F475527

General Info

Members Datasets Scaffolds Average Seq Length
691 372 534 268

Family's Representative Sequence

Representative Sequence 3300025916|Ga0207663_10120021|Ga0207663_101200212
Length 281
Sequence MPRIALGLEYDGTDFVGWQIQRSGRSIEAALAAAVEVVANEPMTVHGAGRTDAGVHAAQQVAHFDTRAERSERQWLLGINSNLPPDVAVRWVREVPSTFDARRSAVRRRYRYSVLQQPTRPALARARVWWIREQLDAAAMTAASLHWLGEHDFSAFRAAGCQAKSPLRRLAAVRIARTAQAGGVLWQIDFTANAFLQHMVRNLVGALVEIGRGDLEPAAAGEMLASRDRTQAAVAAPPTGLCLVEVLYPEHYRLPAASYADQCLGEVSAMIPRSNRSAPEQ

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
3 2506520008 Serratia plymuthica AS12 Isolate Unclassified
4 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
5 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
6 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
7 2537561728 Pectobacterium wasabiae CFBP 3304 Isolate Rhizoplane
8 2547132181 Kosakonia sacchari SP1 Isolate Stem
9 2547132416 Enterobacter sp. MR1 Isolate Rhizoplane
10 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
11 2561511199 Enterobacter sp. R4-368 Isolate Nodule
12 2565956521 Vibrio rhizosphaerae DSM 18581 Isolate Rhizosphere
13 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
14 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
15 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
16 2599185299 Pantoea ananatis NFR11 Isolate Rhizoplane
17 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
18 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
19 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
20 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
21 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
22 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
23 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
24 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
25 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
26 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
27 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
28 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
29 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
30 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
31 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
32 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
33 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
34 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
35 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
36 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
37 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
38 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
39 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
40 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
41 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
42 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
43 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
44 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
45 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
46 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
47 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
48 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
49 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
50 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
51 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
52 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
53 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
54 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
55 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
56 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
57 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
58 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
59 2608642108 Pantoea agglomerans NFPP29 Isolate Rhizoplane
60 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
61 2636415599 Klebsiella variicola DX120E Isolate Unclassified
62 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
63 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
64 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
65 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
66 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
67 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
68 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
69 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
70 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
71 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
72 2706794495 Dickeya zeae ZJU1202 Isolate Unclassified
73 2711768156 Atlantibacter hermannii DDE1 Isolate Unclassified
74 2751185917 Enterobacter sp. HK169 Isolate Unclassified
75 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
76 2772190666 Serratia surfactantfaciens YD25 Isolate Unclassified
77 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
78 2775507074 Klebsiella sp. D5A Isolate Unclassified
79 2791354903 Mangrovibacter phragmitis MP23 Isolate Unclassified
80 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
81 2791355275 Enterobacter sp. Sa187 Isolate Unclassified
82 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
83 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
84 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
85 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
86 2821118458 Enterobacter asburiae 609 Isolate Unclassified
87 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
88 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified
89 2844425489 Enterobacter cloacae SBP-8 Isolate Rhizosphere
90 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
91 2846540461 Photorhabdus luminescens HIM3 Isolate Rhizosphere
92 2847085930 Erwinia persicina B64 Isolate Bulb
93 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
94 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
95 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
96 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
97 2858466076 Pectobacterium polaris SS28 Isolate Stem Tuber
98 2865014394 Pantoea sp. R-71966 Isolate Unclassified
99 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
100 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
101 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
102 2876601092 Pantoea endophytica 596 Isolate Unclassified
103 2881609920 Pantoea sp. ARC607 Isolate Rhizosphere
104 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
105 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
106 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
107 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
108 2900051742 Pectobacterium zantedeschiae 2M Isolate Stem Tuber
109 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
110 2904504865 Serratia marcescens 1822 Isolate Unclassified
111 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
112 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
113 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
114 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
115 2919150387 Rahnella aceris 1817 Isolate Unclassified
116 2919497567 Shewanella putrefaciens 3469 Isolate Unclassified
117 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
118 2927143783 Rahnella sp. 2050 Isolate Unclassified
119 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
120 2932406140 Serratia sp. 2723 Isolate Rhizosphere
121 2935625433 Kosakonia sp. 1610 Isolate Rhizosphere
122 2937539931 Pantoea sp. LS15 Isolate Unclassified
123 2937967321 Serratia sp. YC16 Isolate Unclassified
124 2939568625 Lelliottia sp. 489 Isolate Rhizosphere
125 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
126 2939577877 Serratia sp. 509 Isolate Rhizosphere
127 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
128 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
129 2939617950 Kosakonia cowanii 2056 Isolate Rhizosphere
130 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
131 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
132 2945951305 Pantoea agglomerans W2I1 Isolate Rhizosphere
133 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
134 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
135 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
136 2974435778 Kosakonia cowanii SORGH_AS 304 Isolate Unclassified
137 2978975091 Pantoea anthophila SORGH_AS 797 Isolate Unclassified
138 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
139 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
140 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
141 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
142 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
143 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
144 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
145 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
146 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
147 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
148 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
149 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
150 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
151 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
152 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
153 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
154 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
155 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
156 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
157 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
158 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
159 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
160 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
161 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
162 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
163 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
164 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
165 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
166 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
167 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
168 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
169 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
170 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
171 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
172 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
173 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
174 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
175 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
176 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
177 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
