 3300009098 | Bacteria | 1947 |
| 123 | Ga0105245_10715775 | 3300009098 | Bacteria | 1035 |
| 124 | Ga0105245_10744945 | 3300009098 | Bacteria | 1015 |
| 125 | Ga0105245_10973682 | 3300009098 | Bacteria | 892 |
| 126 | Ga0114129_10313527 | 3300009147 | Bacteria | 2087 |
| 127 | Ga0114129_11970664 | 3300009147 | Bacteria | 707 |
| 128 | Ga0105243_10281008 | 3300009148 | Bacteria | 1499 |
| 129 | Ga0105243_10650810 | 3300009148 | Bacteria | 1021 |
| 130 | Ga0105243_11107907 | 3300009148 | Bacteria | 800 |
| 131 | Ga0105241_11174287 | 3300009174 | Bacteria | 726 |
| 132 | Ga0105242_10013571 | 3300009176 | Bacteria | 6303 |
| 133 | Ga0105237_10036436 | 3300009545 | Bacteria | 4978 |
| 134 | Ga0105237_10109056 | 3300009545 | Bacteria | 2760 |
| 135 | Ga0105237_10433505 | 3300009545 | Bacteria | 1320 |
| 136 | Ga0105237_12361353 | 3300009545 | Bacteria | 542 |
| 137 | Ga0105238_10014744 | 3300009551 | Bacteria | 7905 |
| 138 | Ga0105238_10796956 | 3300009551 | Bacteria | 960 |
| 139 | Ga0105238_11960567 | 3300009551 | Bacteria | 619 |
| 140 | Ga0105238_12656932 | 3300009551 | Unclassified | 537 |
| 141 | Ga0105239_10104137 | 3300010375 | Bacteria | 3142 |
| 142 | Ga0105239_10328795 | 3300010375 | Bacteria | 1724 |
| 143 | Ga0105239_13029673 | 3300010375 | Unclassified | 548 |
| 144 | Ga0157370_10013255 | 3300013104 | Bacteria | 8496 |
| 145 | Ga0157370_10025477 | 3300013104 | Bacteria | 5856 |
| 146 | Ga0157370_10097933 | 3300013104 | Bacteria | 2751 |
| 147 | Ga0157370_10134919 | 3300013104 | Bacteria | 2301 |
| 148 | Ga0157370_10307514 | 3300013104 | Bacteria | 1463 |
| 149 | Ga0157370_10345088 | 3300013104 | Bacteria | 1372 |
| 150 | Ga0157370_11641747 | 3300013104 | Bacteria | 577 |
| 151 | Ga0157369_10036956 | 3300013105 | Bacteria | 5350 |
| 152 | Ga0157369_10040691 | 3300013105 | Bacteria | 5074 |
| 153 | Ga0157369_10088788 | 3300013105 | Bacteria | 3300 |
| 154 | Ga0157369_10134114 | 3300013105 | Bacteria | 2623 |
| 155 | Ga0157369_10149361 | 3300013105 | Bacteria | 2470 |
| 156 | Ga0157369_10467383 | 3300013105 | Bacteria | 1306 |
| 157 | Ga0157369_10830546 | 3300013105 | Bacteria | 949 |
| 158 | Ga0157374_10037353 | 3300013296 | Bacteria | 4458 |
| 159 | Ga0157374_10315715 | 3300013296 | Bacteria | 1548 |
| 160 | Ga0157374_11186019 | 3300013296 | Bacteria | 785 |
| 161 | Ga0157378_10773835 | 3300013297 | Bacteria | 984 |
| 162 | Ga0157378_10809147 | 3300013297 | Bacteria | 963 |
| 163 | Ga0157372_10067660 | 3300013307 | Bacteria | 4014 |
| 164 | Ga0157372_10077786 | 3300013307 | Bacteria | 3748 |
| 165 | Ga0157372_10129916 | 3300013307 | Bacteria | 2898 |
| 166 | Ga0157372_10230953 | 3300013307 | Bacteria | 2145 |
| 167 | Ga0157375_10136949 | 3300013308 | Bacteria | 2573 |
| 168 | Ga0157375_11524266 | 3300013308 | Bacteria | 789 |
| 169 | Ga0163163_10217014 | 3300014325 | Bacteria | 1962 |
| 170 | Ga0157380_10307727 | 3300014326 | Bacteria | 1463 |
| 171 | Ga0157380_10620735 | 3300014326 | Bacteria | 1073 |
| 172 | Ga0157376_10359810 | 3300014969 | Bacteria | 1395 |
| 173 | Ga0197907_10828823 | 3300020069 | Unclassified | 533 |
| 174 | Ga0197907_10925693 | 3300020069 | Bacteria | 1032 |
| 175 | Ga0206356_10367634 | 3300020070 | Bacteria | 1340 |
| 176 | Ga0206356_10644722 | 3300020070 | Bacteria | 2095 |
| 177 | Ga0206356_11443052 | 3300020070 | Bacteria | 716 |
| 178 | Ga0206356_11558854 | 3300020070 | Bacteria | 2182 |
| 179 | Ga0206351_10791902 | 3300020077 | Bacteria | 653 |
| 180 | Ga0206354_10020652 | 3300020081 | Bacteria | 709 |
| 181 | Ga0206354_10355337 | 3300020081 | Bacteria | 1015 |
| 182 | Ga0206354_10387144 | 3300020081 | Bacteria | 884 |
| 183 | Ga0206354_10441572 | 3300020081 | Bacteria | 1891 |
| 184 | Ga0206354_10860937 | 3300020081 | Bacteria | 1174 |
| 185 | Ga0206354_11274995 | 3300020081 | Bacteria | 1967 |
| 186 | Ga0206354_11623010 | 3300020081 | Unclassified | 542 |
| 187 | Ga0206353_10775784 | 3300020082 | Bacteria | 3670 |
| 188 | Ga0206353_10981536 | 3300020082 | Bacteria | 6187 |
| 189 | Ga0206353_11050138 | 3300020082 | Bacteria | 669 |
| 190 | Ga0206353_11336883 | 3300020082 | Bacteria | 6791 |
| 191 | Ga0206353_11609119 | 3300020082 | Bacteria | 1426 |
| 192 | Ga0206353_11723450 | 3300020082 | Unclassified | 609 |
| 193 | Ga0206353_11959621 | 3300020082 | Bacteria | 1272 |
| 194 | Ga0213876_10254791 | 3300021384 | Bacteria | 933 |
| 195 | Ga0224712_10320429 | 3300022467 | Unclassified | 728 |
| 196 | Ga0224712_10420060 | 3300022467 | Bacteria | 639 |
| 197 | Ga0207656_10458163 | 3300025321 | Bacteria | 645 |
| 198 | Ga0207692_10104529 | 3300025898 | Bacteria | 1561 |
| 199 | Ga0207647_10105700 | 3300025904 | Bacteria | 1667 |
| 200 | Ga0207699_10041977 | 3300025906 | Bacteria | 2646 |
| 201 | Ga0207699_10232202 | 3300025906 | Bacteria | 1264 |
| 202 | Ga0207699_10500394 | 3300025906 | Bacteria | 877 |
| 203 | Ga0207643_10927846 | 3300025908 | Unclassified | 564 |
| 204 | Ga0207705_10070929 | 3300025909 | Bacteria | 2525 |
| 205 | Ga0207705_10272680 | 3300025909 | Bacteria | 1294 |
| 206 | Ga0207705_10346284 | 3300025909 | Bacteria | 1144 |
| 207 | Ga0207654_10665169 | 3300025911 | Bacteria | 747 |
| 208 | Ga0207707_10001956 | 3300025912 | Bacteria | 18739 |
| 209 | Ga0207707_10168400 | 3300025912 | Bacteria | 1914 |
| 210 | Ga0207707_10170302 | 3300025912 | Bacteria | 1903 |
| 211 | Ga0207707_10509876 | 3300025912 | Bacteria | 1025 |
| 212 | Ga0207695_10036630 | 3300025913 | Bacteria | 5301 |
| 213 | Ga0207695_10111302 | 3300025913 | Bacteria | 2717 |
| 214 | Ga0207695_10415589 | 3300025913 | Bacteria | 1229 |
| 215 | Ga0207695_10682519 | 3300025913 | Bacteria | 908 |
| 216 | Ga0207671_10027150 | 3300025914 | Bacteria | 4281 |
| 217 | Ga0207693_10089991 | 3300025915 | Bacteria | 2405 |
| 218 | Ga0207693_10513534 | 3300025915 | Unclassified | 935 |
| 219 | Ga0207663_10166186 | 3300025916 | Bacteria | 1563 |
| 220 | Ga0207663_10204918 | 3300025916 | Bacteria | 1425 |
| 221 | Ga0207663_10319794 | 3300025916 | Bacteria | 1166 |
| 222 | Ga0207663_10535627 | 3300025916 | Bacteria | 914 |
| 223 | Ga0207660_10030829 | 3300025917 | Bacteria | 3687 |
| 224 | Ga0207660_10094783 | 3300025917 | Bacteria | 2219 |
| 225 | Ga0207660_10110816 | 3300025917 | Bacteria | 2065 |
| 226 | Ga0207660_10183114 | 3300025917 | Bacteria | 1628 |
| 227 | Ga0207657_10000220 | 3300025919 | Bacteria | 59453 |
| 228 | Ga0207657_10056045 | 3300025919 | Bacteria | 3402 |
| 229 | Ga0207657_10061260 | 3300025919 | Bacteria | 3227 |
| 230 | Ga0207657_10083617 | 3300025919 | Bacteria | 2677 |
| 231 | Ga0207657_10343535 | 3300025919 | Bacteria | 1178 |
| 232 | Ga0207657_10586031 | 3300025919 | Bacteria | 871 |
| 233 | Ga0207657_11475117 | 3300025919 | Bacteria | 509 |
| 234 | Ga0207649_10173841 | 3300025920 | Bacteria | 1502 |
| 235 | Ga0207649_10306511 | 3300025920 | Bacteria | 1163 |
| 236 | Ga0207649_10397835 | 3300025920 | Bacteria | 1030 |
| 237 | Ga0207649_10933626 | 3300025920 | Unclassified | 681 |
| 238 | Ga0207652_10012636 | 3300025921 | Bacteria | 6826 |
| 239 | Ga0207652_10056518 | 3300025921 | Bacteria | 3378 |
| 240 | Ga0207652_10156381 | 3300025921 | Bacteria | 2042 |
| 241 | Ga0207652_10280414 | 3300025921 | Bacteria | 1503 |
| 242 | Ga0207652_10348921 | 3300025921 | Bacteria | 1336 |
| 243 | Ga0207652_10388648 | 3300025921 | Bacteria | 1259 |
| 244 | Ga0207652_11219970 | 3300025921 | Unclassified | 654 |
| 245 | Ga0207652_11344398 | 3300025921 | Bacteria | 617 |
| 246 | Ga0207681_11042264 | 3300025923 | Bacteria | 687 |
| 247 | Ga0207694_10047159 | 3300025924 | Bacteria | 3332 |
| 248 | Ga0207694_11663905 | 3300025924 | Unclassified | 537 |
| 249 | Ga0207687_10267793 | 3300025927 | Bacteria | 1364 |
| 250 | Ga0207700_10224510 | 3300025928 | Bacteria | 1594 |
| 251 | Ga0207700_10491745 | 3300025928 | Unclassified | 1085 |
| 252 | Ga0207664_10146937 | 3300025929 | Bacteria | 2000 |
| 253 | Ga0207664_10758357 | 3300025929 | Bacteria | 873 |
| 254 | Ga0207664_11061814 | 3300025929 | Bacteria | 725 |
| 255 | Ga0207664_11118044 | 3300025929 | Bacteria | 704 |
| 256 | Ga0207664_11609231 | 3300025929 | Bacteria | 572 |
| 257 | Ga0207644_10081765 | 3300025931 | Bacteria | 2388 |
| 258 | Ga0207644_10447874 | 3300025931 | Bacteria | 1060 |
| 259 | Ga0207690_10094288 | 3300025932 | Bacteria | 2123 |
| 260 | Ga0207690_10128248 | 3300025932 | Bacteria | 1853 |
| 261 | Ga0207686_10252027 | 3300025934 | Bacteria | 1290 |
| 262 | Ga0207704_10193996 | 3300025938 | Unclassified | 1480 |
| 263 | Ga0207665_10960027 | 3300025939 | Unclassified | 679 |
| 264 | Ga0207691_10482686 | 3300025940 | Bacteria | 1053 |
| 265 | Ga0207711_10406378 | 3300025941 | Bacteria | 1265 |
| 266 | Ga0207661_10017963 | 3300025944 | Bacteria | 5248 |
| 267 | Ga0207661_10255428 | 3300025944 | Bacteria | 1559 |
| 268 | Ga0207661_10757252 | 3300025944 | Bacteria | 894 |
| 269 | Ga0207661_11003736 | 3300025944 | Bacteria | 769 |
| 270 | Ga0207679_10617294 | 3300025945 | Bacteria | 978 |
| 271 | Ga0207679_11149849 | 3300025945 | Bacteria | 712 |
| 272 | Ga0207667_10061300 | 3300025949 | Bacteria | 3935 |
| 273 | Ga0207667_10284234 | 3300025949 | Bacteria | 1690 |
| 274 | Ga0207667_10344832 | 3300025949 | Bacteria | 1519 |
| 275 | Ga0207667_10717908 | 3300025949 | Bacteria | 1001 |
| 276 | Ga0207667_10875173 | 3300025949 | Bacteria | 891 |
| 277 | Ga0207667_11323390 | 3300025949 | Bacteria | 696 |
| 278 | Ga0207667_11835405 | 3300025949 | Bacteria | 570 |
| 279 | Ga0207640_10236986 | 3300025981 | Bacteria | 1407 |
| 280 | Ga0207640_10368631 | 3300025981 | Bacteria | 1160 |
| 281 | Ga0207640_10445581 | 3300025981 | Unclassified | 1066 |
| 282 | Ga0207658_10007817 | 3300025986 | Bacteria | 7283 |
| 283 | Ga0207639_10609637 | 3300026041 | Bacteria | 1007 |
| 284 | Ga0207678_10084031 | 3300026067 | Bacteria | 2723 |
| 285 | Ga0207678_10308895 | 3300026067 | Bacteria | 1359 |
| 286 | Ga0207678_10744836 | 3300026067 | Bacteria | 864 |
| 287 | Ga0207678_11006654 | 3300026067 | Bacteria | 737 |
| 288 | Ga0207702_10082070 | 3300026078 | Bacteria | 2802 |
| 289 | Ga0207702_10310164 | 3300026078 | Bacteria | 1500 |
| 290 | Ga0207702_10737920 | 3300026078 | Bacteria | 972 |
| 291 | Ga0207702_10954302 | 3300026078 | Bacteria | 850 |
| 292 | Ga0207702_12114056 | 3300026078 | Bacteria | 553 |
| 293 | Ga0207648_10056371 | 3300026089 | Bacteria | 3430 |
| 294 | Ga0207674_10011922 | 3300026116 | Bacteria | 9746 |
| 295 | Ga0207674_10029793 | 3300026116 | Bacteria | 5743 |
| 296 | Ga0207683_10016644 | 3300026121 | Bacteria | 6257 |
| 297 | Ga0207683_10091988 | 3300026121 | Bacteria | 2703 |
| 298 | Ga0207683_11031695 | 3300026121 | Bacteria | 763 |
| 299 | Ga0207698_10111696 | 3300026142 | Bacteria | 2292 |
| 300 | Ga0207698_10114054 | 3300026142 | Bacteria | 2272 |
| 301 | Ga0207698_10225936 | 3300026142 | Bacteria | 1696 |
| 302 | Ga0207698_10648492 | 3300026142 | Bacteria | 1046 |
| 303 | Ga0207698_11601227 | 3300026142 | Unclassified | 667 |
| 304 | Ga0268266_11020342 | 3300028379 | Bacteria | 800 |
| 305 | Ga0265337_1222032 | 3300028556 | Bacteria | 514 |
| 306 | Ga0265326_10041535 | 3300028558 | Bacteria | 1306 |
| 307 | Ga0265334_10088002 | 3300028573 | Bacteria | 1137 |
| 308 | Ga0265323_10167638 | 3300028653 | Bacteria | 699 |
| 309 | Ga0265322_10025500 | 3300028654 | Bacteria | 1690 |
| 310 | Ga0265336_10080005 | 3300028666 | Bacteria | 975 |
| 311 | Ga0265336_10084801 | 3300028666 | Bacteria | 945 |
| 312 | Ga0265338_10013496 | 3300028800 | Bacteria | 9213 |
| 313 | Ga0265338_10279433 | 3300028800 | Bacteria | 1220 |
| 314 | Ga0265324_10062743 | 3300029957 | Bacteria | 1269 |
| 315 | Ga0265330_10259994 | 3300031235 | Bacteria | 731 |
| 316 | Ga0265328_10040032 | 3300031239 | Bacteria | 1728 |
| 317 | Ga0265325_10033910 | 3300031241 | Bacteria | 2720 |
| 318 | Ga0265329_10085000 | 3300031242 | Bacteria | 1002 |
| 319 | Ga0265340_10055866 | 3300031247 | Bacteria | 1900 |
| 320 | Ga0265339_10034571 | 3300031249 | Bacteria | 2839 |
| 321 | Ga0265327_10010427 | 3300031251 | Bacteria | 6540 |
| 322 | Ga0265327_10030692 | 3300031251 | Bacteria | 3033 |
| 323 | Ga0265327_10039560 | 3300031251 | Bacteria | 2560 |
| 324 | Ga0265327_10108141 | 3300031251 | Bacteria | 1332 |
| 325 | Ga0265316_10014198 | 3300031344 | Bacteria | 7026 |
| 326 | Ga0265313_10020675 | 3300031595 | Bacteria | 3623 |
| 327 | Ga0265314_10011486 | 3300031711 | Bacteria | 7305 |
| 328 | Ga0265342_10154578 | 3300031712 | Bacteria | 1272 |
| 329 | Ga0373926_0269602 | 3300035083 | Bacteria | 662 |
| 330 | Ga0373944_0000694 | 3300035089 | Bacteria | 8109 |
| 331 | Ga0373945_0052814 | 3300035116 | Bacteria | 1498 |
| 332 | Ga0373953_0012180 | 3300035117 | Bacteria | 3040 |
| 333 | Ga0373954_0091927 | 3300035118 | Bacteria | 1458 |
| 334 | Ga0373956_0033174 | 3300035119 | Bacteria | 2269 |
| 335 | Ga0373943_0000954 | 3300035170 | Bacteria | 12814 |
| 336 | Ga0373955_0031410 | 3300035172 | Bacteria | 2782 |
| 337 | Ga0373931_0237316 | 3300035691 | Bacteria | 1104 |
| 338 | Ga0373935_0011825 | 3300035692 | Bacteria | 5244 |
| 339 | Ga0373927_0190435 | 3300035695 | Bacteria | 1346 |
| 340 | Ga0373933_0020346 | 3300035724 | Bacteria | 3762 |
| 341 | Ga0373947_0017804 | 3300035725 | Bacteria | 4087 |
| 342 | Ga0373937_0278782 | 3300036401 | Bacteria | 1578 |
| 343 | Ga0373937_0562468 | 3300036401 | Bacteria | 1083 |
| 344 | Ga0373937_0645769 | 3300036401 | Bacteria | 1004 |
| 345 | Ga0373925_0117687 | 3300037068 | Bacteria | 2059 |
| 346 | Ga0395899_0011394 | 3300037312 | Bacteria | 6809 |
| 347 | Ga0395899_0022160 | 3300037312 | Bacteria | 4817 |
| 348 | Ga0395899_0060613 | 3300037312 | Bacteria | 2788 |
| 349 | Ga0395899_0258991 | 3300037312 | Bacteria | 1191 |
| 350 | Ga0395899_0383827 | 3300037312 | Bacteria | 933 |
| 351 | Ga0395899_0728740 | 3300037312 | Bacteria | 619 |
| 352 | Ga0395899_0735413 | 3300037312 | Bacteria | 615 |
| 353 | Ga0395899_0800453 | 3300037312 | Unclassified | 582 |
| 354 | Ga0395900_0006939 | 3300037418 | Bacteria | 11750 |
| 355 | Ga0395900_0011512 | 3300037418 | Bacteria | 9055 |
| 356 | Ga0395900_0114597 | 3300037418 | Bacteria | 2766 |
| 357 | Ga0395900_0180740 | 3300037418 | Bacteria | 2144 |
| 358 | Ga0395900_0398018 | 3300037418 | Bacteria | 1342 |
| 359 | Ga0395900_0620053 | 3300037418 | Bacteria | 1020 |
| 360 | Ga0395900_0658629 | 3300037418 | Bacteria | 983 |
| 361 | Ga0395900_1927998 | 3300037418 | Unclassified | 501 |
| 362 | Ga0395898_0006161 | 3300037466 | Bacteria | 12843 |
| 363 | Ga0395898_0022696 | 3300037466 | Bacteria | 6352 |
| 364 | Ga0395898_0077425 | 3300037466 | Bacteria | 3211 |
| 365 | Ga0395898_0251044 | 3300037466 | Bacteria | 1687 |
| 366 | Ga0395898_0320035 | 3300037466 | Unclassified | 1480 |