178 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
179 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
180 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
181 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
182 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
183 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
184 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
185 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
186 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
187 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
188 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
189 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
190 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
191 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
192 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
193 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
194 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
195 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
196 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
197 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
198 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
199 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
200 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
201 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
202 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
203 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
204 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
205 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
206 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
207 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
208 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
209 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
210 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
211 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
212 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
213 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
214 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
215 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
216 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
217 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
218 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
219 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
220 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
221 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
222 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
223 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
224 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
225 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
226 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
227 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
228 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
229 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
230 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
231 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
232 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
233 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
234 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
235 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
236 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
237 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
238 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
239 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
240 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
241 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
242 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
243 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
264 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
266 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
267 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
268 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
269 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
270 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
272 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
273 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
274 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
276 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
277 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
278 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
279 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
280 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
281 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
282 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
283 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
284 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
285 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
286 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
287 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
288 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
289 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
290 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
291 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
292 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
293 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
294 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
295 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
296 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
297 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
298 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
299 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
300 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
301 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
302 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
303 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
304 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
305 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
306 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
307 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
308 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
309 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
310 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
311 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
312 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
313 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
314 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
315 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
316 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
317 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
318 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
319 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
320 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
321 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
322 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
323 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
324 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
325 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
326 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
327 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
328 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
329 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
330 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
331 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
332 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
333 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
334 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
335 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
336 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
337 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
338 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
339 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
340 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
341 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
342 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
343 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
344 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
345 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
346 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
347 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
348 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
349 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
350 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
351 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
352 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
353 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
354 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
355 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
356 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
357 640753048 Serratia proteamaculans 568 Isolate Endosphere
358 8004592986 Serratia sp. S119 Isolate Unclassified
359 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere
360 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
361 8018221730 Enterobacter sp. CM29 Isolate Unclassified
362 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
363 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere
364 8019504834 Atlantibacter hermannii 1903 Isolate Rhizosphere
365 8054357960 Idiomarina rhizosphaerae M1R2S28 Isolate Rhizosphere
366 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
367 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere
368 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
369 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
370 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere
371 8055693939 Hafnia alvei A23BA Isolate Rhizosphere
372 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 77.28
Metatranscriptomes 0
Isolates 22.72

Biome Distribution

Category Percentage (%)
Aerial Root 0.58
Bulb 0.14
Endosphere 3.91
Nodule 3.33
Rhizoplane 9.7
Rhizosphere 58.47
Stem 0.14
Stem Tuber 0.87
Unclassified 22.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2482997 2162886007 Bacteria 8621
2 JGI24739J22299_10000804 3300001989 Bacteria 11483
3 JGI25162J39368_1000002 3300002737 Bacteria 663004
4 JGI25162J39368_1002185 3300002737 Bacteria 8106
5 JGI25163J39215_1000175 3300002771 Bacteria 25032
6 JGI25164J39214_1000006 3300002772 Bacteria 342675
7 JGI25152J39213_1000591 3300002773 Bacteria 19598
8 rootH2_10038029 3300003320 Bacteria 12253
9 Ga0055538_1000003 3300003751 Bacteria 663004