| 367 | Ga0395898_0871872 | 3300037466 | Bacteria | 839 |
| 368 | Ga0395905_0052908 | 3300037471 | Bacteria | 3801 |
| 369 | Ga0395905_0110546 | 3300037471 | Bacteria | 2581 |
| 370 | Ga0395905_0139055 | 3300037471 | Bacteria | 2285 |
| 371 | Ga0395905_0202038 | 3300037471 | Bacteria | 1863 |
| 372 | Ga0395905_0590578 | 3300037471 | Unclassified | 1012 |
| 373 | Ga0395905_0967600 | 3300037471 | Bacteria | 754 |
| 374 | Ga0395905_1677116 | 3300037471 | Unclassified | 541 |
| 375 | Ga0436364_0565611 | 3300037853 | Bacteria | 881 |
| 376 | Ga0395901_0007265 | 3300038443 | Bacteria | 11181 |
| 377 | Ga0395901_0008378 | 3300038443 | Bacteria | 10454 |
| 378 | Ga0395901_0017667 | 3300038443 | Bacteria | 7281 |
| 379 | Ga0395901_0092126 | 3300038443 | Bacteria | 3173 |
| 380 | Ga0395901_0109363 | 3300038443 | Bacteria | 2902 |
| 381 | Ga0395901_0137964 | 3300038443 | Bacteria | 2563 |
| 382 | Ga0395901_0240664 | 3300038443 | Bacteria | 1887 |
| 383 | Ga0395901_0643718 | 3300038443 | Bacteria | 1064 |
| 384 | Ga0395901_0677716 | 3300038443 | Unclassified | 1031 |
| 385 | Ga0395901_1918111 | 3300038443 | Unclassified | 540 |
| 386 | Ga0395901_1935210 | 3300038443 | Unclassified | 537 |
| 387 | Ga0436365_1540994 | 3300039437 | Bacteria | 3608 |
| 388 | Ga0436365_1753612 | 3300039437 | Bacteria | 928 |
| 389 | Ga0436363_1268980 | 3300039450 | Bacteria | 1358 |
| 390 | Ga0439461_0007131 | 3300041410 | Bacteria | 1969 |
| 391 | Ga0439466_0100840 | 3300041411 | Bacteria | 900 |
| 392 | Ga0451835_0477936 | 3300041492 | Bacteria | 634 |
| 393 | Ga0439454_046920 | 3300042011 | Unclassified | 721 |
| 394 | Ga0439446_0008559 | 3300042156 | Bacteria | 2722 |
| 395 | Ga0439446_0092060 | 3300042156 | Bacteria | 950 |
| 396 | Ga0466972_0130053 | 3300044658 | Bacteria | 1186 |
| 397 | Ga0466965_0614838 | 3300044683 | Bacteria | 618 |
| 398 | Ga0466966_0050586 | 3300044684 | Bacteria | 2643 |
| 399 | Ga0466966_0050634 | 3300044684 | Bacteria | 2641 |
| 400 | Ga0466966_0057872 | 3300044684 | Bacteria | 2451 |
| 401 | Ga0466966_0081346 | 3300044684 | Bacteria | 2017 |
| 402 | Ga0466966_0144968 | 3300044684 | Bacteria | 1450 |
| 403 | Ga0466966_0145409 | 3300044684 | Bacteria | 1447 |
| 404 | Ga0466961_0017176 | 3300044693 | Bacteria | 4648 |
| 405 | Ga0466961_0044813 | 3300044693 | Bacteria | 2830 |
| 406 | Ga0466961_0221393 | 3300044693 | Bacteria | 1166 |
| 407 | Ga0466961_0508807 | 3300044693 | Bacteria | 727 |
| 408 | Ga0466961_0684842 | 3300044693 | Bacteria | 614 |
| 409 | Ga0466963_0015475 | 3300044694 | Bacteria | 4725 |
| 410 | Ga0466963_0020158 | 3300044694 | Bacteria | 4191 |
| 411 | Ga0466963_0034222 | 3300044694 | Bacteria | 3305 |
| 412 | Ga0466963_0036761 | 3300044694 | Bacteria | 3194 |
| 413 | Ga0466963_0038657 | 3300044694 | Bacteria | 3122 |
| 414 | Ga0466963_0051318 | 3300044694 | Bacteria | 2734 |
| 415 | Ga0466963_0174460 | 3300044694 | Bacteria | 1499 |
| 416 | Ga0466963_0189081 | 3300044694 | Bacteria | 1438 |
| 417 | Ga0466964_0012104 | 3300044706 | Bacteria | 3264 |
| 418 | Ga0466964_0032648 | 3300044706 | Bacteria | 2069 |
| 419 | Ga0466964_0488256 | 3300044706 | Unclassified | 659 |
| 420 | Ga0466964_0729786 | 3300044706 | Bacteria | 554 |
| 421 | Ga0466971_0006866 | 3300044719 | Bacteria | 4952 |
| 422 | Ga0466971_0013604 | 3300044719 | Bacteria | 3575 |
| 423 | Ga0466971_0067989 | 3300044719 | Bacteria | 1615 |
| 424 | Ga0466968_0008104 | 3300044735 | Bacteria | 4018 |
| 425 | Ga0466968_0048640 | 3300044735 | Bacteria | 1805 |
| 426 | Ga0466968_0069979 | 3300044735 | Bacteria | 1526 |
| 427 | Ga0466970_0022273 | 3300044765 | Bacteria | 3307 |
| 428 | Ga0466970_0062116 | 3300044765 | Bacteria | 2002 |
| 429 | Ga0466957_0038281 | 3300044842 | Bacteria | 2889 |
| 430 | Ga0466957_0136290 | 3300044842 | Bacteria | 1578 |
| 431 | Ga0466957_0163291 | 3300044842 | Bacteria | 1447 |
| 432 | Ga0466957_0888503 | 3300044842 | Bacteria | 636 |
| 433 | Ga0466957_0909579 | 3300044842 | Unclassified | 629 |
| 434 | Ga0466959_0009357 | 3300045049 | Bacteria | 6963 |
| 435 | Ga0466959_0025567 | 3300045049 | Bacteria | 4377 |
| 436 | Ga0466959_0048685 | 3300045049 | Bacteria | 3115 |
| 437 | Ga0466958_0001800 | 3300045836 | Bacteria | 10404 |
| 438 | Ga0466958_0008405 | 3300045836 | Bacteria | 5724 |
| 439 | Ga0466958_0194265 | 3300045836 | Bacteria | 1290 |
| 440 | Ga0466958_0237169 | 3300045836 | Bacteria | 1165 |
| 441 | Ga0466967_0007679 | 3300045976 | Bacteria | 7810 |
| 442 | Ga0466967_0023263 | 3300045976 | Bacteria | 5074 |
| 443 | Ga0466967_0037883 | 3300045976 | Bacteria | 4131 |
| 444 | Ga0466967_0048332 | 3300045976 | Bacteria | 3714 |
| 445 | Ga0466967_0062495 | 3300045976 | Bacteria | 3306 |
| 446 | Ga0466967_0087048 | 3300045976 | Bacteria | 2831 |
| 447 | Ga0466967_0135268 | 3300045976 | Bacteria | 2292 |
| 448 | Ga0466967_0149149 | 3300045976 | Bacteria | 2184 |
| 449 | Ga0466967_0194372 | 3300045976 | Bacteria | 1919 |
| 450 | Ga0466967_0252634 | 3300045976 | Bacteria | 1684 |
| 451 | Ga0466967_0276514 | 3300045976 | Bacteria | 1610 |
| 452 | Ga0466967_0575121 | 3300045976 | Bacteria | 1110 |
| 453 | Ga0466967_0618827 | 3300045976 | Bacteria | 1069 |
| 454 | Ga0466967_0640582 | 3300045976 | Bacteria | 1050 |
| 455 | Ga0466967_0763902 | 3300045976 | Bacteria | 959 |
| 456 | Ga0466967_0829910 | 3300045976 | Bacteria | 918 |
| 457 | Ga0466967_0883998 | 3300045976 | Bacteria | 888 |
| 458 | Ga0495592_0055440 | 3300046454 | Bacteria | 2933 |
| 459 | Ga0495592_0159031 | 3300046454 | Bacteria | 1556 |
| 460 | Ga0495592_0197396 | 3300046454 | Bacteria | 1360 |
| 461 | Ga0495592_0230428 | 3300046454 | Unclassified | 1233 |
| 462 | Ga0495603_0256487 | 3300046455 | Bacteria | 1007 |
| 463 | Ga0495629_0000259 | 3300046459 | Bacteria | 46161 |
| 464 | Ga0495641_0000681 | 3300046461 | Bacteria | 28646 |
| 465 | Ga0495641_0185021 | 3300046461 | Bacteria | 933 |
| 466 | Ga0495641_0295915 | 3300046461 | Bacteria | 729 |
| 467 | Ga0495651_0020411 | 3300046462 | Bacteria | 5144 |
| 468 | Ga0495651_0048870 | 3300046462 | Bacteria | 3266 |
| 469 | Ga0495651_0374259 | 3300046462 | Bacteria | 935 |
| 470 | Ga0495651_0504747 | 3300046462 | Unclassified | 774 |
| 471 | Ga0495653_0023210 | 3300046463 | Bacteria | 5016 |
| 472 | Ga0495653_0042433 | 3300046463 | Bacteria | 3543 |
| 473 | Ga0495653_0166844 | 3300046463 | Bacteria | 1523 |
| 474 | Ga0495580_0137088 | 3300046472 | Bacteria | 1697 |
| 475 | Ga0495580_0533573 | 3300046472 | Bacteria | 781 |
| 476 | Ga0495582_0006753 | 3300046473 | Bacteria | 6382 |
| 477 | Ga0495582_0202765 | 3300046473 | Bacteria | 1133 |
| 478 | Ga0495605_0225918 | 3300046474 | Bacteria | 808 |
| 479 | Ga0495639_0408821 | 3300046475 | Bacteria | 686 |
| 480 | Ga0495662_0001214 | 3300046476 | Bacteria | 12678 |
| 481 | Ga0495662_0013919 | 3300046476 | Bacteria | 3916 |
| 482 | Ga0495662_0146222 | 3300046476 | Bacteria | 1164 |
| 483 | Ga0495664_0048015 | 3300046477 | Bacteria | 2534 |
| 484 | Ga0495584_0147355 | 3300046491 | Bacteria | 1196 |
| 485 | Ga0495585_0155551 | 3300046492 | Bacteria | 1190 |
| 486 | Ga0495596_0053386 | 3300046500 | Bacteria | 1581 |
| 487 | Ga0495607_0349564 | 3300046501 | Unclassified | 683 |
| 488 | Ga0495608_0003273 | 3300046511 | Bacteria | 11571 |
| 489 | Ga0495608_0009426 | 3300046511 | Bacteria | 6825 |