10 Ga0055539_1000003 3300003752 Bacteria 663004
11 Ga0055533_1000005 3300003756 Bacteria 663004
12 Ga0055525_1000005 3300003759 Bacteria 663004
13 Ga0055541_1000003 3300003841 Bacteria 663004
14 Ga0058692_1000079 3300003856 Bacteria 70485
15 Ga0058692_1002561 3300003856 Bacteria 6016
16 Ga0058692_1008497 3300003856 Bacteria 2648
17 Ga0058692_1008671 3300003856 Bacteria 2613
18 Ga0058692_1013482 3300003856 Bacteria 1899
19 Ga0058692_1018949 3300003856 Bacteria 1476
20 Ga0065703_1018830 3300005272 Bacteria 6281
21 Ga0065714_10086726 3300005288 Bacteria 2089
22 Ga0065704_10000837 3300005289 Bacteria 24303
23 Ga0065704_10073081 3300005289 Bacteria 7603
24 Ga0065704_10076660 3300005289 Bacteria 5014
25 Ga0065704_10076836 3300005289 Bacteria 4945
26 Ga0065704_10107038 3300005289 Bacteria 2066
27 Ga0070676_10169118 3300005328 Bacteria 1412
28 Ga0070676_10468241 3300005328 Bacteria 889
29 Ga0070690_100049942 3300005330 Bacteria 2668
30 Ga0070670_100007813 3300005331 Bacteria 9100
31 Ga0068869_100593329 3300005334 Unclassified 935
32 Ga0070666_10040580 3300005335 Bacteria 3106
33 Ga0070682_100203321 3300005337 Bacteria 1399
34 Ga0068868_100000140 3300005338 Bacteria 46540
35 Ga0070661_100055576 3300005344 Bacteria 2898
36 Ga0070692_10051586 3300005345 Bacteria 2140
37 Ga0070668_100002858 3300005347 Bacteria 12732
38 Ga0070668_100524384 3300005347 Bacteria 1028
39 Ga0070671_100030856 3300005355 Bacteria 4424
40 Ga0070674_100242036 3300005356 Bacteria 1413
41 Ga0070673_100140149 3300005364 Bacteria 2039
42 Ga0070659_100098409 3300005366 Bacteria 2352
43 Ga0070667_100001722 3300005367 Bacteria 19563
44 Ga0070667_100247505 3300005367 Bacteria 1593
45 Ga0070701_10008464 3300005438 Bacteria 4452
46 Ga0070705_100244924 3300005440 Bacteria 1255
47 Ga0070700_100050794 3300005441 Bacteria 2579
48 Ga0070678_100247047 3300005456 Bacteria 1495
49 Ga0070699_100493954 3300005518 Bacteria 1111
50 Ga0070684_100002931 3300005535 Bacteria 12684
51 Ga0070695_100068983 3300005545 Bacteria 2310
52 Ga0070665_100000374 3300005548 Bacteria 66650
53 Ga0070665_100011309 3300005548 Bacteria 9027
54 Ga0070665_100045237 3300005548 Bacteria 4421
55 Ga0070704_100035195 3300005549 Bacteria 3403
56 Ga0070664_100005398 3300005564 Bacteria 10261
57 Ga0068857_100000051 3300005577 Bacteria 64784
58 Ga0068856_100078611 3300005614 Bacteria 3271
59 Ga0070702_100027929 3300005615 Bacteria 3051
60 Ga0068859_100002958 3300005617 Bacteria 17234
61 Ga0068859_100072522 3300005617 Bacteria 3480
62 Ga0068859_100618483 3300005617 Unclassified 1176
63 Ga0068864_100044165 3300005618 Bacteria 3818
64 Ga0068861_100078095 3300005719 Bacteria 2584
65 Ga0068851_10016990 3300005834 Bacteria 3488
66 Ga0068863_100001117 3300005841 Bacteria 26783
67 Ga0068863_100840123 3300005841 Bacteria 917
68 Ga0068858_100060822 3300005842 Bacteria 3491
69 Ga0068862_100042729 3300005844 Bacteria 3862
70 Ga0068862_100456770 3300005844 Bacteria 1205
71 Ga0075364_10023125 3300006051 Bacteria 3932
72 Ga0097621_100166218 3300006237 Bacteria 1899
73 Ga0075429_100053422 3300006880 Bacteria 3516
74 Ga0068865_100385424 3300006881 Bacteria 1144
75 Ga0097620_100002958 3300006931 Bacteria 17234
76 Ga0097620_100072522 3300006931 Bacteria 3480
77 Ga0097620_100618444 3300006931 Unclassified 1176
78 Ga0079104_1000120 3300006946 Bacteria 111969
79 Ga0079104_1000135 3300006946 Bacteria 103632
80 Ga0079104_1000376 3300006946 Bacteria 52544
81 Ga0079104_1002388 3300006946 Bacteria 10239
82 Ga0079104_1003319 3300006946 Bacteria 7631
83 Ga0079104_1003324 3300006946 Bacteria 7621
84 Ga0079104_1004879 3300006946 Bacteria 5547
85 Ga0079104_1012496 3300006946 Bacteria 2663
86 Ga0079104_1012498 3300006946 Bacteria 2663
87 Ga0079104_1016611 3300006946 Bacteria 2145
88 Ga0079104_1038506 3300006946 Bacteria 1132
89 Ga0105251_10000329 3300009011 Bacteria 47651
90 Ga0105251_10000502 3300009011 Bacteria 37100
91 Ga0105251_10000644 3300009011 Bacteria 32098
92 Ga0105251_10000779 3300009011 Bacteria 28970
93 Ga0105251_10008997 3300009011 Bacteria 5954
94 Ga0105251_10009710 3300009011 Bacteria 5654
95 Ga0105251_10028596 3300009011 Bacteria 2815
96 Ga0105251_10030329 3300009011 Bacteria 2717
97 Ga0105251_10060792 3300009011 Bacteria 1778
98 Ga0105251_10121336 3300009011 Bacteria 1187
99 Ga0105244_10000224 3300009036 Bacteria 58869
100 Ga0105244_10000342 3300009036 Bacteria 43837
101 Ga0105244_10000731 3300009036 Bacteria 28197
102 Ga0105244_10000919 3300009036 Bacteria 24925
103 Ga0105244_10001037 3300009036 Bacteria 23256
104 Ga0105244_10001240 3300009036 Bacteria 20930
105 Ga0105244_10001249 3300009036 Bacteria 20849
106 Ga0105244_10002689 3300009036 Bacteria 13302
107 Ga0105244_10009502 3300009036 Bacteria 5974
108 Ga0105244_10009831 3300009036 Bacteria 5839
109 Ga0105244_10009873 3300009036 Bacteria 5826
110 Ga0105244_10032936 3300009036 Bacteria 2738
111 Ga0105244_10033088 3300009036 Bacteria 2730
112 Ga0105244_10034864 3300009036 Bacteria 2647
113 Ga0105244_10038476 3300009036 Bacteria 2495
114 Ga0105244_10043305 3300009036 Bacteria 2323
115 Ga0105244_10081776 3300009036 Bacteria 1598
116 Ga0105250_10000007 3300009092 Bacteria 355249
117 Ga0105250_10000018 3300009092 Bacteria 246692
118 Ga0105250_10000080 3300009092 Bacteria 83436
119 Ga0105250_10000344 3300009092 Bacteria 35692
120 Ga0105250_10001093 3300009092 Bacteria 15301
121 Ga0105250_10003102 3300009092 Bacteria 7995
122 Ga0105250_10006131 3300009092 Bacteria 5287
123 Ga0105250_10017613 3300009092 Bacteria 2903
124 Ga0105250_10042340 3300009092 Bacteria 1825
125 Ga0105250_10055493 3300009092 Bacteria 1590
126 Ga0111539_10006586 3300009094 Bacteria 14967
127 Ga0105245_10002513 3300009098 Bacteria 16535
128 Ga0105247_10000166 3300009101 Bacteria 64598
129 Ga0105247_10004182 3300009101 Bacteria 9262
130 Ga0105243_10061712 3300009148 Bacteria 2999
131 Ga0105243_10097075 3300009148 Bacteria 2439
132 Ga0105243_10559174 3300009148 Bacteria 1094
133 Ga0105241_10000001 3300009174 Bacteria 879793
134 Ga0105242_10030367 3300009176 Bacteria 4315
135 Ga0105248_10047112 3300009177 Bacteria 4833
136 Ga0105248_10153646 3300009177 Bacteria 2597
137 Ga0105237_10056445 3300009545 Bacteria 3931
138 Ga0105238_10200857 3300009551 Bacteria 1969
139 Ga0105239_10020008 3300010375 Bacteria 7387
140 Ga0105246_10000648 3300011119 Bacteria 19460
141 Ga0105246_10199582 3300011119 Bacteria 1554
142 Ga0105246_10362641 3300011119 Bacteria 1191
143 Ga0157373_10000400 3300013100 Bacteria 34834
144 Ga0157373_10019103 3300013100 Bacteria 4989
145 Ga0157373_10020212 3300013100 Bacteria 4843
146 Ga0157373_10021414 3300013100 Bacteria 4697
147 Ga0157373_10140929 3300013100 Bacteria 1695
148 Ga0157371_10000006 3300013102 Bacteria 404774
149 Ga0157371_10001036 3300013102 Bacteria 30469
150 Ga0157371_10004097 3300013102 Bacteria 12880
151 Ga0157371_10033323 3300013102 Bacteria 3701
152 Ga0157371_10052867 3300013102 Bacteria 2885
153 Ga0157371_10143280 3300013102 Bacteria 1702
154 Ga0157371_10260356 3300013102 Bacteria 1250
155 Ga0157370_10000618 3300013104 Bacteria 44184
156 Ga0157370_10003773 3300013104 Bacteria 17683
157 Ga0157370_10012990 3300013104 Bacteria 8605
158 Ga0157370_10136911 3300013104 Bacteria 2282
159 Ga0157369_10002014 3300013105 Bacteria 24487
160 Ga0157369_10184860 3300013105 Bacteria 2192
161 Ga0157369_10298083 3300013105 Bacteria 1677
162 Ga0157374_10000998 3300013296 Bacteria 24538
163 Ga0163162_10021644 3300013306 Bacteria 6333
164 Ga0163162_10032321 3300013306 Bacteria 5196
165 Ga0163162_10054186 3300013306 Bacteria 4034
166 Ga0163162_10135352 3300013306 Bacteria 2574
167 Ga0157372_10001081 3300013307 Bacteria 29674
168 Ga0157372_10004291 3300013307 Bacteria 15241
169 Ga0157372_10009908 3300013307 Bacteria 10135
170 Ga0157372_10533397 3300013307 Bacteria 1368
171 Ga0157375_10028847 3300013308 Bacteria 5209
172 Ga0163163_10001153 3300014325 Bacteria 22447
173 Ga0157380_10020663 3300014326 Bacteria 4923
174 Ga0157380_10165993 3300014326 Unclassified 1924
175 Ga0182008_10001168 3300014497 Bacteria 18118
176 Ga0157377_10004505 3300014745 Bacteria 6427
177 Ga0157377_10227996 3300014745 Bacteria 1196
178 Ga0157379_10097757 3300014968 Bacteria 2636
179 Ga0157376_10473374 3300014969 Bacteria 1226
180 Ga0182006_1000024 3300015261 Bacteria 257431
181 Ga0182006_1004296 3300015261 Bacteria 7051
182 Ga0182006_1052767 3300015261 Bacteria 1561
183 Ga0183366_1001 3300015679 Bacteria 2743932
184 Ga0183370_1001 3300015680 Bacteria 2743932
185 Ga0183369_1001 3300015685 Bacteria 2743932
186 Ga0183368_1001 3300015687 Bacteria 2743932
187 Ga0163161_10000003 3300017792 Bacteria 339847
188 Ga0163161_10020809 3300017792 Bacteria 4606
189 Ga0213876_10000023 3300021384 Bacteria 255370
190 Ga0209760_100093 3300025207 Bacteria 71626
191 Ga0209784_100001 3300025224 Bacteria 3600592
192 Ga0209566_100001 3300025225 Bacteria 3600765
193 Ga0209674_100002 3300025226 Bacteria 3600592
194 Ga0209563_100002 3300025230 Bacteria 2045675
195 Ga0207427_100009 3300025231 Bacteria 663036
196 Ga0209437_100001 3300025233 Bacteria 2045675
197 Ga0209437_100103 3300025233 Bacteria 221904
198 Ga0209677_100002 3300025253 Bacteria 2045675
199 Ga0209129_1000037 3300025258 Bacteria 326534
200 Ga0207696_1000001 3300025711 Bacteria 2579611
201 Ga0207696_1000013 3300025711 Bacteria 524881
202 Ga0207696_1000029 3300025711 Bacteria 398074
203 Ga0207696_1000067 3300025711 Bacteria 228478
204 Ga0207696_1000100 3300025711 Bacteria 171029
205 Ga0207696_1000124 3300025711 Bacteria 139229
206 Ga0207696_1000275 3300025711 Bacteria 61367
207 Ga0207696_1000467 3300025711 Bacteria 34875
208 Ga0207696_1000490 3300025711 Bacteria 33286
209 Ga0207696_1007110 3300025711 Bacteria 4421
210 Ga0207696_1007329 3300025711 Bacteria 4332
211 Ga0207655_1000002 3300025728 Bacteria 1148694
212 Ga0207655_1000004 3300025728 Bacteria 1021221
213 Ga0207655_1000007 3300025728 Bacteria 773492
214 Ga0207655_1000041 3300025728 Bacteria 333962
215 Ga0207655_1000062 3300025728 Bacteria 258054
216 Ga0207655_1000115 3300025728 Bacteria 162114
217 Ga0207655_1000205 3300025728 Bacteria 102993
218 Ga0207655_1000697 3300025728 Bacteria 39005
219 Ga0207655_1003992 3300025728 Bacteria 10668
220 Ga0207655_1012186 3300025728 Bacteria 5047
221 Ga0207655_1014037 3300025728 Bacteria 4556
222 Ga0207655_1020061 3300025728 Bacteria 3459
223 Ga0207655_1029112 3300025728 Bacteria 2593
224 Ga0207655_1041705 3300025728 Bacteria 1963
225 Ga0207655_1060354 3300025728 Bacteria 1470
226 Ga0207713_1000001 3300025735 Bacteria 2295391
227 Ga0207713_1000023 3300025735 Bacteria 346097
228 Ga0207713_1000070 3300025735 Bacteria 186597
229 Ga0207713_1000072 3300025735 Bacteria 185652
230 Ga0207713_1000083 3300025735 Bacteria 160973
231 Ga0207713_1000241 3300025735 Bacteria 72891