| 490 | Ga0495608_0079773 | 3300046511 | Bacteria | 2128 |
| 491 | Ga0495608_0141095 | 3300046511 | Bacteria | 1538 |
| 492 | Ga0495608_0381208 | 3300046511 | Bacteria | 864 |
| 493 | Ga0495618_0031447 | 3300046514 | Bacteria | 3320 |
| 494 | Ga0495618_0269776 | 3300046514 | Bacteria | 1064 |
| 495 | Ga0495628_0137248 | 3300046516 | Bacteria | 1868 |
| 496 | Ga0495628_0166019 | 3300046516 | Bacteria | 1676 |
| 497 | Ga0495630_0002573 | 3300046517 | Bacteria | 12569 |
| 498 | Ga0495630_0009303 | 3300046517 | Bacteria | 7065 |
| 499 | Ga0495630_0014315 | 3300046517 | Bacteria | 5777 |
| 500 | Ga0495632_0235397 | 3300046519 | Bacteria | 825 |
| 501 | Ga0495637_0218981 | 3300046520 | Unclassified | 694 |
| 502 | Ga0495644_0212867 | 3300046523 | Bacteria | 746 |
| 503 | Ga0495666_0021375 | 3300046526 | Bacteria | 3203 |
| 504 | Ga0495652_0031625 | 3300046529 | Bacteria | 4633 |
| 505 | Ga0495652_0102423 | 3300046529 | Bacteria | 2320 |
| 506 | Ga0495652_0139379 | 3300046529 | Bacteria | 1909 |
| 507 | Ga0495652_0166179 | 3300046529 | Bacteria | 1707 |
| 508 | Ga0495652_0196370 | 3300046529 | Bacteria | 1535 |
| 509 | Ga0495665_0004742 | 3300046531 | Bacteria | 7342 |
| 510 | Ga0495665_0689114 | 3300046531 | Unclassified | 507 |
| 511 | Ga0495640_0025285 | 3300046533 | Bacteria | 4309 |
| 512 | Ga0495640_0045699 | 3300046533 | Bacteria | 3038 |
| 513 | Ga0495640_0087371 | 3300046533 | Bacteria | 2062 |
| 514 | Ga0495640_0195139 | 3300046533 | Bacteria | 1286 |
| 515 | Ga0495640_0367292 | 3300046533 | Unclassified | 886 |
| 516 | Ga0495586_0148808 | 3300046535 | Bacteria | 1317 |
| 517 | Ga0495587_0127203 | 3300046536 | Bacteria | 1457 |
| 518 | Ga0495587_0192552 | 3300046536 | Bacteria | 1154 |
| 519 | Ga0495587_0434220 | 3300046536 | Bacteria | 728 |
| 520 | Ga0495598_0043185 | 3300046537 | Bacteria | 1327 |
| 521 | Ga0495645_0162483 | 3300046543 | Bacteria | 1543 |
| 522 | Ga0495645_0198642 | 3300046543 | Bacteria | 1362 |
| 523 | Ga0495633_0589764 | 3300046558 | Bacteria | 500 |
| 524 | Ga0495667_0006790 | 3300046559 | Bacteria | 7766 |
| 525 | Ga0495667_0019860 | 3300046559 | Bacteria | 4534 |
| 526 | Ga0495667_0029954 | 3300046559 | Bacteria | 3660 |
| 527 | Ga0495667_0039046 | 3300046559 | Bacteria | 3159 |
| 528 | Ga0495667_0727502 | 3300046559 | Bacteria | 614 |
| 529 | Ga0495656_0034293 | 3300046615 | Bacteria | 2077 |
| 530 | Ga0495668_0074513 | 3300046616 | Bacteria | 1864 |
| 531 | Ga0495668_0200106 | 3300046616 | Bacteria | 1094 |
| 532 | Ga0495634_0016166 | 3300046642 | Bacteria | 5341 |
| 533 | Ga0495634_0025808 | 3300046642 | Bacteria | 4104 |
| 534 | Ga0495634_0088139 | 3300046642 | Bacteria | 2019 |
| 535 | Ga0495634_0172925 | 3300046642 | Bacteria | 1356 |
| 536 | Ga0495635_0001587 | 3300046663 | Bacteria | 15288 |
| 537 | Ga0495635_0065764 | 3300046663 | Bacteria | 2487 |
| 538 | Ga0495635_0099121 | 3300046663 | Bacteria | 1991 |
| 539 | Ga0495635_0222026 | 3300046663 | Bacteria | 1278 |
| 540 | Ga0495635_0562513 | 3300046663 | Unclassified | 747 |
| 541 | Ga0495657_0063718 | 3300046675 | Bacteria | 2431 |
| 542 | Ga0495599_0076027 | 3300046678 | Bacteria | 2097 |
| 543 | Ga0495599_0137091 | 3300046678 | Bacteria | 1519 |
| 544 | Ga0495623_0036216 | 3300046679 | Bacteria | 3162 |
| 545 | Ga0495646_0024234 | 3300046680 | Bacteria | 3822 |
| 546 | Ga0495646_0039081 | 3300046680 | Bacteria | 2927 |
| 547 | Ga0495658_0000432 | 3300046683 | Bacteria | 23385 |
| 548 | Ga0495658_0659525 | 3300046683 | Bacteria | 670 |
| 549 | Ga0495658_0708183 | 3300046683 | Bacteria | 645 |
| 550 | Ga0495613_0001501 | 3300046689 | Bacteria | 17766 |
| 551 | Ga0495624_0006409 | 3300046690 | Bacteria | 8350 |
| 552 | Ga0495624_0108825 | 3300046690 | Bacteria | 1705 |
| 553 | Ga0495624_0443544 | 3300046690 | Unclassified | 778 |
| 554 | Ga0495670_0257132 | 3300046691 | Bacteria | 932 |
| 555 | Ga0495671_0549568 | 3300046692 | Unclassified | 550 |
| 556 | Ga0495600_0017380 | 3300046809 | Bacteria | 4575 |
| 557 | Ga0495600_0150214 | 3300046809 | Bacteria | 1509 |
| 558 | Ga0495581_0002893 | 3300047315 | Bacteria | 9823 |
| 559 | Ga0495604_0084370 | 3300047317 | Bacteria | 2372 |
| 560 | Ga0495604_0271980 | 3300047317 | Unclassified | 1147 |
| 561 | Ga0495604_0553296 | 3300047317 | Unclassified | 742 |
| 562 | Ga0495636_0547127 | 3300047318 | Unclassified | 563 |
| 563 | Ga0495674_0017538 | 3300047319 | Bacteria | 6663 |
| 564 | Ga0495674_0024514 | 3300047319 | Bacteria | 5541 |
| 565 | Ga0495674_0099879 | 3300047319 | Bacteria | 2470 |
| 566 | Ga0495674_0613873 | 3300047319 | Unclassified | 860 |
| 567 | Ga0495676_0001661 | 3300047321 | Bacteria | 19426 |
| 568 | Ga0495676_0395159 | 3300047321 | Bacteria | 918 |
| 569 | Ga0495676_0673162 | 3300047321 | Bacteria | 671 |
| 570 | Ga0495680_0005472 | 3300047322 | Bacteria | 11942 |
| 571 | Ga0495680_0005808 | 3300047322 | Bacteria | 11550 |
| 572 | Ga0495680_0017187 | 3300047322 | Bacteria | 6187 |
| 573 | Ga0495680_0030697 | 3300047322 | Bacteria | 4384 |
| 574 | Ga0495675_0031268 | 3300047444 | Bacteria | 3398 |
| 575 | Ga0495684_0000907 | 3300047471 | Bacteria | 24057 |
| 576 | Ga0495684_0017012 | 3300047471 | Bacteria | 5602 |
| 577 | Ga0495684_0039162 | 3300047471 | Bacteria | 3634 |
| 578 | Ga0495684_0074299 | 3300047471 | Bacteria | 2583 |
| 579 | Ga0495684_0231067 | 3300047471 | Bacteria | 1353 |
| 580 | Ga0495593_0001102 | 3300047673 | Bacteria | 15762 |
| 581 | Ga0495602_0050219 | 3300048088 | Bacteria | 3729 |
| 582 | Ga0495602_0119566 | 3300048088 | Bacteria | 2122 |
| 583 | Ga0495602_0382985 | 3300048088 | Bacteria | 1007 |
| 584 | Ga0495602_0615621 | 3300048088 | Bacteria | 745 |
| 585 | Ga0495602_0796541 | 3300048088 | Bacteria | 635 |
| 586 | Ga0495602_1001846 | 3300048088 | Unclassified | 551 |
| 587 | Ga0495614_0016887 | 3300048089 | Bacteria | 3175 |
| 588 | Ga0495614_0081043 | 3300048089 | Bacteria | 1406 |
| 589 | Ga0496100_0044967 | 3300048903 | Bacteria | 2831 |
| 590 | Ga0496100_0625038 | 3300048903 | Bacteria | 837 |
| 591 | Ga0496100_0636869 | 3300048903 | Bacteria | 829 |
| 592 | Ga0496100_0862454 | 3300048903 | Unclassified | 710 |
| 593 | Ga0496100_1594010 | 3300048903 | Unclassified | 516 |
| 594 | Ga0496101_0007347 | 3300048904 | Bacteria | 7134 |
| 595 | Ga0496101_0008219 | 3300048904 | Bacteria | 6814 |
| 596 | Ga0496101_0018377 | 3300048904 | Bacteria | 4753 |
| 597 | Ga0496101_0225570 | 3300048904 | Bacteria | 1455 |
| 598 | Ga0496101_0832146 | 3300048904 | Bacteria | 728 |
| 599 | Ga0496102_0033064 | 3300048905 | Bacteria | 4646 |
| 600 | Ga0496102_0112978 | 3300048905 | Bacteria | 2534 |
| 601 | Ga0496102_1032918 | 3300048905 | Bacteria | 742 |
| 602 | Ga0496103_0069746 | 3300048906 | Bacteria | 2198 |
| 603 | Ga0496104_0013290 | 3300048907 | Bacteria | 7422 |
| 604 | Ga0496104_0352106 | 3300048907 | Bacteria | 1385 |
| 605 | Ga0496104_0426941 | 3300048907 | Bacteria | 1237 |
| 606 | Ga0496104_0431552 | 3300048907 | Bacteria | 1229 |
| 607 | Ga0496105_0025734 | 3300048908 | Bacteria | 4793 |
| 608 | Ga0496105_0494305 | 3300048908 | Bacteria | 961 |
| 609 | Ga0496106_0009519 | 3300048909 | Bacteria | 7177 |
| 610 | Ga0496106_0013305 | 3300048909 | Bacteria | 6073 |
| 611 | Ga0496106_0274491 | 3300048909 | Bacteria | 1350 |
| 612 | Ga0496106_0286390 | 3300048909 | Bacteria | 1320 |
| 613 | Ga0496107_0012911 | 3300048910 | Bacteria | 5838 |