232 Ga0207713_1001731 3300025735 Bacteria 16796
233 Ga0207713_1014323 3300025735 Bacteria 4129
234 Ga0207713_1016307 3300025735 Bacteria 3775
235 Ga0207713_1027498 3300025735 Bacteria 2582
236 Ga0207713_1029145 3300025735 Bacteria 2478
237 Ga0207713_1075047 3300025735 Bacteria 1235
238 Ga0207710_10000051 3300025900 Bacteria 182751
239 Ga0207654_10000004 3300025911 Bacteria 902334
240 Ga0207663_10120021 3300025916 Bacteria 1799
241 Ga0207660_10060588 3300025917 Bacteria 2722
242 Ga0207649_10042255 3300025920 Bacteria 2780
243 Ga0207694_10041772 3300025924 Bacteria 3535
244 Ga0207650_10095380 3300025925 Bacteria 2280
245 Ga0207687_10029749 3300025927 Bacteria 3676
246 Ga0207644_10021997 3300025931 Bacteria 4350
247 Ga0207690_10321801 3300025932 Bacteria 1216
248 Ga0207709_10055136 3300025935 Bacteria 2454
249 Ga0207670_10059920 3300025936 Bacteria 2591
250 Ga0207669_10329284 3300025937 Bacteria 1172
251 Ga0207711_10002654 3300025941 Bacteria 15811
252 Ga0207667_10689656 3300025949 Bacteria 1024
253 Ga0207651_10259705 3300025960 Bacteria 1425
254 Ga0207658_10157173 3300025986 Bacteria 1859
255 Ga0207703_10001744 3300026035 Bacteria 19465
256 Ga0207708_10007427 3300026075 Bacteria 8100
257 Ga0207702_10770583 3300026078 Bacteria 950
258 Ga0207648_10025082 3300026089 Bacteria 5316
259 Ga0207676_10001802 3300026095 Bacteria 15704
260 Ga0207676_10010018 3300026095 Bacteria 6745
261 Ga0207674_10000718 3300026116 Bacteria 43315
262 Ga0207675_100008159 3300026118 Bacteria 9870
263 Ga0207675_100749104 3300026118 Bacteria 988
264 Ga0207683_10087208 3300026121 Bacteria 2775
265 Ga0209281_1000004 3300027111 Bacteria 1253949
266 Ga0209281_1000014 3300027111 Bacteria 643021
267 Ga0209281_1000038 3300027111 Bacteria 361154
268 Ga0209281_1000095 3300027111 Bacteria 238108
269 Ga0209281_1000219 3300027111 Bacteria 123456
270 Ga0209281_1000286 3300027111 Bacteria 94163
271 Ga0209281_1000340 3300027111 Bacteria 79749
272 Ga0209281_1000404 3300027111 Bacteria 65885
273 Ga0209281_1001735 3300027111 Bacteria 11212
274 Ga0209281_1003025 3300027111 Bacteria 5938
275 Ga0209281_1012356 3300027111 Bacteria 1877
276 Ga0209371_1000001 3300027312 Bacteria 2771503
277 Ga0209371_1000005 3300027312 Bacteria 1061740
278 Ga0209371_1000015 3300027312 Bacteria 659640
279 Ga0209371_1000108 3300027312 Bacteria 141822
280 Ga0209371_1000118 3300027312 Bacteria 134470
281 Ga0209371_1000559 3300027312 Bacteria 34100
282 Ga0209371_1000688 3300027312 Bacteria 28987
283 Ga0209371_1001511 3300027312 Bacteria 15455
284 Ga0209371_1002228 3300027312 Bacteria 11209
285 Ga0209371_1003936 3300027312 Bacteria 6814
286 Ga0209371_1004305 3300027312 Bacteria 6287
287 Ga0209371_1005909 3300027312 Bacteria 4701
288 Ga0209371_1006768 3300027312 Bacteria 4161
289 Ga0209371_1007785 3300027312 Bacteria 3665
290 Ga0209371_1021442 3300027312 Bacteria 1565
291 Ga0207428_10036039 3300027907 Bacteria 4039
292 Ga0268266_10000894 3300028379 Bacteria 38498
293 Ga0268265_10028465 3300028380 Bacteria 4000
294 Ga0268265_10777745 3300028380 Bacteria 931
295 Ga0268264_10470891 3300028381 Unclassified 1220
296 Ga0268256_1000001 3300030500 Bacteria 2771065
297 Ga0268256_1000006 3300030500 Bacteria 1063991
298 Ga0268256_1000018 3300030500 Bacteria 594572
299 Ga0268256_1000076 3300030500 Bacteria 178295
300 Ga0268256_1000100 3300030500 Bacteria 134526
301 Ga0268256_1000960 3300030500 Bacteria 19631
302 Ga0268256_1001195 3300030500 Bacteria 16583
303 Ga0268256_1001450 3300030500 Bacteria 14273
304 Ga0268256_1002785 3300030500 Bacteria 8481
305 Ga0268256_1004927 3300030500 Bacteria 5387
306 Ga0268256_1008031 3300030500 Bacteria 3665
307 Ga0268256_1009429 3300030500 Bacteria 3240
308 Ga0268256_1009856 3300030500 Bacteria 3132
309 Ga0268256_1040818 3300030500 Bacteria 1040
310 Ga0307413_10099269 3300031824 Bacteria 1919
311 Ga0307414_10452807 3300032004 Bacteria 1126
312 Ga0373957_0047298 3300035120 Bacteria 1636
313 Ga0373960_0027763 3300035121 Bacteria 1557
314 Ga0316574_0112778 3300035398 Bacteria 1743
315 Ga0373931_0005264 3300035691 Bacteria 5966
316 Ga0373933_0268465 3300035724 Bacteria 1101
317 Ga0373937_0209349 3300036401 Bacteria 1834
318 Ga0400483_078643 3300039062 Bacteria 13677
319 Ga0400483_197092 3300039062 Bacteria 6002
320 Ga0436365_0965775 3300039437 Bacteria 470291
321 Ga0439438_000002 3300041405 Bacteria 618223
322 Ga0439438_002312 3300041405 Bacteria 8154
323 Ga0439438_017145 3300041405 Bacteria 2091
324 Ga0439447_001619 3300041407 Bacteria 8257
325 Ga0439447_002475 3300041407 Bacteria 6721
326 Ga0439447_007467 3300041407 Bacteria 3469
327 Ga0439466_0000001 3300041411 Bacteria 647258
328 Ga0451853_0044574 3300041512 Bacteria 7523
329 Ga0439432_002151 3300042006 Bacteria 7433
330 Ga0439432_013099 3300042006 Bacteria 2824
331 Ga0439432_031453 3300042006 Bacteria 1716
332 Ga0439432_076743 3300042006 Bacteria 1014
333 Ga0439452_000002 3300042010 Bacteria 1377577
334 Ga0439452_000015 3300042010 Bacteria 342948
335 Ga0439452_000037 3300042010 Bacteria 150659
336 Ga0439452_000193 3300042010 Bacteria 44853
337 Ga0439452_001418 3300042010 Bacteria 9846
338 Ga0439463_021283 3300042016 Bacteria 1619
339 Ga0450907_000304 3300042146 Bacteria 16484
340 Ga0439464_0003523 3300042439 Bacteria 3957
341 Ga0450893_0016302 3300042532 Bacteria 1257
342 Ga0466981_0000013 3300044669 Bacteria 129274
343 Ga0451576_0105889 3300045051 Bacteria 2926
344 Ga0495627_000044 3300046453 Bacteria 182964
345 Ga0495591_000001 3300046458 Bacteria 503087
346 Ga0495591_000341 3300046458 Bacteria 41541
347 Ga0495591_002220 3300046458 Bacteria 11080
348 Ga0495591_002225 3300046458 Bacteria 11065
349 Ga0495591_005762 3300046458 Bacteria 5642
350 Ga0495629_0207580 3300046459 Bacteria 1353
351 Ga0495641_0088258 3300046461 Bacteria 1387
352 Ga0495641_0123082 3300046461 Bacteria 1157
353 Ga0495650_0000018 3300046471 Bacteria 538888
354 Ga0495650_0000047 3300046471 Bacteria 335136
355 Ga0495650_0000065 3300046471 Bacteria 275124
356 Ga0495605_0035053 3300046474 Bacteria 2537
357 Ga0495596_0023395 3300046500 Bacteria 2507
358 Ga0495607_0010601 3300046501 Bacteria 6185
359 Ga0495606_0004825 3300046507 Bacteria 13244
360 Ga0495631_0075947 3300046518 Bacteria 1450
361 Ga0495648_0008155 3300046524 Bacteria 8266
362 Ga0495654_0000009 3300046530 Bacteria 381872
363 Ga0495654_0000190 3300046530 Bacteria 60060
364 Ga0495654_0003389 3300046530 Bacteria 9800
365 Ga0495654_0012526 3300046530 Bacteria 4552
366 Ga0495654_0016414 3300046530 Bacteria 3916
367 Ga0495654_0027772 3300046530 Bacteria 2896
368 Ga0495654_0080702 3300046530 Bacteria 1526
369 Ga0495597_0002438 3300046542 Bacteria 11798
370 Ga0495597_0143680 3300046542 Bacteria 983
371 Ga0495668_0053856 3300046616 Bacteria 2224
372 Ga0495625_0004935 3300046660 Bacteria 12405
373 Ga0495657_0225878 3300046675 Bacteria 1134
374 Ga0495647_0009114 3300046681 Bacteria 3352
375 Ga0495658_0106634 3300046683 Bacteria 1680
376 Ga0495613_0130211 3300046689 Bacteria 1802
377 Ga0495671_0005708 3300046692 Bacteria 7253
378 Ga0495649_0006401 3300046694 Bacteria 7328
379 Ga0495649_0141491 3300046694 Bacteria 1266
380 Ga0495589_0000003 3300046794 Bacteria 453448
381 Ga0495589_0018448 3300046794 Bacteria 3575
382 Ga0495660_0000004 3300046810 Bacteria 1003183
383 Ga0495660_0000017 3300046810 Bacteria 320655
384 Ga0495660_0009485 3300046810 Bacteria 5675
385 Ga0495672_0000001 3300047320 Bacteria 1458820
386 Ga0495672_0000009 3300047320 Bacteria 557755
387 Ga0495672_0000038 3300047320 Bacteria 273489
388 Ga0495679_000032 3300047446 Bacteria 171636
389 Ga0495679_003712 3300047446 Bacteria 7265
390 Ga0495679_008773 3300047446 Bacteria 4087
391 Ga0495673_0000019 3300047469 Bacteria 554389
392 Ga0495673_0000071 3300047469 Bacteria 217117
393 Ga0495681_0053164 3300047470 Bacteria 1897
394 Ga0496101_0000060 3300048904 Bacteria 128504
395 Ga0496102_0054685 3300048905 Bacteria 3640
396 Ga0496102_0174353 3300048905 Bacteria 2024
397 Ga0496104_0000212 3300048907 Bacteria 51443
398 Ga0496104_0008460 3300048907 Bacteria 9148
399 Ga0496104_0039921 3300048907 Bacteria 4397
400 Ga0496104_0163759 3300048907 Bacteria 2133
401 Ga0496104_0178299 3300048907 Bacteria 2035
402 Ga0496105_0009468 3300048908 Bacteria 7622
403 Ga0496108_0276403 3300048911 Bacteria 1462
404 Ga0496112_0007336 3300048915 Bacteria 9782
405 Ga0496114_0016389 3300048917 Bacteria 5970
406 Ga0496116_0000007 3300048919 Bacteria 795464
407 Ga0496116_0000118 3300048919 Bacteria 168946
408 Ga0496116_0000426 3300048919 Bacteria 59252
409 Ga0496116_0000446 3300048919 Bacteria 57660
410 Ga0496116_0000788 3300048919 Bacteria 40249
411 Ga0496116_0005290 3300048919 Bacteria 12040
412 Ga0496116_0010872 3300048919 Bacteria 7588
413 Ga0496116_0034380 3300048919 Bacteria 3577
414 Ga0496116_0123970 3300048919 Bacteria 1488
415 Ga0496117_0000009 3300048920 Bacteria 613759
416 Ga0496117_0000113 3300048920 Bacteria 181737
417 Ga0496117_0001337 3300048920 Bacteria 36234
418 Ga0496117_0003513 3300048920 Bacteria 18159
419 Ga0496117_0008647 3300048920 Bacteria 9636
420 Ga0496117_0022085 3300048920 Bacteria 5113
421 Ga0496117_0031324 3300048920 Bacteria 4062
422 Ga0496117_0051121 3300048920 Bacteria 2924
423 Ga0496117_0072833 3300048920 Bacteria 2294
424 Ga0496117_0075492 3300048920 Bacteria 2239
425 Ga0496117_0114602 3300048920 Bacteria 1670
426 Ga0496118_0000017 3300048921 Bacteria 549445
427 Ga0496118_0000471 3300048921 Bacteria 66863
428 Ga0496118_0002398 3300048921 Bacteria 25297
429 Ga0496118_0003213 3300048921 Bacteria 20858
430 Ga0496118_0003672 3300048921 Bacteria 19040
431 Ga0496118_0006402 3300048921 Bacteria 12962
432 Ga0496118_0010920 3300048921 Bacteria 8929
433 Ga0496118_0049657 3300048921 Bacteria 3228
434 Ga0496118_0063227 3300048921 Bacteria 2724
435 Ga0496118_0103955 3300048921 Bacteria 1908
436 Ga0496118_0117790 3300048921 Bacteria 1741
437 Ga0496119_0000012 3300048922 Bacteria 411917
438 Ga0496119_0000013 3300048922 Bacteria 323820
439 Ga0496119_0000129 3300048922 Bacteria 106571
440 Ga0496119_0000202 3300048922 Bacteria 84354
441 Ga0496119_0000359 3300048922 Bacteria 63918
442 Ga0496119_0001060 3300048922 Bacteria 35062
443 Ga0496119_0004305 3300048922 Bacteria 14217
444 Ga0496119_0005772 3300048922 Bacteria 11725
445 Ga0496119_0008448 3300048922 Bacteria 9040
446 Ga0496119_0008701 3300048922 Bacteria 8869
447 Ga0496119_0010600 3300048922 Bacteria 7731
448 Ga0496119_0043037 3300048922 Bacteria 2857
449 Ga0496119_0048768 3300048922 Bacteria 2623
450 Ga0496119_0059242 3300048922 Bacteria 2301
451 Ga0496120_0000004 3300048923 Bacteria 534793
452 Ga0496120_0000081 3300048923 Bacteria 158294
453 Ga0496120_0000179 3300048923 Bacteria 107658
454 Ga0496120_0000186 3300048923 Bacteria 106450