| 614 | Ga0496107_0035291 | 3300048910 | Bacteria | 3585 |
| 615 | Ga0496107_0859305 | 3300048910 | Bacteria | 662 |
| 616 | Ga0496108_0006628 | 3300048911 | Bacteria | 9383 |
| 617 | Ga0496109_0016942 | 3300048912 | Bacteria | 6378 |
| 618 | Ga0496109_1067829 | 3300048912 | Bacteria | 745 |
| 619 | Ga0496109_1669821 | 3300048912 | Bacteria | 571 |
| 620 | Ga0496110_0021962 | 3300048913 | Bacteria | 5413 |
| 621 | Ga0496110_0092506 | 3300048913 | Bacteria | 2706 |
| 622 | Ga0496110_0235214 | 3300048913 | Bacteria | 1667 |
| 623 | Ga0496111_0026999 | 3300048914 | Bacteria | 4058 |
| 624 | Ga0496112_0001575 | 3300048915 | Bacteria | 17627 |
| 625 | Ga0496112_0091377 | 3300048915 | Bacteria | 3013 |
| 626 | Ga0496112_0131232 | 3300048915 | Bacteria | 2476 |
| 627 | Ga0496112_0203968 | 3300048915 | Bacteria | 1936 |
| 628 | Ga0496112_0783751 | 3300048915 | Bacteria | 878 |
| 629 | Ga0496113_0020646 | 3300048916 | Bacteria | 4636 |
| 630 | Ga0496113_1503174 | 3300048916 | Unclassified | 520 |
| 631 | Ga0496114_0004895 | 3300048917 | Bacteria | 10433 |
| 632 | Ga0496114_0011371 | 3300048917 | Bacteria | 7109 |
| 633 | Ga0496114_0018322 | 3300048917 | Bacteria | 5661 |
| 634 | Ga0496114_0022381 | 3300048917 | Bacteria | 5151 |
| 635 | Ga0496114_0185382 | 3300048917 | Bacteria | 1818 |
| 636 | Ga0496114_0491578 | 3300048917 | Unclassified | 1085 |
| 637 | Ga0496114_0552814 | 3300048917 | Bacteria | 1017 |
| 638 | Ga0496115_0000684 | 3300048918 | Bacteria | 25100 |
| 639 | Ga0496115_0066677 | 3300048918 | Bacteria | 2909 |
| 640 | Ga0496115_0184929 | 3300048918 | Bacteria | 1722 |
| 641 | Ga0496115_0343741 | 3300048918 | Unclassified | 1217 |
| 642 | Ga0496115_0507366 | 3300048918 | Bacteria | 968 |
| 643 | Ga0496115_0746957 | 3300048918 | Bacteria | 765 |
| 644 | Ga0496115_0852247 | 3300048918 | Unclassified | 706 |
| 645 | Ga0496115_1394006 | 3300048918 | Unclassified | 518 |
| 646 | Ga0501032_0935759 | 3300049569 | Bacteria | 545 |
| 647 | Ga0501034_0517975 | 3300049571 | Bacteria | 1105 |
| 648 | Ga0501038_1101042 | 3300049574 | Bacteria | 580 |
| 649 | Ga0501041_0899751 | 3300049577 | Archaea | 569 |
| 650 | Ga0501043_0192028 | 3300049579 | Bacteria | 1588 |
| 651 | Ga0501046_0775349 | 3300049580 | Bacteria | 673 |
| 652 | Ga0501047_0016462 | 3300049581 | Bacteria | 7059 |
| 653 | Ga0501047_0232970 | 3300049581 | Bacteria | 1694 |
| 654 | Ga0501047_0334352 | 3300049581 | Bacteria | 1353 |
| 655 | Ga0501067_0017656 | 3300049583 | Bacteria | 3950 |
| 656 | Ga0501067_0034813 | 3300049583 | Bacteria | 2796 |
| 657 | Ga0501069_0137178 | 3300049585 | Bacteria | 1402 |
| 658 | Ga0501069_0731577 | 3300049585 | Bacteria | 598 |
| 659 | Ga0501069_0817676 | 3300049585 | Unclassified | 565 |
| 660 | Ga0501070_0000830 | 3300049586 | Bacteria | 28091 |
| 661 | Ga0501070_0110869 | 3300049586 | Bacteria | 2268 |
| 662 | Ga0501070_0126501 | 3300049586 | Bacteria | 2112 |
| 663 | Ga0501070_0344743 | 3300049586 | Bacteria | 1210 |
| 664 | Ga0501070_0351950 | 3300049586 | Bacteria | 1195 |
| 665 | Ga0501070_0394710 | 3300049586 | Bacteria | 1119 |
| 666 | Ga0501074_0015244 | 3300049590 | Bacteria | 5585 |
| 667 | Ga0501074_0169038 | 3300049590 | Bacteria | 1561 |
| 668 | Ga0501074_0325225 | 3300049590 | Bacteria | 1092 |
| 669 | Ga0501080_0165453 | 3300049742 | Bacteria | 2041 |
| 670 | Ga0501080_0509535 | 3300049742 | Bacteria | 1075 |
| 671 | Ga0501044_0088022 | 3300049823 | Bacteria | 3136 |
| 672 | Ga0501044_0123712 | 3300049823 | Bacteria | 2585 |
| 673 | nmdc:mga0n895_55466_c1 | 3300050512 | Bacteria | 3900 |
| 674 | nmdc:mga0rr50_195984_c1 | 3300050513 | Bacteria | 1658 |
| 675 | nmdc:mga0a205_44833_c1 | 3300050515 | Bacteria | 979 |
| 676 | Ga0495601_0038051 | 3300053077 | Bacteria | 3007 |
| 677 | Ga0495601_0084108 | 3300053077 | Bacteria | 2044 |
| 678 | Ga0495601_0284267 | 3300053077 | Bacteria | 1078 |
| 679 | Ga0495601_0465424 | 3300053077 | Unclassified | 817 |
| 680 | Ga0495612_0092587 | 3300053078 | Bacteria | 1281 |
| 681 | Ga0495612_0405450 | 3300053078 | Bacteria | 620 |
| 682 | Ga0495655_0245753 | 3300053083 | Bacteria | 600 |
| 683 | Ga0495595_0009908 | 3300053084 | Bacteria | 3950 |
| 684 | Ga0495595_0028453 | 3300053084 | Bacteria | 2496 |
| 685 | Ga0495595_0069495 | 3300053084 | Bacteria | 1662 |
| 686 | Ga0495595_0132551 | 3300053084 | Bacteria | 1219 |
| 687 | Ga0495619_0002309 | 3300053085 | Bacteria | 12568 |
| 688 | Ga0495619_0003372 | 3300053085 | Bacteria | 10329 |
| 689 | Ga0495619_0014725 | 3300053085 | Bacteria | 4940 |
| 690 | Ga0466962_0000805 | 3300061719 | Bacteria | 14157 |
| 691 | Ga0466962_0010464 | 3300061719 | Bacteria | 4460 |
| 692 | Ga0207639_10834763 | |||
| 693 | Ga0070658_10005736 | |||
| 694 | Ga0070658_10076636 | |||
| 695 | Ga0070658_10195725 | |||
| 696 | Ga0070658_10389010 | |||
| 697 | Ga0070658_11050574 | |||
| 698 | Ga0070683_100006690 | |||
| 699 | Ga0070683_100038654 | |||
| 700 | Ga0070683_100163623 | |||
| 701 | Ga0070683_101329732 | |||
| 702 | Ga0070680_100146179 | |||
| 703 | Ga0070680_100224030 | |||
| 704 | Ga0070682_100034507 | |||
| 705 | Ga0070682_100338087 | |||
| 706 | Ga0070682_100403939 | |||
| 707 | Ga0070660_100038088 | |||
| 708 | Ga0070660_100117890 | |||
| 709 | Ga0070660_100322293 | |||
| 710 | Ga0070661_100017594 | |||
| 711 | Ga0070661_100018666 | |||
| 712 | Ga0070661_100052516 | |||
| 713 | Ga0070661_100246424 | |||
| 714 | Ga0070661_101530751 | |||
| 715 | Ga0070671_100093695 | |||
| 716 | Ga0070671_100631288 | |||
| 717 | Ga0070674_100018739 | |||
| 718 | Ga0070673_101063254 | |||
| 719 | Ga0070659_100096084 | |||
| 720 | Ga0070659_100183319 | |||
| 721 | Ga0070667_100011565 | |||
| 722 | Ga0070709_10116137 | |||
| 723 | Ga0070709_10431954 | |||
| 724 | Ga0070709_11525562 | |||
| 725 | Ga0070714_100201043 | |||
| 726 | Ga0070714_100462783 | |||
| 727 | Ga0070714_100692811 | |||
| 728 | Ga0070714_101578520 | |||
| 729 | Ga0070713_100141189 | |||
| 730 | Ga0070713_102225938 | |||
| 731 | Ga0070710_11346181 | |||
| 732 | Ga0070711_100101164 | |||
| 733 | Ga0070711_100225127 | |||
| 734 | Ga0070711_100452687 | |||
| 735 | Ga0070700_100100930 | |||
| 736 | Ga0070708_100033087 | |||
| 737 | Ga0070663_100022986 | |||
| 738 | Ga0070663_101038910 | |||
| 739 | Ga0070678_100009047 | |||
| 740 | Ga0070678_100066918 | |||
| 741 | Ga0070678_100825741 | |||
| 742 | Ga0070681_10000811 | |||
| 743 | Ga0070681_10018082 | |||
| 744 | Ga0070681_10025555 | |||
| 745 | Ga0070681_10084629 | |||
| 746 | Ga0070681_10211098 | |||
| 747 | Ga0070681_10835631 | |||
| 748 | Ga0070685_10899494 | |||
| 749 | Ga0070707_100671753 | |||
| 750 | Ga0070707_101356391 | |||
| 751 | Ga0070698_100446236 | |||
| 752 | Ga0070698_101363231 | |||
| 753 | Ga0070699_100212994 | |||
| 754 | Ga0070699_100557897 | |||
| 755 | Ga0070679_100018749 | |||
| 756 | Ga0070679_100050681 | |||
| 757 | Ga0070679_100205588 | |||
| 758 | Ga0070679_100417215 | |||
| 759 | Ga0070679_100667314 | |||
| 760 | Ga0070684_100007564 | |||
| 761 | Ga0070684_100097271 | |||
| 762 | Ga0070684_100186700 | |||
| 763 | Ga0070684_100261315 | |||
| 764 | Ga0070684_100583604 | |||
| 765 | Ga0070684_100586500 | |||
| 766 | Ga0070684_100888610 | |||
| 767 | Ga0070684_100924431 | |||
| 768 | Ga0068853_100270985 | |||
| 769 | Ga0068853_100690809 | |||
| 770 | Ga0070672_100111106 | |||
| 771 | Ga0070696_100399003 | |||
| 772 | Ga0070665_100005864 | |||
| 773 | Ga0070704_100236161 | |||
| 774 | Ga0068855_100031342 | |||
| 775 | Ga0068855_100053400 | |||
| 776 | Ga0068855_100095958 | |||
| 777 | Ga0068855_100123914 | |||
| 778 | Ga0068855_100192176 | |||
| 779 | Ga0068855_101531712 | |||
| 780 | Ga0070664_100419756 | |||
| 781 | Ga0068857_100012134 | |||
| 782 | Ga0068857_100102112 | |||
| 783 | Ga0068857_100148904 | |||
| 784 | Ga0068854_100427200 | |||
| 785 | Ga0068854_100496713 | |||
| 786 | Ga0068856_100099036 | |||
| 787 | Ga0068856_100134461 | |||
| 788 | Ga0068856_100273325 | |||
| 789 | Ga0068856_100494084 | |||
| 790 | Ga0068856_100549603 | |||
| 791 | Ga0068852_100035501 | |||
| 792 | Ga0068852_100058958 | |||
| 793 | Ga0068852_100082756 | |||
| 794 | Ga0068861_102417362 | |||
| 795 | Ga0068870_10731906 | |||
| 796 | Ga0070717_10298640 | |||
| 797 | Ga0070716_100500840 | |||
| 798 | Ga0070712_100257636 | |||
| 799 | Ga0070712_100411423 | |||
| 800 | Ga0070712_100708520 | |||
| 801 | Ga0070712_101546947 | |||
| 802 | Ga0097621_101208052 | |||
| 803 | Ga0097621_101944847 | |||
| 804 | Ga0075430_101813808 | |||
| 805 | Ga0075433_10858836 | |||
| 806 | Ga0075434_100036196 | |||
| 807 | Ga0075435_100177202 | |||
| 808 | Ga0105240_10113039 | |||
| 809 | Ga0105240_10314715 | |||
| 810 | Ga0105240_10969513 | |||
| 811 | Ga0105240_11462617 | |||
| 812 | Ga0105240_12203134 | |||
| 813 | Ga0105245_10193967 | |||
| 814 | Ga0105245_10715775 | |||
| 815 | Ga0105245_10744945 | |||
| 816 | Ga0105245_10973682 | |||
| 817 | Ga0114129_10313527 | |||
| 818 | Ga0114129_11970664 | |||
| 819 | Ga0105243_10281008 | |||
| 820 | Ga0105243_10650810 | |||
| 821 | Ga0105243_11107907 | |||
| 822 | Ga0105241_11174287 | |||
| 823 | Ga0105242_10013571 | |||
| 824 | Ga0105237_10036436 | |||
| 825 | Ga0105237_10109056 | |||
| 826 | Ga0105237_10433505 | |||
| 827 | Ga0105237_12361353 | |||
| 828 | Ga0105238_10014744 | |||
| 829 | Ga0105238_10796956 | |||
| 830 | Ga0105238_11960567 | |||
| 831 | Ga0105238_12656932 | |||
| 832 | Ga0105239_10104137 | |||
| 833 | Ga0105239_10328795 | |||
| 834 | Ga0105239_13029673 | |||
| 835 | Ga0157370_10013255 | |||
| 836 | Ga0157370_10025477 | |||
| 837 | Ga0157370_10097933 | |||
| 838 | Ga0157370_10134919 | |||
| 839 | Ga0157370_10307514 | |||
| 840 | Ga0157370_10345088 | |||
| 841 | Ga0157370_11641747 | |||
| 842 | Ga0157369_10036956 | |||
| 843 | Ga0157369_10040691 | |||
| 844 | Ga0157369_10088788 | |||
| 845 | Ga0157369_10134114 | |||
| 846 | Ga0157369_10149361 | |||
| 847 | Ga0157369_10467383 | |||
| 848 | Ga0157369_10830546 | |||
| 849 | Ga0157374_10037353 | |||
| 850 | Ga0157374_10315715 | |||
| 851 | Ga0157374_11186019 | |||
| 852 | Ga0157378_10773835 | |||
| 853 | Ga0157378_10809147 | |||
| 854 | Ga0157372_10067660 | |||
| 855 | Ga0157372_10077786 | |||
| 856 | Ga0157372_10129916 | |||
| 857 | Ga0157372_10230953 | |||
| 858 | Ga0157375_10136949 | |||
| 859 | Ga0157375_11524266 | |||
| 860 | Ga0163163_10217014 | |||
| 861 | Ga0157380_10307727 | |||
| 862 | Ga0157380_10620735 | |||
| 863 | Ga0157376_10359810 | |||
| 864 | Ga0197907_10828823 | |||
| 865 | Ga0197907_10925693 | |||
| 866 | Ga0206356_10367634 | |||
| 867 | Ga0206356_10644722 | |||
| 868 | Ga0206356_11443052 | |||
| 869 | Ga0206356_11558854 | |||
| 870 | Ga0206351_10791902 | |||
| 871 | Ga0206354_10020652 | |||
| 872 | Ga0206354_10355337 | |||
| 873 | Ga0206354_10387144 | |||
| 874 | Ga0206354_10441572 | |||
| 875 | Ga0206354_10860937 | |||
| 876 | Ga0206354_11274995 | |||
| 877 | Ga0206354_11623010 | |||
| 878 | Ga0206353_10775784 | |||
| 879 | Ga0206353_10981536 | |||
| 880 | Ga0206353_11050138 | |||
| 881 | Ga0206353_11336883 | |||
| 882 | Ga0206353_11609119 | |||
| 883 | Ga0206353_11723450 | |||
| 884 | Ga0206353_11959621 | |||
| 885 | Ga0213876_10254791 | |||
| 886 | Ga0224712_10320429 | |||
| 887 | Ga0224712_10420060 | |||
| 888 | Ga0207656_10458163 | |||
| 889 | Ga0207692_10104529 | |||
| 890 | Ga0207647_10105700 | |||
| 891 | Ga0207699_10041977 | |||
| 892 | Ga0207699_10232202 | |||
| 893 | Ga0207699_10500394 | |||
| 894 | Ga0207643_10927846 | |||
| 895 | Ga0207705_10070929 | |||
| 896 | Ga0207705_10272680 | |||
| 897 | Ga0207705_10346284 | |||
| 898 | Ga0207654_10665169 | |||
| 899 | Ga0207707_10001956 | |||
| 900 | Ga0207707_10168400 | |||
| 901 | Ga0207707_10170302 | |||
| 902 | Ga0207707_10509876 | |||
| 903 | Ga0207695_10036630 | |||
| 904 | Ga0207695_10111302 | |||
| 905 | Ga0207695_10415589 | |||
| 906 | Ga0207695_10682519 | |||
| 907 | Ga0207671_10027150 | |||
| 908 | Ga0207693_10089991 | |||
| 909 | Ga0207693_10513534 | |||
| 910 | Ga0207663_10166186 | |||
| 911 | Ga0207663_10204918 | |||
| 912 | Ga0207663_10319794 | |||
| 913 | Ga0207663_10535627 | |||
| 914 | Ga0207660_10030829 | |||
| 915 | Ga0207660_10094783 | |||
| 916 | Ga0207660_10110816 | |||
| 917 | Ga0207660_10183114 | |||
| 918 | Ga0207657_10000220 | |||
| 919 | Ga0207657_10056045 | |||
| 920 | Ga0207657_10061260 | |||
| 921 | Ga0207657_10083617 | |||
| 922 | Ga0207657_10343535 | |||
| 923 | Ga0207657_10586031 | |||
| 924 | Ga0207657_11475117 | |||
| 925 | Ga0207649_10173841 | |||
| 926 | Ga0207649_10306511 | |||
| 927 | Ga0207649_10397835 | |||
| 928 | Ga0207649_10933626 | |||
| 929 | Ga0207652_10012636 | |||
| 930 | Ga0207652_10056518 | |||
| 931 | Ga0207652_10156381 | |||
| 932 | Ga0207652_10280414 | |||
| 933 | Ga0207652_10348921 | |||
| 934 | Ga0207652_10388648 | |||
| 935 | Ga0207652_11219970 | |||
| 936 | Ga0207652_11344398 | |||
| 937 | Ga0207681_11042264 | |||
| 938 | Ga0207694_10047159 | |||
| 939 | Ga0207694_11663905 | |||
| 940 | Ga0207687_10267793 | |||
| 941 | Ga0207700_10224510 | |||
| 942 | Ga0207700_10491745 | |||
| 943 | Ga0207664_10146937 | |||
| 944 | Ga0207664_10758357 | |||
| 945 | Ga0207664_11061814 | |||
| 946 | Ga0207664_11118044 | |||
| 947 | Ga0207664_11609231 | |||
| 948 | Ga0207644_10081765 | |||
| 949 | Ga0207644_10447874 | |||
| 950 | Ga0207690_10094288 | |||
| 951 | Ga0207690_10128248 | |||
| 952 | Ga0207686_10252027 | |||
| 953 | Ga0207704_10193996 | |||
| 954 | Ga0207665_10960027 | |||
| 955 | Ga0207691_10482686 | |||
| 956 | Ga0207711_10406378 | |||
| 957 | Ga0207661_10017963 | |||
| 958 | Ga0207661_10255428 | |||
| 959 | Ga0207661_10757252 | |||
| 960 | Ga0207661_11003736 | |||
| 961 | Ga0207679_10617294 | |||
| 962 | Ga0207679_11149849 | |||
| 963 | Ga0207667_10061300 | |||
| 964 | Ga0207667_10284234 | |||
| 965 | Ga0207667_10344832 | |||
| 966 | Ga0207667_10717908 | |||
| 967 | Ga0207667_10875173 | |||
| 968 | Ga0207667_11323390 | |||
| 969 | Ga0207667_11835405 | |||
| 970 | Ga0207640_10236986 | |||
| 971 | Ga0207640_10368631 | |||
| 972 | Ga0207640_10445581 | |||
| 973 | Ga0207658_10007817 | |||
| 974 | Ga0207639_10609637 | |||
| 975 | Ga0207678_10084031 | |||
| 976 | Ga0207678_10308895 | |||
| 977 | Ga0207678_10744836 | |||
| 978 | Ga0207678_11006654 | |||
| 979 | Ga0207702_10082070 | |||
| 980 | Ga0207702_10310164 | |||
| 981 | Ga0207702_10737920 | |||
| 982 | Ga0207702_10954302 | |||
| 983 | Ga0207702_12114056 | |||
| 984 | Ga0207648_10056371 | |||
| 985 | Ga0207674_10011922 | |||
| 986 | Ga0207674_10029793 | |||
| 987 | Ga0207683_10016644 | |||
| 988 | Ga0207683_10091988 | |||
| 989 | Ga0207683_11031695 | |||
| 990 | Ga0207698_10111696 | |||