455 Ga0496120_0000291 3300048923 Bacteria 84354
456 Ga0496120_0000403 3300048923 Bacteria 69285
457 Ga0496120_0000492 3300048923 Bacteria 61827
458 Ga0496120_0001390 3300048923 Bacteria 29363
459 Ga0496120_0003109 3300048923 Bacteria 15592
460 Ga0496120_0003554 3300048923 Bacteria 14079
461 Ga0496120_0005646 3300048923 Bacteria 9904
462 Ga0496120_0020148 3300048923 Bacteria 4247
463 Ga0496120_0059524 3300048923 Bacteria 2140
464 Ga0496121_0000224 3300048924 Bacteria 122378
465 Ga0496121_0007739 3300048924 Bacteria 12880
466 Ga0496121_0016597 3300048924 Bacteria 7589
467 Ga0496121_0074560 3300048924 Bacteria 2713
468 Ga0496122_0000003 3300048925 Bacteria 645810
469 Ga0496122_0000303 3300048925 Bacteria 108668
470 Ga0496122_0000803 3300048925 Bacteria 60232
471 Ga0496122_0001179 3300048925 Bacteria 44684
472 Ga0496122_0004253 3300048925 Bacteria 17958
473 Ga0496122_0005488 3300048925 Bacteria 15088
474 Ga0496122_0020144 3300048925 Bacteria 6050
475 Ga0496122_0039285 3300048925 Bacteria 3775
476 Ga0496122_0073855 3300048925 Bacteria 2415
477 Ga0496122_0134899 3300048925 Bacteria 1558
478 Ga0496123_0000012 3300048926 Bacteria 458760
479 Ga0496123_0000140 3300048926 Bacteria 147707
480 Ga0496123_0000250 3300048926 Bacteria 108668
481 Ga0496123_0002106 3300048926 Bacteria 25549
482 Ga0496123_0002927 3300048926 Bacteria 19981
483 Ga0496123_0005912 3300048926 Bacteria 12076
484 Ga0496123_0030515 3300048926 Bacteria 3944
485 Ga0496123_0055891 3300048926 Bacteria 2585
486 Ga0496123_0056882 3300048926 Bacteria 2551
487 Ga0496123_0068739 3300048926 Bacteria 2228
488 Ga0496123_0072968 3300048926 Bacteria 2132
489 Ga0496124_0000027 3300048927 Bacteria 376097
490 Ga0496124_0000028 3300048927 Bacteria 357219
491 Ga0496124_0000060 3300048927 Bacteria 239933
492 Ga0496124_0000738 3300048927 Bacteria 53538
493 Ga0496124_0001085 3300048927 Bacteria 42903
494 Ga0496124_0001356 3300048927 Bacteria 36667
495 Ga0496124_0007002 3300048927 Bacteria 12084
496 Ga0496124_0012739 3300048927 Bacteria 8265
497 Ga0496124_0020051 3300048927 Bacteria 6192
498 Ga0496124_0051821 3300048927 Bacteria 3490
499 Ga0496124_0157476 3300048927 Bacteria 1774
500 Ga0496124_0166675 3300048927 Bacteria 1711
501 Ga0496125_0000052 3300048928 Bacteria 281862
502 Ga0496125_0000296 3300048928 Bacteria 98054
503 Ga0496125_0006723 3300048928 Bacteria 12366
504 Ga0496125_0019039 3300048928 Bacteria 6495
505 Ga0496125_0026916 3300048928 Bacteria 5223
506 Ga0496125_0032917 3300048928 Bacteria 4596
507 Ga0496125_0033000 3300048928 Bacteria 4588
508 Ga0496125_0061893 3300048928 Bacteria 2998
509 Ga0496125_0078071 3300048928 Bacteria 2547
510 Ga0496125_0112446 3300048928 Bacteria 1967
511 Ga0496125_0300057 3300048928 Bacteria 984
512 Ga0496126_0001215 3300048929 Bacteria 42003
513 Ga0496126_0006168 3300048929 Bacteria 13418
514 Ga0496126_0016003 3300048929 Bacteria 7519
515 Ga0496126_0052893 3300048929 Bacteria 3687
516 Ga0496126_0058362 3300048929 Bacteria 3478
517 Ga0496126_0106003 3300048929 Bacteria 2453
518 Ga0496126_0113052 3300048929 Bacteria 2364
519 Ga0496126_0171420 3300048929 Bacteria 1848
520 Ga0496126_0211078 3300048929 Bacteria 1634
521 Ga0495678_000231 3300049459 Bacteria 64074
522 Ga0495678_009631 3300049459 Bacteria 4760
523 Ga0495682_0000164 3300049460 Bacteria 55956
524 Ga0501040_0091482 3300049576 Bacteria 2115
525 Ga0501042_0193160 3300049578 Bacteria 1468
526 Ga0501071_0455294 3300049587 Bacteria 979
527 nmdc:mga00v17_201487_c1 3300050491 Bacteria 1287
528 nmdc:mga00v17_3354_c1 3300050491 Bacteria 8264
529 nmdc:mga0k408_142912_c1 3300050493 Bacteria 1424
530 nmdc:mga09592_51015_c1 3300050508 Bacteria 3490
531 nmdc:mga0qj67_23106_c1 3300050509 Bacteria 4780
532 nmdc:mga08y16_14469_c1 3300050511 Bacteria 8300
533 Ga0500641_0004188 3300053096 Bacteria 5090
534 Ga0500621_000005 3300053126 Bacteria 320383

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046683 Ga0495658_0106634 Ga0495658_0106634_191_859 217
2 3300031824 Ga0307413_10099269 Ga0307413_100992692 225
3 3300025949 Ga0207667_10689656 Ga0207667_106896562 238
4 3300005334 Ga0068869_100593329 Ga0068869_1005933291 241
5 3300005345 Ga0070692_10051586 Ga0070692_100515862 241
6 3300005438 Ga0070701_10008464 Ga0070701_100084642 241
7 3300005440 Ga0070705_100244924 Ga0070705_1002449241 241
8 3300005441 Ga0070700_100050794 Ga0070700_1000507943 241
9 3300005549 Ga0070704_100035195 Ga0070704_1000351952 241
10 3300005617 Ga0068859_100618483 Ga0068859_1006184831 241
11 3300005719 Ga0068861_100078095 Ga0068861_1000780952 241
12 3300006931 Ga0097620_100618444 Ga0097620_1006184442 241
13 3300014326 Ga0157380_10165993 Ga0157380_101659931 241
14 3300026075 Ga0207708_10007427 Ga0207708_100074274 241
15 3300026118 Ga0207675_100008159 Ga0207675_1000081598 241
16 3300028380 Ga0268265_10028465 Ga0268265_100284654 241
17 3300049576 Ga0501040_0091482 Ga0501040_0091482_257_1042 242
18 3300049587 Ga0501071_0455294 Ga0501071_0455294_144_929 243
19 iso_pu_bacteria 2839989709 2839990494 244
20 iso_pu_bacteria 2911138879 2911142844 247
21 3300009148 Ga0105243_10061712 Ga0105243_100617122 249
22 3300032004 Ga0307414_10452807 Ga0307414_104528071 252
23 iso_pu_bacteria 2511231025 2511380100 252
24 3300026118 Ga0207675_100749104 Ga0207675_1007491041 254
25 3300035398 Ga0316574_0112778 Ga0316574_0112778_724_1491 255
26 3300005328 Ga0070676_10468241 Ga0070676_104682411 257
27 3300005330 Ga0070690_100049942 Ga0070690_1000499422 257
28 3300005331 Ga0070670_100007813 Ga0070670_1000078132 257
29 3300005335 Ga0070666_10040580 Ga0070666_100405802 257
30 3300005337 Ga0070682_100203321 Ga0070682_1002033212 257
31 3300005338 Ga0068868_100000140 Ga0068868_10000014010 257
32 3300005344 Ga0070661_100055576 Ga0070661_1000555762 257
33 3300005355 Ga0070671_100030856 Ga0070671_1000308562 257
34 3300005356 Ga0070674_100242036 Ga0070674_1002420362 257
35 3300005364 Ga0070673_100140149 Ga0070673_1001401492 257
36 3300005367 Ga0070667_100001722 Ga0070667_10000172224 257
37 3300005456 Ga0070678_100247047 Ga0070678_1002470472 257
38 3300005535 Ga0070684_100002931 Ga0070684_1000029316 257
39 3300005545 Ga0070695_100068983 Ga0070695_1000689832 257
40 3300005548 Ga0070665_100011309 Ga0070665_1000113092 257
41 3300005564 Ga0070664_100005398 Ga0070664_1000053988 257
42 3300005614 Ga0068856_100078611 Ga0068856_1000786112 257
43 3300005615 Ga0070702_100027929 Ga0070702_1000279292 257
44 3300005617 Ga0068859_100002958 Ga0068859_1000029582 257
45 3300005618 Ga0068864_100044165 Ga0068864_1000441653 257
46 3300005841 Ga0068863_100001117 Ga0068863_10000111714 257
47 3300005842 Ga0068858_100060822 Ga0068858_1000608222 257
48 3300006237 Ga0097621_100166218 Ga0097621_1001662182 257
49 3300006931 Ga0097620_100002958 Ga0097620_10000295821 257
50 3300009098 Ga0105245_10002513 Ga0105245_1000251311 257
51 3300009101 Ga0105247_10004182 Ga0105247_100041822 257
52 3300009148 Ga0105243_10559174 Ga0105243_105591742 257
53 3300009176 Ga0105242_10030367 Ga0105242_100303672 257
54 3300009177 Ga0105248_10047112 Ga0105248_100471122 257
55 3300009551 Ga0105238_10200857 Ga0105238_102008572 257
56 3300010375 Ga0105239_10020008 Ga0105239_100200084 257
57 3300011119 Ga0105246_10000648 Ga0105246_1000064815 257
58 3300013296 Ga0157374_10000998 Ga0157374_1000099819 257
59 3300013306 Ga0163162_10135352 Ga0163162_101353522 257
60 3300013308 Ga0157375_10028847 Ga0157375_100288472 257
61 3300014325 Ga0163163_10001153 Ga0163163_1000115312 257
62 3300014326 Ga0157380_10020663 Ga0157380_100206632 257
63 3300014745 Ga0157377_10004505 Ga0157377_100045055 257
64 3300014745 Ga0157377_10227996 Ga0157377_102279961 257
65 3300014968 Ga0157379_10097757 Ga0157379_100977572 257
66 3300014969 Ga0157376_10473374 Ga0157376_104733741 257
67 3300025917 Ga0207660_10060588 Ga0207660_100605882 257
68 3300025920 Ga0207649_10042255 Ga0207649_100422552 257
69 3300025924 Ga0207694_10041772 Ga0207694_100417722 257
70 3300025925 Ga0207650_10095380 Ga0207650_100953802 257
71 3300025927 Ga0207687_10029749 Ga0207687_100297492 257
72 3300025931 Ga0207644_10021997 Ga0207644_100219972 257
73 3300025936 Ga0207670_10059920 Ga0207670_100599203 257
74 3300025937 Ga0207669_10329284 Ga0207669_103292842 257
75 3300025941 Ga0207711_10002654 Ga0207711_1000265410 257
76 3300025960 Ga0207651_10259705 Ga0207651_102597052 257
77 3300025986 Ga0207658_10157173 Ga0207658_101571732 257
78 3300026035 Ga0207703_10001744 Ga0207703_1000174410 257
79 3300026078 Ga0207702_10770583 Ga0207702_107705831 257
80 3300026089 Ga0207648_10025082 Ga0207648_100250826 257
81 3300026095 Ga0207676_10001802 Ga0207676_100018026 257
82 3300026121 Ga0207683_10087208 Ga0207683_100872083 257
83 3300028381 Ga0268264_10470891 Ga0268264_104708912 257
84 3300035120 Ga0373957_0047298 Ga0373957_0047298_28_813 257
85 3300035121 Ga0373960_0027763 Ga0373960_0027763_141_926 257
86 3300035691 Ga0373931_0005264 Ga0373931_0005264_230_1015 257
87 3300035724 Ga0373933_0268465 Ga0373933_0268465_213_998 257
88 3300036401 Ga0373937_0209349 Ga0373937_0209349_291_1076 257
89 3300045051 Ga0451576_0105889 Ga0451576_0105889_1882_2667 257
90 3300046681 Ga0495647_0009114 Ga0495647_0009114_2014_2799 257
91 3300046689 Ga0495613_0130211 Ga0495613_0130211_877_1662 257
92 3300048907 Ga0496104_0039921 Ga0496104_0039921_533_1318 257
93 3300048911 Ga0496108_0276403 Ga0496108_0276403_174_959 257
94 3300048915 Ga0496112_0007336 Ga0496112_0007336_7532_8317 257
95 3300048917 Ga0496114_0016389 Ga0496114_0016389_2428_3213 257
96 3300049578 Ga0501042_0193160 Ga0501042_0193160_444_1229 257
97 3300053096 Ga0500641_0004188 Ga0500641_0004188_2075_2860 257
98 iso_pu_bacteria 2565956521 2566034937 257
99 iso_pu_bacteria 2919497567 2919500749 257
100 iso_pu_bacteria 8054357960 8054359887 257
101 3300048926 Ga0496123_0072968 Ga0496123_0072968_742_1518 258
102 3300005328 Ga0070676_10169118 Ga0070676_101691182 260
103 3300005347 Ga0070668_100524384 Ga0070668_1005243841 260
104 3300005367 Ga0070667_100247505 Ga0070667_1002475053 260
105 3300005617 Ga0068859_100072522 Ga0068859_1000725222 260
106 3300005841 Ga0068863_100840123 Ga0068863_1008401231 260
107 3300005844 Ga0068862_100456770 Ga0068862_1004567702 260
108 3300006881 Ga0068865_100385424 Ga0068865_1003854242 260
109 3300006931 Ga0097620_100072522 Ga0097620_1000725222 260
110 3300009177 Ga0105248_10153646 Ga0105248_101536462 260
111 3300026095 Ga0207676_10010018 Ga0207676_100100182 260
112 3300028380 Ga0268265_10777745 Ga0268265_107777451 260
113 3300046459 Ga0495629_0207580 Ga0495629_0207580_269_1066 260
114 3300046461 Ga0495641_0123082 Ga0495641_0123082_32_829 260
115 3300046675 Ga0495657_0225878 Ga0495657_0225878_43_840 260
116 3300005288 Ga0065714_10086726 Ga0065714_100867262 261
117 3300005518 Ga0070699_100493954 Ga0070699_1004939542 261