| 991 | Ga0207698_10114054 | |||
| 992 | Ga0207698_10225936 | |||
| 993 | Ga0207698_10648492 | |||
| 994 | Ga0207698_11601227 | |||
| 995 | Ga0268266_11020342 | |||
| 996 | Ga0265337_1222032 | |||
| 997 | Ga0265326_10041535 | |||
| 998 | Ga0265334_10088002 | |||
| 999 | Ga0265323_10167638 | |||
| 1000 | Ga0265322_10025500 | |||
| 1001 | Ga0265336_10080005 | |||
| 1002 | Ga0265336_10084801 | |||
| 1003 | Ga0265338_10013496 | |||
| 1004 | Ga0265338_10279433 | |||
| 1005 | Ga0265324_10062743 | |||
| 1006 | Ga0265330_10259994 | |||
| 1007 | Ga0265328_10040032 | |||
| 1008 | Ga0265325_10033910 | |||
| 1009 | Ga0265329_10085000 | |||
| 1010 | Ga0265340_10055866 | |||
| 1011 | Ga0265339_10034571 | |||
| 1012 | Ga0265327_10010427 | |||
| 1013 | Ga0265327_10030692 | |||
| 1014 | Ga0265327_10039560 | |||
| 1015 | Ga0265327_10108141 | |||
| 1016 | Ga0265316_10014198 | |||
| 1017 | Ga0265313_10020675 | |||
| 1018 | Ga0265314_10011486 | |||
| 1019 | Ga0265342_10154578 | |||
| 1020 | Ga0373926_0269602 | |||
| 1021 | Ga0373944_0000694 | |||
| 1022 | Ga0373945_0052814 | |||
| 1023 | Ga0373953_0012180 | |||
| 1024 | Ga0373954_0091927 | |||
| 1025 | Ga0373956_0033174 | |||
| 1026 | Ga0373943_0000954 | |||
| 1027 | Ga0373955_0031410 | |||
| 1028 | Ga0373931_0237316 | |||
| 1029 | Ga0373935_0011825 | |||
| 1030 | Ga0373927_0190435 | |||
| 1031 | Ga0373933_0020346 | |||
| 1032 | Ga0373947_0017804 | |||
| 1033 | Ga0373937_0278782 | |||
| 1034 | Ga0373937_0562468 | |||
| 1035 | Ga0373937_0645769 | |||
| 1036 | Ga0373925_0117687 | |||
| 1037 | Ga0395899_0011394 | |||
| 1038 | Ga0395899_0022160 | |||
| 1039 | Ga0395899_0060613 | |||
| 1040 | Ga0395899_0258991 | |||
| 1041 | Ga0395899_0383827 | |||
| 1042 | Ga0395899_0728740 | |||
| 1043 | Ga0395899_0735413 | |||
| 1044 | Ga0395899_0800453 | |||
| 1045 | Ga0395900_0006939 | |||
| 1046 | Ga0395900_0011512 | |||
| 1047 | Ga0395900_0114597 | |||
| 1048 | Ga0395900_0180740 | |||
| 1049 | Ga0395900_0398018 | |||
| 1050 | Ga0395900_0620053 | |||
| 1051 | Ga0395900_0658629 | |||
| 1052 | Ga0395900_1927998 | |||
| 1053 | Ga0395898_0006161 | |||
| 1054 | Ga0395898_0022696 | |||
| 1055 | Ga0395898_0077425 | |||
| 1056 | Ga0395898_0251044 | |||
| 1057 | Ga0395898_0320035 | |||
| 1058 | Ga0395898_0871872 | |||
| 1059 | Ga0395905_0052908 | |||
| 1060 | Ga0395905_0110546 | |||
| 1061 | Ga0395905_0139055 | |||
| 1062 | Ga0395905_0202038 | |||
| 1063 | Ga0395905_0590578 | |||
| 1064 | Ga0395905_0967600 | |||
| 1065 | Ga0395905_1677116 | |||
| 1066 | Ga0436364_0565611 | |||
| 1067 | Ga0395901_0007265 | |||
| 1068 | Ga0395901_0008378 | |||
| 1069 | Ga0395901_0017667 | |||
| 1070 | Ga0395901_0092126 | |||
| 1071 | Ga0395901_0109363 | |||
| 1072 | Ga0395901_0137964 | |||
| 1073 | Ga0395901_0240664 | |||
| 1074 | Ga0395901_0643718 | |||
| 1075 | Ga0395901_0677716 | |||
| 1076 | Ga0395901_1918111 | |||
| 1077 | Ga0395901_1935210 | |||
| 1078 | Ga0436365_1540994 | |||
| 1079 | Ga0436365_1753612 | |||
| 1080 | Ga0436363_1268980 | |||
| 1081 | Ga0439461_0007131 | |||
| 1082 | Ga0439466_0100840 | |||
| 1083 | Ga0451835_0477936 | |||
| 1084 | Ga0439454_046920 | |||
| 1085 | Ga0439446_0008559 | |||
| 1086 | Ga0439446_0092060 | |||
| 1087 | Ga0466972_0130053 | |||
| 1088 | Ga0466965_0614838 | |||
| 1089 | Ga0466966_0050586 | |||
| 1090 | Ga0466966_0050634 | |||
| 1091 | Ga0466966_0057872 | |||
| 1092 | Ga0466966_0081346 | |||
| 1093 | Ga0466966_0144968 | |||
| 1094 | Ga0466966_0145409 | |||
| 1095 | Ga0466961_0017176 | |||
| 1096 | Ga0466961_0044813 | |||
| 1097 | Ga0466961_0221393 | |||
| 1098 | Ga0466961_0508807 | |||
| 1099 | Ga0466961_0684842 | |||
| 1100 | Ga0466963_0015475 | |||
| 1101 | Ga0466963_0020158 | |||
| 1102 | Ga0466963_0034222 | |||
| 1103 | Ga0466963_0036761 | |||
| 1104 | Ga0466963_0038657 | |||
| 1105 | Ga0466963_0051318 | |||
| 1106 | Ga0466963_0174460 | |||
| 1107 | Ga0466963_0189081 | |||
| 1108 | Ga0466964_0012104 | |||
| 1109 | Ga0466964_0032648 | |||
| 1110 | Ga0466964_0488256 | |||
| 1111 | Ga0466964_0729786 | |||
| 1112 | Ga0466971_0006866 | |||
| 1113 | Ga0466971_0013604 | |||
| 1114 | Ga0466971_0067989 | |||
| 1115 | Ga0466968_0008104 | |||
| 1116 | Ga0466968_0048640 | |||
| 1117 | Ga0466968_0069979 | |||
| 1118 | Ga0466970_0022273 | |||
| 1119 | Ga0466970_0062116 | |||
| 1120 | Ga0466957_0038281 | |||
| 1121 | Ga0466957_0136290 | |||
| 1122 | Ga0466957_0163291 | |||
| 1123 | Ga0466957_0888503 | |||
| 1124 | Ga0466957_0909579 | |||
| 1125 | Ga0466959_0009357 | |||
| 1126 | Ga0466959_0025567 | |||
| 1127 | Ga0466959_0048685 | |||
| 1128 | Ga0466958_0001800 | |||
| 1129 | Ga0466958_0008405 | |||
| 1130 | Ga0466958_0194265 | |||
| 1131 | Ga0466958_0237169 | |||
| 1132 | Ga0466967_0007679 | |||
| 1133 | Ga0466967_0023263 | |||
| 1134 | Ga0466967_0037883 | |||
| 1135 | Ga0466967_0048332 | |||
| 1136 | Ga0466967_0062495 | |||
| 1137 | Ga0466967_0087048 | |||
| 1138 | Ga0466967_0135268 | |||
| 1139 | Ga0466967_0149149 | |||
| 1140 | Ga0466967_0194372 | |||
| 1141 | Ga0466967_0252634 | |||
| 1142 | Ga0466967_0276514 | |||
| 1143 | Ga0466967_0575121 | |||
| 1144 | Ga0466967_0618827 | |||
| 1145 | Ga0466967_0640582 | |||
| 1146 | Ga0466967_0763902 | |||
| 1147 | Ga0466967_0829910 | |||
| 1148 | Ga0466967_0883998 | |||
| 1149 | Ga0495592_0055440 | |||
| 1150 | Ga0495592_0159031 | |||
| 1151 | Ga0495592_0197396 | |||
| 1152 | Ga0495592_0230428 | |||
| 1153 | Ga0495603_0256487 | |||
| 1154 | Ga0495629_0000259 | |||
| 1155 | Ga0495641_0000681 | |||
| 1156 | Ga0495641_0185021 | |||
| 1157 | Ga0495641_0295915 | |||
| 1158 | Ga0495651_0020411 | |||
| 1159 | Ga0495651_0048870 | |||
| 1160 | Ga0495651_0374259 | |||
| 1161 | Ga0495651_0504747 | |||
| 1162 | Ga0495653_0023210 | |||
| 1163 | Ga0495653_0042433 | |||
| 1164 | Ga0495653_0166844 | |||
| 1165 | Ga0495580_0137088 | |||
| 1166 | Ga0495580_0533573 | |||
| 1167 | Ga0495582_0006753 | |||
| 1168 | Ga0495582_0202765 | |||
| 1169 | Ga0495605_0225918 | |||
| 1170 | Ga0495639_0408821 | |||
| 1171 | Ga0495662_0001214 | |||
| 1172 | Ga0495662_0013919 | |||
| 1173 | Ga0495662_0146222 | |||
| 1174 | Ga0495664_0048015 | |||
| 1175 | Ga0495584_0147355 | |||
| 1176 | Ga0495585_0155551 | |||
| 1177 | Ga0495596_0053386 | |||
| 1178 | Ga0495607_0349564 | |||
| 1179 | Ga0495608_0003273 | |||
| 1180 | Ga0495608_0009426 | |||
| 1181 | Ga0495608_0079773 | |||
| 1182 | Ga0495608_0141095 | |||
| 1183 | Ga0495608_0381208 | |||
| 1184 | Ga0495618_0031447 | |||
| 1185 | Ga0495618_0269776 | |||
| 1186 | Ga0495628_0137248 | |||
| 1187 | Ga0495628_0166019 | |||
| 1188 | Ga0495630_0002573 | |||
| 1189 | Ga0495630_0009303 | |||
| 1190 | Ga0495630_0014315 | |||
| 1191 | Ga0495632_0235397 | |||
| 1192 | Ga0495637_0218981 | |||
| 1193 | Ga0495644_0212867 | |||
| 1194 | Ga0495666_0021375 | |||
| 1195 | Ga0495652_0031625 | |||
| 1196 | Ga0495652_0102423 | |||
| 1197 | Ga0495652_0139379 | |||
| 1198 | Ga0495652_0166179 | |||
| 1199 | Ga0495652_0196370 | |||
| 1200 | Ga0495665_0004742 | |||
| 1201 | Ga0495665_0689114 | |||
| 1202 | Ga0495640_0025285 | |||
| 1203 | Ga0495640_0045699 | |||
| 1204 | Ga0495640_0087371 | |||
| 1205 | Ga0495640_0195139 | |||
| 1206 | Ga0495640_0367292 | |||
| 1207 | Ga0495586_0148808 | |||
| 1208 | Ga0495587_0127203 | |||
| 1209 | Ga0495587_0192552 | |||
| 1210 | Ga0495587_0434220 | |||
| 1211 | Ga0495598_0043185 | |||
| 1212 | Ga0495645_0162483 | |||
| 1213 | Ga0495645_0198642 | |||
| 1214 | Ga0495633_0589764 | |||
| 1215 | Ga0495667_0006790 | |||
| 1216 | Ga0495667_0019860 | |||
| 1217 | Ga0495667_0029954 | |||
| 1218 | Ga0495667_0039046 | |||
| 1219 | Ga0495667_0727502 | |||
| 1220 | Ga0495656_0034293 | |||
| 1221 | Ga0495668_0074513 | |||
| 1222 | Ga0495668_0200106 | |||
| 1223 | Ga0495634_0016166 | |||
| 1224 | Ga0495634_0025808 | |||
| 1225 | Ga0495634_0088139 | |||
| 1226 | Ga0495634_0172925 | |||
| 1227 | Ga0495635_0001587 | |||
| 1228 | Ga0495635_0065764 | |||
| 1229 | Ga0495635_0099121 | |||
| 1230 | Ga0495635_0222026 | |||
| 1231 | Ga0495635_0562513 | |||
| 1232 | Ga0495657_0063718 | |||
| 1233 | Ga0495599_0076027 | |||
| 1234 | Ga0495599_0137091 | |||
| 1235 | Ga0495623_0036216 | |||
| 1236 | Ga0495646_0024234 | |||
| 1237 | Ga0495646_0039081 | |||
| 1238 | Ga0495658_0000432 | |||
| 1239 | Ga0495658_0659525 | |||
| 1240 | Ga0495658_0708183 | |||
| 1241 | Ga0495613_0001501 | |||
| 1242 | Ga0495624_0006409 | |||
| 1243 | Ga0495624_0108825 | |||
| 1244 | Ga0495624_0443544 | |||
| 1245 | Ga0495670_0257132 | |||
| 1246 | Ga0495671_0549568 | |||
| 1247 | Ga0495600_0017380 | |||
| 1248 | Ga0495600_0150214 | |||
| 1249 | Ga0495581_0002893 | |||
| 1250 | Ga0495604_0084370 | |||
| 1251 | Ga0495604_0271980 | |||
| 1252 | Ga0495604_0553296 | |||
| 1253 | Ga0495636_0547127 | |||
| 1254 | Ga0495674_0017538 | |||
| 1255 | Ga0495674_0024514 | |||
| 1256 | Ga0495674_0099879 | |||
| 1257 | Ga0495674_0613873 | |||
| 1258 | Ga0495676_0001661 | |||
| 1259 | Ga0495676_0395159 | |||
| 1260 | Ga0495676_0673162 | |||
| 1261 | Ga0495680_0005472 | |||
| 1262 | Ga0495680_0005808 | |||
| 1263 | Ga0495680_0017187 | |||
| 1264 | Ga0495680_0030697 | |||
| 1265 | Ga0495675_0031268 | |||
| 1266 | Ga0495684_0000907 | |||
| 1267 | Ga0495684_0017012 | |||
| 1268 | Ga0495684_0039162 | |||
| 1269 | Ga0495684_0074299 | |||
| 1270 | Ga0495684_0231067 | |||
| 1271 | Ga0495593_0001102 | |||
| 1272 | Ga0495602_0050219 | |||
| 1273 | Ga0495602_0119566 | |||
| 1274 | Ga0495602_0382985 | |||
| 1275 | Ga0495602_0615621 | |||
| 1276 | Ga0495602_0796541 | |||
| 1277 | Ga0495602_1001846 | |||
| 1278 | Ga0495614_0016887 | |||
| 1279 | Ga0495614_0081043 | |||
| 1280 | Ga0496100_0044967 | |||
| 1281 | Ga0496100_0625038 | |||
| 1282 | Ga0496100_0636869 | |||
| 1283 | Ga0496100_0862454 | |||
| 1284 | Ga0496100_1594010 | |||
| 1285 | Ga0496101_0007347 | |||
| 1286 | Ga0496101_0008219 | |||
| 1287 | Ga0496101_0018377 | |||
| 1288 | Ga0496101_0225570 | |||
| 1289 | Ga0496101_0832146 | |||
| 1290 | Ga0496102_0033064 | |||
| 1291 | Ga0496102_0112978 | |||
| 1292 | Ga0496102_1032918 | |||
| 1293 | Ga0496103_0069746 | |||
| 1294 | Ga0496104_0013290 | |||
| 1295 | Ga0496104_0352106 | |||
| 1296 | Ga0496104_0426941 | |||
| 1297 | Ga0496104_0431552 | |||
| 1298 | Ga0496105_0025734 | |||
| 1299 | Ga0496105_0494305 | |||
| 1300 | Ga0496106_0009519 | |||
| 1301 | Ga0496106_0013305 | |||
| 1302 | Ga0496106_0274491 | |||
| 1303 | Ga0496106_0286390 | |||
| 1304 | Ga0496107_0012911 | |||
| 1305 | Ga0496107_0035291 | |||
| 1306 | Ga0496107_0859305 | |||
| 1307 | Ga0496108_0006628 | |||
| 1308 | Ga0496109_0016942 | |||
| 1309 | Ga0496109_1067829 | |||
| 1310 | Ga0496109_1669821 | |||
| 1311 | Ga0496110_0021962 | |||
| 1312 | Ga0496110_0092506 | |||
| 1313 | Ga0496110_0235214 | |||
| 1314 | Ga0496111_0026999 | |||
| 1315 | Ga0496112_0001575 | |||
| 1316 | Ga0496112_0091377 | |||
| 1317 | Ga0496112_0131232 | |||
| 1318 | Ga0496112_0203968 | |||
| 1319 | Ga0496112_0783751 | |||
| 1320 | Ga0496113_0020646 | |||
| 1321 | Ga0496113_1503174 | |||
| 1322 | Ga0496114_0004895 | |||
| 1323 | Ga0496114_0011371 | |||
| 1324 | Ga0496114_0018322 | |||
| 1325 | Ga0496114_0022381 | |||
| 1326 | Ga0496114_0185382 | |||
| 1327 | Ga0496114_0491578 | |||
| 1328 | Ga0496114_0552814 | |||
| 1329 | Ga0496115_0000684 | |||
| 1330 | Ga0496115_0066677 | |||
| 1331 | Ga0496115_0184929 | |||
| 1332 | Ga0496115_0343741 | |||
| 1333 | Ga0496115_0507366 | |||
| 1334 | Ga0496115_0746957 | |||
| 1335 | Ga0496115_0852247 | |||
| 1336 | Ga0496115_1394006 | |||
| 1337 | Ga0501032_0935759 | |||
| 1338 | Ga0501034_0517975 | |||
| 1339 | Ga0501038_1101042 | |||
| 1340 | Ga0501041_0899751 | |||
| 1341 | Ga0501043_0192028 | |||
| 1342 | Ga0501046_0775349 | |||
| 1343 | Ga0501047_0016462 | |||
| 1344 | Ga0501047_0232970 | |||
| 1345 | Ga0501047_0334352 | |||
| 1346 | Ga0501067_0017656 | |||
| 1347 | Ga0501067_0034813 | |||
| 1348 | Ga0501069_0137178 | |||
| 1349 | Ga0501069_0731577 | |||
| 1350 | Ga0501069_0817676 | |||
| 1351 | Ga0501070_0000830 | |||
| 1352 | Ga0501070_0110869 | |||
| 1353 | Ga0501070_0126501 | |||
| 1354 | Ga0501070_0344743 | |||
| 1355 | Ga0501070_0351950 | |||
| 1356 | Ga0501070_0394710 | |||
| 1357 | Ga0501074_0015244 | |||
| 1358 | Ga0501074_0169038 | |||
| 1359 | Ga0501074_0325225 | |||
| 1360 | Ga0501080_0165453 | |||
| 1361 | Ga0501080_0509535 | |||
| 1362 | Ga0501044_0088022 | |||
| 1363 | Ga0501044_0123712 | |||
| 1364 | nmdc:mga0n895_55466_c1 | |||
| 1365 | nmdc:mga0rr50_195984_c1 | |||
| 1366 | nmdc:mga0a205_44833_c1 | |||
| 1367 | Ga0495601_0038051 | |||
| 1368 | Ga0495601_0084108 | |||
| 1369 | Ga0495601_0284267 | |||
| 1370 | Ga0495601_0465424 | |||
| 1371 | Ga0495612_0092587 | |||
| 1372 | Ga0495612_0405450 | |||
| 1373 | Ga0495655_0245753 | |||
| 1374 | Ga0495595_0009908 | |||
| 1375 | Ga0495595_0028453 | |||
| 1376 | Ga0495595_0069495 | |||
| 1377 | Ga0495595_0132551 | |||
| 1378 | Ga0495619_0002309 | |||
| 1379 | Ga0495619_0003372 | |||
| 1380 | Ga0495619_0014725 | |||
| 1381 | Ga0466962_0000805 | |||
| 1382 | Ga0466962_0010464 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7bze-assembly1.cif.gz_A-2 | structure of bacillus subtilis hxlr, k13a mutant | 0.9438 | 15 | 107 |
| 4a5n-assembly2.cif.gz_D | redoxregulator hypr in its reduced form | 0.9241 | 15 | 105 |
| 5hs9-assembly1.cif.gz_A | crystal structure of the quinone-bound yodb from b. subtilis | 0.9188 | 15 | 105 |
| 5hs9-assembly1.cif.gz_B | crystal structure of the quinone-bound yodb from b. subtilis | 0.9134 | 15 | 105 |
| 2fsw-assembly1.cif.gz_A | crystal structure of the putative transcriptional regualator, marr family from porphyromonas gingivalis w83 | 0.909 | 6 | 107 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5hs9A00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9188 | 15 | 105 | 1.10.10.10 |
| 2fswA00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.917 | 6 | 103 | 1.10.10.10 |
| 5hs9B00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9134 | 15 | 105 | 1.10.10.10 |
| 4hqmA00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9019 | 15 | 105 | 1.10.10.10 |
| af_Q9VIH1_177_246_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8945 | 30 | 70 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6L9QM57-F1-model_v4 | Helix-turn-helix transcriptional regulator | 0.9637 | 11 | 105 |
GO:0003677
|
| AF-A0A4Q2JQK9-F1-model_v4 | Transcriptional regulator | 0.9537 | 12 | 105 |
GO:0003677
|
| AF-A0A1S9ABJ3-F1-model_v4 | Transcriptional regulator | 0.9511 | 17 | 105 |
GO:0003677
|
| AF-A0A7J5BQC2-F1-model_v4 | Helix-turn-helix transcriptional regulator | 0.9486 | 14 | 102 |
GO:0003677
|
| AF-A0A6L3W3K1-F1-model_v4 | Helix-turn-helix transcriptional regulator | 0.9409 | 11 | 105 |
GO:0003677
|