118 3300005844 Ga0068862_100042729 Ga0068862_1000427292 261
119 3300039062 Ga0400483_078643 Ga0400483_078643_11887_12681 261
120 3300039062 Ga0400483_197092 Ga0400483_197092_1214_2008 261
121 3300025916 Ga0207663_10120021 Ga0207663_101200212 262
122 iso_pu_bacteria 2888373701 2888377335 262
123 iso_pu_bacteria 2599185299 2599926550 263
124 iso_pu_bacteria 2608642108 2608670054 263
125 iso_pu_bacteria 2648501693 2650895790 263
126 iso_pu_bacteria 2684622997 2686354202 263
127 iso_pu_bacteria 2808606414 2809125233 263
128 iso_pu_bacteria 2844528606 2844529161 263
129 iso_pu_bacteria 2847797336 2847798935 263
130 iso_pu_bacteria 2865014394 2865016593 263
131 iso_pu_bacteria 2881609920 2881612560 263
132 iso_pu_bacteria 2945951305 2945952191 263
133 iso_pu_bacteria 2978975091 2978978665 263
134 iso_pu_bacteria 2984494565 2984497568 263
135 iso_pu_bacteria 2990261002 2990261516 263
136 iso_pu_bacteria 2511231035 2511434914 264
137 iso_pu_bacteria 2876601092 2876603241 264
138 iso_pu_bacteria 2939602548 2939604839 264
139 iso_pu_bacteria 8016733728 8016735034 264
140 iso_pu_bacteria 8019499862 8019501483 264
141 iso_pu_bacteria 8054849141 8054852006 264
142 iso_pu_bacteria 2506520007 2506579612 265
143 iso_pu_bacteria 2506520008 2506584751 265
144 iso_pu_bacteria 2508501071 2508853401 265
145 iso_pu_bacteria 2654587920 2656276956 265
146 iso_pu_bacteria 2687453601 2689446134 265
147 iso_pu_bacteria 2772190666 2772440049 265
148 iso_pu_bacteria 2806310673 2807179674 265
149 iso_pu_bacteria 2869551831 2869555484 265
150 iso_pu_bacteria 2888366609 2888370141 265
151 iso_pu_bacteria 2932406140 2932410091 265
152 iso_pu_bacteria 2937967321 2937968673 265
153 iso_pu_bacteria 2939577877 2939581431 265
154 iso_pu_bacteria 3000376612 3000378326 265
155 iso_pu_bacteria 640753048 640938880 265
156 iso_pu_bacteria 8004592986 8004596204 265
157 iso_pu_bacteria 8015394850 8015397844 265
158 3300006880 Ga0075429_100053422 Ga0075429_1000534223 266
159 3300009036 Ga0105244_10009502 Ga0105244_100095022 266
160 3300009092 Ga0105250_10003102 Ga0105250_100031025 266
161 3300009094 Ga0111539_10006586 Ga0111539_1000658611 266
162 3300025711 Ga0207696_1000275 Ga0207696_100027537 266
163 3300025728 Ga0207655_1014037 Ga0207655_10140374 266
164 3300027907 Ga0207428_10036039 Ga0207428_100360392 266
165 3300046542 Ga0495597_0002438 Ga0495597_0002438_4801_5616 266
166 3300046542 Ga0495597_0143680 Ga0495597_0143680_170_973 266
167 3300050508 nmdc:mga09592_51015_c1 nmdc:mga09592_51015_c1_100_930 266
168 3300050509 nmdc:mga0qj67_23106_c1 nmdc:mga0qj67_23106_c1_2714_3544 266
169 3300050511 nmdc:mga08y16_14469_c1 nmdc:mga08y16_14469_c1_967_1797 266
170 iso_pu_bacteria 2547132181 2547697346 266
171 iso_pu_bacteria 2547132416 2548647711 266
172 iso_pu_bacteria 2554235234 2555259897 266
173 iso_pu_bacteria 2561511199 2562463633 266
174 iso_pu_bacteria 2599185169 2599411228 266
175 iso_pu_bacteria 2600255254 2601524223 266
176 iso_pu_bacteria 2600255255 2601529377 266
177 iso_pu_bacteria 2600255256 2601535509 266
178 iso_pu_bacteria 2600255257 2601540066 266
179 iso_pu_bacteria 2600255280 2601616211 266
180 iso_pu_bacteria 2600255281 2601620933 266
181 iso_pu_bacteria 2600255287 2601644279 266
182 iso_pu_bacteria 2600255288 2601649330 266
183 iso_pu_bacteria 2600255289 2601654257 266
184 iso_pu_bacteria 2600255290 2601659679 266
185 iso_pu_bacteria 2600255291 2601664101 266
186 iso_pu_bacteria 2600255298 2601697061 266
187 iso_pu_bacteria 2600255299 2601702107 266
188 iso_pu_bacteria 2600255300 2601707001 266
189 iso_pu_bacteria 2600255301 2601712047 266
190 iso_pu_bacteria 2600255302 2601717518 266
191 iso_pu_bacteria 2600255303 2601722213 266
192 iso_pu_bacteria 2600255304 2601727446 266
193 iso_pu_bacteria 2600255305 2601732489 266
194 iso_pu_bacteria 2600255306 2601736996 266
195 iso_pu_bacteria 2600255307 2601741278 266
196 iso_pu_bacteria 2600255309 2601752468 266
197 iso_pu_bacteria 2600255310 2601758689 266
198 iso_pu_bacteria 2600255311 2601764803 266
199 iso_pu_bacteria 2600255392 2602019309 266
200 iso_pu_bacteria 2602042046 2603636845 266
201 iso_pu_bacteria 2602042047 2603645402 266
202 iso_pu_bacteria 2602042052 2603662264 266
203 iso_pu_bacteria 2602042053 2603667160 266
204 iso_pu_bacteria 2602042066 2603699376 266
205 iso_pu_bacteria 2602042067 2603705405 266
206 iso_pu_bacteria 2602042103 2603839870 266
207 iso_pu_bacteria 2602042104 2603844947 266
208 iso_pu_bacteria 2602042105 2603850049 266
209 iso_pu_bacteria 2602042106 2603855088 266
210 iso_pu_bacteria 2602042109 2603867903 266
211 iso_pu_bacteria 2602042110 2603872668 266
212 iso_pu_bacteria 2602042111 2603877971 266
213 iso_pu_bacteria 2603880178 2606049875 266
214 iso_pu_bacteria 2603880184 2606071536 266
215 iso_pu_bacteria 2603880202 2606147532 266
216 iso_pu_bacteria 2603880211 2606177764 266
217 iso_pu_bacteria 2609459761 2609909619 266
218 iso_pu_bacteria 2636415599 2637224045 266
219 iso_pu_bacteria 2667528172 2671101084 266
220 iso_pu_bacteria 2675903046 2676405453 266
221 iso_pu_bacteria 2681812866 2681996186 266
222 iso_pu_bacteria 2681812869 2682006478 266
223 iso_pu_bacteria 2711768156 2712468849 266
224 iso_pu_bacteria 2751185917 2753856952 266
225 iso_pu_bacteria 2765235842 2765590057 266
226 iso_pu_bacteria 2775506706 2775541271 266
227 iso_pu_bacteria 2775507074 2777020982 266
228 iso_pu_bacteria 2791354903 2791922323 266
229 iso_pu_bacteria 2791355010 2792311985 266
230 iso_pu_bacteria 2791355275 2793404705 266
231 iso_pu_bacteria 2811995292 2813727855 266
232 iso_pu_bacteria 2814123068 2814695398 266
233 iso_pu_bacteria 2821118458 2821121076 266
234 iso_pu_bacteria 2823373977 2823375710 266
235 iso_pu_bacteria 2844425489 2844428401 266
236 iso_pu_bacteria 2884086401 2884087837 266
237 iso_pu_bacteria 2904513164 2904515359 266
238 iso_pu_bacteria 2919108558 2919111009 266
239 iso_pu_bacteria 2923634449 2923635925 266
240 iso_pu_bacteria 2927833300 2927837577 266
241 iso_pu_bacteria 2935625433 2935625734 266
242 iso_pu_bacteria 2937539931 2937542410 266
243 iso_pu_bacteria 2939568625 2939570072 266
244 iso_pu_bacteria 2939573065 2939575392 266
245 iso_pu_bacteria 2939607340 2939608650 266
246 iso_pu_bacteria 2939617950 2939618517 266
247 iso_pu_bacteria 2939642701 2939642909 266
248 iso_pu_bacteria 2945874760 2945876807 266
249 iso_pu_bacteria 2969079654 2969081079 266
250 iso_pu_bacteria 2971820967 2971822453 266
251 iso_pu_bacteria 2974310843 2974311055 266
252 iso_pu_bacteria 2974435778 2974439312 266
253 iso_pu_bacteria 2984559226 2984563537 266
254 iso_pu_bacteria 2984595703 2984596271 266
255 iso_pu_bacteria 8018221730 8018223596 266
256 iso_pu_bacteria 8018405270 8018409205 266
257 iso_pu_bacteria 8019504834 8019505145 266
258 iso_pu_bacteria 8055087960 8055092197 266
259 iso_pu_bacteria 8055092621 8055095523 266
260 iso_pu_bacteria 8055097453 8055100233 266
261 iso_pu_bacteria 8057304971 8057306734 266
262 3300001989 JGI24739J22299_10000804 JGI24739J22299_100008045 267
263 3300002737 JGI25162J39368_1002185 JGI25162J39368_10021854 267
264 3300003856 Ga0058692_1008497 Ga0058692_10084972 267
265 3300003856 Ga0058692_1008671 Ga0058692_10086712 267
266 3300005347 Ga0070668_100002858 Ga0070668_10000285812 267
267 3300005548 Ga0070665_100045237 Ga0070665_1000452374 267
268 3300009011 Ga0105251_10009710 Ga0105251_100097102 267
269 3300009011 Ga0105251_10121336 Ga0105251_101213361 267
270 3300009036 Ga0105244_10001240 Ga0105244_1000124021 267
271 3300009036 Ga0105244_10034864 Ga0105244_100348642 267
272 3300009092 Ga0105250_10055493 Ga0105250_100554932 267
273 3300009545 Ga0105237_10056445 Ga0105237_100564453 267
274 3300011119 Ga0105246_10199582 Ga0105246_101995822 267
275 3300013102 Ga0157371_10052867 Ga0157371_100528673 267
276 3300013102 Ga0157371_10260356 Ga0157371_102603562 267
277 3300013104 Ga0157370_10003773 Ga0157370_1000377317 267
278 3300013104 Ga0157370_10136911 Ga0157370_101369112 267
279 3300013105 Ga0157369_10184860 Ga0157369_101848602 267
280 3300013105 Ga0157369_10298083 Ga0157369_102980832 267
281 3300013306 Ga0163162_10054186 Ga0163162_100541863 267
282 3300013307 Ga0157372_10009908 Ga0157372_100099083 267
283 3300013307 Ga0157372_10533397 Ga0157372_105333971 267
284 3300015261 Ga0182006_1004296 Ga0182006_10042964 267
285 3300015261 Ga0182006_1052767 Ga0182006_10527672 267
286 3300017792 Ga0163161_10020809 Ga0163161_100208092 267
287 3300025233 Ga0209437_100103 Ga0209437_100103121 267
288 3300025711 Ga0207696_1000490 Ga0207696_100049013 267
289 3300025728 Ga0207655_1020061 Ga0207655_10200612 267
290 3300025728 Ga0207655_1029112 Ga0207655_10291122 267
291 3300025735 Ga0207713_1000001 Ga0207713_10000011856 267
292 3300025735 Ga0207713_1075047 Ga0207713_10750472 267
293 3300027312 Ga0209371_1000005 Ga0209371_1000005934 267
294 3300027312 Ga0209371_1000688 Ga0209371_100068829 267
295 3300027312 Ga0209371_1001511 Ga0209371_10015113 267
296 3300027312 Ga0209371_1004305 Ga0209371_10043055 267
297 3300027312 Ga0209371_1021442 Ga0209371_10214422 267
298 3300030500 Ga0268256_1000006 Ga0268256_1000006123 267
299 3300030500 Ga0268256_1001195 Ga0268256_100119514 267
300 3300030500 Ga0268256_1009429 Ga0268256_10094292 267
301 3300041405 Ga0439438_017145 Ga0439438_017145_1211_2014 267
302 3300041407 Ga0439447_002475 Ga0439447_002475_3285_4088 267
303 3300041407 Ga0439447_007467 Ga0439447_007467_602_1405 267
304 3300041411 Ga0439466_0000001 Ga0439466_0000001_432280_433083 267
305 3300042006 Ga0439432_076743 Ga0439432_076743_21_824 267
306 3300042010 Ga0439452_000015 Ga0439452_000015_75391_76194 267
307 3300042016 Ga0439463_021283 Ga0439463_021283_520_1323 267
308 3300042146 Ga0450907_000304 Ga0450907_000304_11338_12141 267
309 3300042439 Ga0439464_0003523 Ga0439464_0003523_2721_3524 267
310 3300046458 Ga0495591_005762 Ga0495591_005762_4435_5238 267
311 3300046500 Ga0495596_0023395 Ga0495596_0023395_283_1086 267
312 3300046524 Ga0495648_0008155 Ga0495648_0008155_6691_7494 267
313 3300046810 Ga0495660_0009485 Ga0495660_0009485_2137_2940 267
314 3300047320 Ga0495672_0000009 Ga0495672_0000009_128984_129799 267
315 3300047320 Ga0495672_0000038 Ga0495672_0000038_93981_94784 267
316 3300047446 Ga0495679_003712 Ga0495679_003712_2800_3603 267
317 3300048905 Ga0496102_0054685 Ga0496102_0054685_415_1218 267
318 3300048905 Ga0496102_0174353 Ga0496102_0174353_234_1037 267
319 3300048907 Ga0496104_0163759 Ga0496104_0163759_342_1145 267
320 3300048908 Ga0496105_0009468 Ga0496105_0009468_6198_7001 267
321 3300048919 Ga0496116_0000788 Ga0496116_0000788_867_1670 267
322 3300048919 Ga0496116_0034380 Ga0496116_0034380_2016_2819 267
323 3300048920 Ga0496117_0000009 Ga0496117_0000009_545415_546218 267
324 3300048920 Ga0496117_0000113 Ga0496117_0000113_58852_59655 267
325 3300048920 Ga0496117_0001337 Ga0496117_0001337_9316_10119 267
326 3300048920 Ga0496117_0075492 Ga0496117_0075492_554_1357 267
327 3300048921 Ga0496118_0000017 Ga0496118_0000017_481101_481904 267
328 3300048921 Ga0496118_0000471 Ga0496118_0000471_7831_8634 267
329 3300048921 Ga0496118_0003213 Ga0496118_0003213_13325_14128 267
330 3300048921 Ga0496118_0063227 Ga0496118_0063227_1013_1816 267
331 3300048921 Ga0496118_0103955 Ga0496118_0103955_997_1800 267
332 3300048922 Ga0496119_0000129 Ga0496119_0000129_57524_58327 267
333 3300048922 Ga0496119_0000202 Ga0496119_0000202_61007_61810 267
334 3300048922 Ga0496119_0004305 Ga0496119_0004305_12462_13265 267
335 3300048923 Ga0496120_0000186 Ga0496120_0000186_48245_49048 267
336 3300048923 Ga0496120_0000291 Ga0496120_0000291_22545_23348 267
337 3300048923 Ga0496120_0003109 Ga0496120_0003109_894_1697 267
338 3300048924 Ga0496121_0000224 Ga0496121_0000224_72543_73346 267
339 3300048925 Ga0496122_0001179 Ga0496122_0001179_21293_22096 267
340 3300048925 Ga0496122_0134899 Ga0496122_0134899_526_1329 267
341 3300048926 Ga0496123_0055891 Ga0496123_0055891_200_1003 267
342 3300048927 Ga0496124_0001356 Ga0496124_0001356_11584_12387 267
343 3300048927 Ga0496124_0007002 Ga0496124_0007002_7680_8483 267
344 3300048927 Ga0496124_0157476 Ga0496124_0157476_68_871 267
345 3300048928 Ga0496125_0026916 Ga0496125_0026916_591_1394 267
346 3300048929 Ga0496126_0106003 Ga0496126_0106003_672_1475 267
347 3300048929 Ga0496126_0211078 Ga0496126_0211078_200_1003 267
348 3300049459 Ga0495678_009631 Ga0495678_009631_3621_4424 267
349 iso_pu_bacteria 2671180115 2671584506 267
350 iso_pu_bacteria 2847085930 2847086588 267
351 iso_pu_bacteria 2908669403 2908672464 267
352 iso_pu_bacteria 8054844752 8054846665 267
353 3300003856 Ga0058692_1000079 Ga0058692_10000796 268
354 3300003856 Ga0058692_1002561 Ga0058692_10025612 268
355 3300003856 Ga0058692_1013482 Ga0058692_10134821 268
356 3300005272 Ga0065703_1018830 Ga0065703_10188303 268
357 3300006946 Ga0079104_1002388 Ga0079104_10023883 268
358 3300006946 Ga0079104_1016611 Ga0079104_10166112 268
359 3300009011 Ga0105251_10000329 Ga0105251_100003295 268
360 3300009011 Ga0105251_10000644 Ga0105251_1000064428 268
361 3300009011 Ga0105251_10000779 Ga0105251_100007796 268
362 3300009036 Ga0105244_10001249 Ga0105244_100012498 268
363 3300009036 Ga0105244_10002689 Ga0105244_100026898 268
364 3300009036 Ga0105244_10009831 Ga0105244_100098312 268
365 3300009036 Ga0105244_10038476 Ga0105244_100384762 268
366 3300009092 Ga0105250_10001093 Ga0105250_100010935 268
367 3300009092 Ga0105250_10017613 Ga0105250_100176132 268
368 3300009101 Ga0105247_10000166 Ga0105247_1000016629 268
369 3300009174 Ga0105241_10000001 Ga0105241_10000001721 268
370 3300011119 Ga0105246_10362641 Ga0105246_103626411 268
371 3300013100 Ga0157373_10000400 Ga0157373_1000040035 268
372 3300013100 Ga0157373_10019103 Ga0157373_100191033 268
373 3300013100 Ga0157373_10021414 Ga0157373_100214144 268
374 3300013102 Ga0157371_10001036 Ga0157371_1000103621 268
375 3300013102 Ga0157371_10004097 Ga0157371_100040974 268
376 3300013306 Ga0163162_10032321 Ga0163162_100323214 268
377 3300014497 Ga0182008_10001168 Ga0182008_1000116817 268
378 3300017792 Ga0163161_10000003 Ga0163161_10000003159 268
379 3300025711 Ga0207696_1000001 Ga0207696_10000012360 268
380 3300025711 Ga0207696_1000124 Ga0207696_100012485 268
381 3300025728 Ga0207655_1000007 Ga0207655_1000007608 268
382 3300025728 Ga0207655_1000041 Ga0207655_100004140 268
383 3300025735 Ga0207713_1000070 Ga0207713_1000070161 268
384 3300025735 Ga0207713_1000072 Ga0207713_1000072162 268
385 3300025735 Ga0207713_1001731 Ga0207713_10017316 268
386 3300025735 Ga0207713_1029145 Ga0207713_10291452 268
387 3300025900 Ga0207710_10000051 Ga0207710_1000005129 268
388 3300025911 Ga0207654_10000004 Ga0207654_10000004749 268
389 3300027111 Ga0209281_1000038 Ga0209281_1000038163 268
390 3300027111 Ga0209281_1012356 Ga0209281_10123562 268
391 3300027312 Ga0209371_1000118 Ga0209371_100011869 268
392 3300027312 Ga0209371_1000559 Ga0209371_100055932 268
393 3300027312 Ga0209371_1005909 Ga0209371_10059095 268
394 3300030500 Ga0268256_1000100 Ga0268256_100010069 268
395 3300030500 Ga0268256_1000960 Ga0268256_100096018 268
396 3300030500 Ga0268256_1009856 Ga0268256_10098561 268
397 3300041405 Ga0439438_000002 Ga0439438_000002_371627_372433 268
398 3300041407 Ga0439447_001619 Ga0439447_001619_6315_7121 268
399 3300042006 Ga0439432_002151 Ga0439432_002151_4202_5008 268
400 3300042006 Ga0439432_031453 Ga0439432_031453_485_1306 268
401 3300046453 Ga0495627_000044 Ga0495627_000044_25584_26405 268
402 3300046458 Ga0495591_000001 Ga0495591_000001_288216_289022 268
403 3300046530 Ga0495654_0000009 Ga0495654_0000009_312698_313504 268
404 3300046530 Ga0495654_0027772 Ga0495654_0027772_2052_2873 268
405 3300046616 Ga0495668_0053856 Ga0495668_0053856_80_886 268
406 3300046794 Ga0495589_0000003 Ga0495589_0000003_290295_291116 268
407 3300048904 Ga0496101_0000060 Ga0496101_0000060_31442_32248 268
408 3300048919 Ga0496116_0000007 Ga0496116_0000007_326075_326896 268
409 3300048919 Ga0496116_0000446 Ga0496116_0000446_29486_30292 268
410 3300048920 Ga0496117_0003513 Ga0496117_0003513_8031_8852 268
411 3300048920 Ga0496117_0072833 Ga0496117_0072833_1095_1916 268
412 3300048921 Ga0496118_0002398 Ga0496118_0002398_16440_17261 268
413 3300048922 Ga0496119_0000359 Ga0496119_0000359_62415_63236 268
414 3300048922 Ga0496119_0001060 Ga0496119_0001060_33559_34380 268
415 3300048922 Ga0496119_0005772 Ga0496119_0005772_6927_7733 268
416 3300048922 Ga0496119_0059242 Ga0496119_0059242_712_1533 268
417 3300048923 Ga0496120_0000179 Ga0496120_0000179_38487_39293 268
418 3300048923 Ga0496120_0000403 Ga0496120_0000403_29032_29853 268
419 3300048923 Ga0496120_0000492 Ga0496120_0000492_21540_22361 268
420 3300048923 Ga0496120_0001390 Ga0496120_0001390_6081_6887 268
421 3300048925 Ga0496122_0039285 Ga0496122_0039285_2209_3015 268
422 3300048926 Ga0496123_0002106 Ga0496123_0002106_22436_23242 268
423 3300048927 Ga0496124_0000028 Ga0496124_0000028_144749_145570 268
424 3300048927 Ga0496124_0000738 Ga0496124_0000738_20926_21732 268
425 3300048927 Ga0496124_0020051 Ga0496124_0020051_1478_2284 268
426 3300048927 Ga0496124_0166675 Ga0496124_0166675_384_1190 268
427 3300048929 Ga0496126_0113052 Ga0496126_0113052_511_1317 268
428 iso_pu_bacteria 2852103415 2852107056 268
429 iso_pu_bacteria 2891670763 2891672375 268
430 3300009011 Ga0105251_10008997 Ga0105251_100089975 269
431 3300046530 Ga0495654_0003389 Ga0495654_0003389_8171_8986 269
432 3300046530 Ga0495654_0016414 Ga0495654_0016414_2278_3102 269
433 3300046660 Ga0495625_0004935 Ga0495625_0004935_8346_9170 269
434 3300047446 Ga0495679_000032 Ga0495679_000032_41525_42349 269
435 iso_pu_bacteria 2706794495 2707098860 269
436 iso_pu_bacteria 2854601825 2854606085 269
437 3300002773 JGI25152J39213_1000591 JGI25152J39213_100059122 270
438 3300003320 rootH2_10038029 rootH2_100380292 270
439 3300003856 Ga0058692_1018949 Ga0058692_10189492 270
440 3300005289 Ga0065704_10073081 Ga0065704_100730816 270
441 3300005289 Ga0065704_10076660 Ga0065704_100766605 270
442 3300005289 Ga0065704_10076836 Ga0065704_100768363 270
443 3300005289 Ga0065704_10107038 Ga0065704_101070382 270
444 3300005366 Ga0070659_100098409 Ga0070659_1000984093 270
445 3300005548 Ga0070665_100000374 Ga0070665_10000037430 270
446 3300005577 Ga0068857_100000051 Ga0068857_10000005132 270
447 3300005834 Ga0068851_10016990 Ga0068851_100169903 270
448 3300006051 Ga0075364_10023125 Ga0075364_100231254 270
449 3300006946 Ga0079104_1000120 Ga0079104_100012070 270
450 3300006946 Ga0079104_1000376 Ga0079104_100037630 270
451 3300006946 Ga0079104_1003319 Ga0079104_10033196 270
452 3300006946 Ga0079104_1003324 Ga0079104_10033242 270
453 3300006946 Ga0079104_1004879 Ga0079104_10048792 270
454 3300006946 Ga0079104_1012496 Ga0079104_10124962 270
455 3300006946 Ga0079104_1012498 Ga0079104_10124982 270
456 3300006946 Ga0079104_1038506 Ga0079104_10385062 270
457 3300009011 Ga0105251_10000502 Ga0105251_1000050235 270
458 3300009011 Ga0105251_10028596 Ga0105251_100285962 270
459 3300009011 Ga0105251_10030329 Ga0105251_100303293 270
460 3300009011 Ga0105251_10060792 Ga0105251_100607923 270
461 3300009036 Ga0105244_10000224 Ga0105244_1000022424 270
462 3300009036 Ga0105244_10000342 Ga0105244_1000034244 270
463 3300009036 Ga0105244_10001037 Ga0105244_1000103713 270
464 3300009036 Ga0105244_10032936 Ga0105244_100329362 270
465 3300009036 Ga0105244_10033088 Ga0105244_100330882 270
466 3300009036 Ga0105244_10043305 Ga0105244_100433052 270
467 3300009036 Ga0105244_10081776 Ga0105244_100817762 270
468 3300009092 Ga0105250_10000018 Ga0105250_1000001837 270
469 3300009092 Ga0105250_10000080 Ga0105250_1000008029 270
470 3300009092 Ga0105250_10006131 Ga0105250_100061315 270
471 3300009092 Ga0105250_10042340 Ga0105250_100423402 270
472 3300009148 Ga0105243_10097075 Ga0105243_100970752 270
473 3300013100 Ga0157373_10020212 Ga0157373_100202124 270
474 3300013100 Ga0157373_10140929 Ga0157373_101409293 270
475 3300013102 Ga0157371_10033323 Ga0157371_100333233 270
476 3300013102 Ga0157371_10143280 Ga0157371_101432803 270
477 3300013104 Ga0157370_10012990 Ga0157370_100129905 270
478 3300013105 Ga0157369_10002014 Ga0157369_1000201417 270
479 3300013307 Ga0157372_10001081 Ga0157372_100010818 270
480 3300013307 Ga0157372_10004291 Ga0157372_100042919 270
481 3300015261 Ga0182006_1000024 Ga0182006_100002447 270
482 3300015679 Ga0183366_1001 Ga0183366_10012419 270
483 3300015680 Ga0183370_1001 Ga0183370_10012419 270
484 3300015685 Ga0183369_1001 Ga0183369_10012420 270
485 3300015687 Ga0183368_1001 Ga0183368_10012419 270
486 3300021384 Ga0213876_10000023 Ga0213876_1000002329 270
487 3300025258 Ga0209129_1000037 Ga0209129_1000037156 270
488 3300025711 Ga0207696_1000013 Ga0207696_1000013371 270
489 3300025711 Ga0207696_1000067 Ga0207696_1000067111 270
490 3300025711 Ga0207696_1000100 Ga0207696_100010029 270
491 3300025711 Ga0207696_1007110 Ga0207696_10071104 270
492 3300025711 Ga0207696_1007329 Ga0207696_10073293 270
493 3300025728 Ga0207655_1000002 Ga0207655_1000002222 270
494 3300025728 Ga0207655_1000004 Ga0207655_1000004214 270
495 3300025728 Ga0207655_1000062 Ga0207655_100006242 270
496 3300025728 Ga0207655_1000115 Ga0207655_100011598 270
497 3300025728 Ga0207655_1003992 Ga0207655_10039926 270
498 3300025728 Ga0207655_1012186 Ga0207655_10121862 270
499 3300025728 Ga0207655_1041705 Ga0207655_10417052 270
500 3300025728 Ga0207655_1060354 Ga0207655_10603542 270
501 3300025735 Ga0207713_1000023 Ga0207713_100002356 270
502 3300025735 Ga0207713_1000083 Ga0207713_100008382 270
503 3300025735 Ga0207713_1000241 Ga0207713_100024135 270
504 3300025735 Ga0207713_1014323 Ga0207713_10143232 270
505 3300025735 Ga0207713_1016307 Ga0207713_10163073 270
506 3300025735 Ga0207713_1027498 Ga0207713_10274982 270
507 3300025932 Ga0207690_10321801 Ga0207690_103218012 270
508 3300025935 Ga0207709_10055136 Ga0207709_100551362 270
509 3300026116 Ga0207674_10000718 Ga0207674_1000071833 270
510 3300027111 Ga0209281_1000004 Ga0209281_1000004181 270
511 3300027111 Ga0209281_1000014 Ga0209281_1000014337 270
512 3300027111 Ga0209281_1000219 Ga0209281_100021951 270
513 3300027111 Ga0209281_1000286 Ga0209281_100028652 270
514 3300027111 Ga0209281_1000340 Ga0209281_10003405 270
515 3300027111 Ga0209281_1000404 Ga0209281_100040428 270
516 3300027111 Ga0209281_1001735 Ga0209281_10017358 270
517 3300027111 Ga0209281_1003025 Ga0209281_10030252 270
518 3300027312 Ga0209371_1000001 Ga0209371_10000012413 270
519 3300027312 Ga0209371_1000015 Ga0209371_1000015327 270
520 3300027312 Ga0209371_1000108 Ga0209371_100010866 270
521 3300027312 Ga0209371_1002228 Ga0209371_10022286 270
522 3300027312 Ga0209371_1003936 Ga0209371_10039365 270
523 3300027312 Ga0209371_1006768 Ga0209371_10067683 270
524 3300027312 Ga0209371_1007785 Ga0209371_10077854 270
525 3300028379 Ga0268266_10000894 Ga0268266_1000089429 270
526 3300030500 Ga0268256_1000001 Ga0268256_1000001227 270
527 3300030500 Ga0268256_1000018 Ga0268256_1000018297 270
528 3300030500 Ga0268256_1000076 Ga0268256_1000076135 270
529 3300030500 Ga0268256_1001450 Ga0268256_100145014 270
530 3300030500 Ga0268256_1002785 Ga0268256_10027853 270
531 3300030500 Ga0268256_1004927 Ga0268256_10049274 270
532 3300030500 Ga0268256_1008031 Ga0268256_10080312 270
533 3300030500 Ga0268256_1040818 Ga0268256_10408182 270
534 3300039437 Ga0436365_0965775 Ga0436365_0965775_43118_43930 270
535 3300041405 Ga0439438_002312 Ga0439438_002312_6060_6872 270
536 3300041512 Ga0451853_0044574 Ga0451853_0044574_5184_5996 270
537 3300042006 Ga0439432_013099 Ga0439432_013099_1457_2269 270
538 3300042010 Ga0439452_000002 Ga0439452_000002_208323_209135 270
539 3300042010 Ga0439452_000037 Ga0439452_000037_144359_145171 270
540 3300042010 Ga0439452_000193 Ga0439452_000193_31247_32059 270
541 3300042010 Ga0439452_001418 Ga0439452_001418_4896_5708 270
542 3300044669 Ga0466981_0000013 Ga0466981_0000013_56153_56965 270
543 3300046458 Ga0495591_000341 Ga0495591_000341_5167_5979 270
544 3300046458 Ga0495591_002220 Ga0495591_002220_5086_5898 270
545 3300046458 Ga0495591_002225 Ga0495591_002225_3365_4180 270
546 3300046461 Ga0495641_0088258 Ga0495641_0088258_408_1223 270
547 3300046471 Ga0495650_0000047 Ga0495650_0000047_25566_26378 270
548 3300046471 Ga0495650_0000065 Ga0495650_0000065_135653_136468 270
549 3300046474 Ga0495605_0035053 Ga0495605_0035053_926_1741 270
550 3300046501 Ga0495607_0010601 Ga0495607_0010601_50_865 270
551 3300046507 Ga0495606_0004825 Ga0495606_0004825_2447_3262 270
552 3300046518 Ga0495631_0075947 Ga0495631_0075947_481_1296 270
553 3300046530 Ga0495654_0000190 Ga0495654_0000190_36638_37453 270
554 3300046530 Ga0495654_0012526 Ga0495654_0012526_466_1278 270
555 3300046530 Ga0495654_0080702 Ga0495654_0080702_674_1489 270
556 3300046692 Ga0495671_0005708 Ga0495671_0005708_4656_5471 270
557 3300046694 Ga0495649_0006401 Ga0495649_0006401_5640_6452 270
558 3300046694 Ga0495649_0141491 Ga0495649_0141491_437_1252 270
559 3300046794 Ga0495589_0018448 Ga0495589_0018448_1815_2630 270
560 3300046810 Ga0495660_0000017 Ga0495660_0000017_37292_38107 270
561 3300047320 Ga0495672_0000001 Ga0495672_0000001_1159714_1160529 270
562 3300047446 Ga0495679_008773 Ga0495679_008773_1330_2142 270
563 3300047469 Ga0495673_0000019 Ga0495673_0000019_269157_269972 270
564 3300047469 Ga0495673_0000071 Ga0495673_0000071_156085_156897 270
565 3300048907 Ga0496104_0000212 Ga0496104_0000212_42118_42930 270
566 3300048907 Ga0496104_0178299 Ga0496104_0178299_813_1625 270
567 3300048919 Ga0496116_0000426 Ga0496116_0000426_27874_28689 270
568 3300048919 Ga0496116_0005290 Ga0496116_0005290_11004_11816 270
569 3300048919 Ga0496116_0010872 Ga0496116_0010872_5955_6767 270
570 3300048919 Ga0496116_0123970 Ga0496116_0123970_413_1225 270
571 3300048920 Ga0496117_0022085 Ga0496117_0022085_3479_4291 270
572 3300048920 Ga0496117_0031324 Ga0496117_0031324_189_1001 270
573 3300048920 Ga0496117_0051121 Ga0496117_0051121_23_835 270
574 3300048920 Ga0496117_0114602 Ga0496117_0114602_36_848 270
575 3300048921 Ga0496118_0003672 Ga0496118_0003672_3824_4636 270
576 3300048921 Ga0496118_0010920 Ga0496118_0010920_780_1592 270
577 3300048921 Ga0496118_0049657 Ga0496118_0049657_1542_2354 270
578 3300048921 Ga0496118_0117790 Ga0496118_0117790_719_1531 270
579 3300048922 Ga0496119_0000012 Ga0496119_0000012_343964_344779 270
580 3300048922 Ga0496119_0000013 Ga0496119_0000013_5752_6564 270
581 3300048922 Ga0496119_0008448 Ga0496119_0008448_7407_8219 270
582 3300048922 Ga0496119_0010600 Ga0496119_0010600_2264_3079 270
583 3300048922 Ga0496119_0043037 Ga0496119_0043037_762_1574 270
584 3300048922 Ga0496119_0048768 Ga0496119_0048768_1027_1839 270
585 3300048923 Ga0496120_0000004 Ga0496120_0000004_67139_67954 270
586 3300048923 Ga0496120_0000081 Ga0496120_0000081_64451_65266 270
587 3300048923 Ga0496120_0003554 Ga0496120_0003554_500_1312 270
588 3300048923 Ga0496120_0005646 Ga0496120_0005646_5186_5998 270
589 3300048923 Ga0496120_0020148 Ga0496120_0020148_659_1471 270
590 3300048924 Ga0496121_0007739 Ga0496121_0007739_12003_12815 270
591 3300048924 Ga0496121_0016597 Ga0496121_0016597_5956_6768 270
592 3300048924 Ga0496121_0074560 Ga0496121_0074560_1126_1938 270
593 3300048925 Ga0496122_0000003 Ga0496122_0000003_524833_525645 270
594 3300048925 Ga0496122_0000803 Ga0496122_0000803_25676_26488 270
595 3300048925 Ga0496122_0004253 Ga0496122_0004253_16324_17136 270
596 3300048925 Ga0496122_0005488 Ga0496122_0005488_703_1515 270
597 3300048925 Ga0496122_0020144 Ga0496122_0020144_4378_5190 270
598 3300048925 Ga0496122_0073855 Ga0496122_0073855_968_1780 270
599 3300048926 Ga0496123_0000012 Ga0496123_0000012_280016_280828 270
600 3300048926 Ga0496123_0000140 Ga0496123_0000140_26143_26955 270
601 3300048926 Ga0496123_0002927 Ga0496123_0002927_2846_3658 270
602 3300048926 Ga0496123_0005912 Ga0496123_0005912_6803_7615 270
603 3300048926 Ga0496123_0030515 Ga0496123_0030515_1245_2057 270
604 3300048926 Ga0496123_0056882 Ga0496123_0056882_772_1584 270
605 3300048926 Ga0496123_0068739 Ga0496123_0068739_48_860 270
606 3300048927 Ga0496124_0000060 Ga0496124_0000060_4048_4860 270
607 3300048927 Ga0496124_0001085 Ga0496124_0001085_35702_36514 270
608 3300048927 Ga0496124_0012739 Ga0496124_0012739_2441_3253 270
609 3300048927 Ga0496124_0051821 Ga0496124_0051821_1175_1987 270
610 3300048928 Ga0496125_0000296 Ga0496125_0000296_29721_30533 270
611 3300048928 Ga0496125_0006723 Ga0496125_0006723_4384_5196 270
612 3300048928 Ga0496125_0019039 Ga0496125_0019039_800_1612 270
613 3300048928 Ga0496125_0032917 Ga0496125_0032917_2794_3606 270
614 3300048928 Ga0496125_0033000 Ga0496125_0033000_2786_3598 270
615 3300048928 Ga0496125_0061893 Ga0496125_0061893_80_892 270
616 3300048928 Ga0496125_0078071 Ga0496125_0078071_762_1574 270
617 3300048928 Ga0496125_0112446 Ga0496125_0112446_1043_1855 270
618 3300048928 Ga0496125_0300057 Ga0496125_0300057_113_925 270
619 3300048929 Ga0496126_0006168 Ga0496126_0006168_6836_7648 270
620 3300048929 Ga0496126_0016003 Ga0496126_0016003_5890_6702 270
621 3300048929 Ga0496126_0052893 Ga0496126_0052893_2081_2893 270
622 3300048929 Ga0496126_0058362 Ga0496126_0058362_1941_2753 270
623 3300048929 Ga0496126_0171420 Ga0496126_0171420_800_1612 270
624 3300049459 Ga0495678_000231 Ga0495678_000231_2771_3586 270
625 3300049460 Ga0495682_0000164 Ga0495682_0000164_31063_31878 270
626 3300050491 nmdc:mga00v17_201487_c1 nmdc:mga00v17_201487_c1_21_833 270
627 3300050491 nmdc:mga00v17_3354_c1 nmdc:mga00v17_3354_c1_6365_7177 270
628 3300050493 nmdc:mga0k408_142912_c1 nmdc:mga0k408_142912_c1_602_1414 270
629 3300053126 Ga0500621_000005 Ga0500621_000005_24360_25175 270
630 3300006946 Ga0079104_1000135 Ga0079104_100013593 271
631 3300009036 Ga0105244_10000919 Ga0105244_1000091916 271
632 3300009036 Ga0105244_10009873 Ga0105244_100098732 271
633 3300013104 Ga0157370_10000618 Ga0157370_1000061839 271
634 3300025728 Ga0207655_1000205 Ga0207655_100020510 271
635 3300027111 Ga0209281_1000095 Ga0209281_1000095148 271
636 iso_pu_bacteria 2846540461 2846540671 271
637 iso_pu_bacteria 2585427591 2585827699 272
638 iso_pu_bacteria 2585427592 2585834811 272
639 iso_pu_bacteria 2667528173 2671107138 272
640 iso_pu_bacteria 2904474040 2904476062 272
641 iso_pu_bacteria 2904504865 2904506482 272
642 iso_pu_bacteria 2919150387 2919152231 272
643 iso_pu_bacteria 2927143783 2927144900 272
644 iso_pu_bacteria 2537561728 2538425422 274
645 iso_pu_bacteria 2855195626 2855197389 274
646 iso_pu_bacteria 2858466076 2858468361 274
647 iso_pu_bacteria 2871272651 2871275978 274
648 iso_pu_bacteria 2871282230 2871285834 274
649 iso_pu_bacteria 2900051742 2900053004 274
650 2162886007 SwRhRL2b_contig_2482997 SwRhRL2b_0468.00005120 276
651 3300002737 JGI25162J39368_1000002 JGI25162J39368_1000002356 276
652 3300002771 JGI25163J39215_1000175 JGI25163J39215_100017520 276
653 3300002772 JGI25164J39214_1000006 JGI25164J39214_1000006242 276
654 3300003751 Ga0055538_1000003 Ga0055538_1000003356 276
655 3300003752 Ga0055539_1000003 Ga0055539_1000003262 276
656 3300003756 Ga0055533_1000005 Ga0055533_1000005262 276
657 3300003759 Ga0055525_1000005 Ga0055525_1000005356 276
658 3300003841 Ga0055541_1000003 Ga0055541_1000003356 276
659 3300005289 Ga0065704_10000837 Ga0065704_1000083710 276
660 3300009036 Ga0105244_10000731 Ga0105244_100007317 276
661 3300009092 Ga0105250_10000007 Ga0105250_10000007214 276
662 3300009092 Ga0105250_10000344 Ga0105250_100003445 276
663 3300013102 Ga0157371_10000006 Ga0157371_10000006106 276
664 3300013306 Ga0163162_10021644 Ga0163162_100216446 276
665 3300025207 Ga0209760_100093 Ga0209760_10009350 276
666 3300025224 Ga0209784_100001 Ga0209784_1000013020 276
667 3300025225 Ga0209566_100001 Ga0209566_1000013020 276
668 3300025226 Ga0209674_100002 Ga0209674_1000023020 276
669 3300025230 Ga0209563_100002 Ga0209563_1000021555 276
670 3300025231 Ga0207427_100009 Ga0207427_100009353 276
671 3300025233 Ga0209437_100001 Ga0209437_1000011555 276
672 3300025253 Ga0209677_100002 Ga0209677_1000021555 276
673 3300025711 Ga0207696_1000029 Ga0207696_1000029249 276
674 3300025711 Ga0207696_1000467 Ga0207696_10004675 276
675 3300025728 Ga0207655_1000697 Ga0207655_100069727 276
676 3300042532 Ga0450893_0016302 Ga0450893_0016302_407_1237 276
677 3300046471 Ga0495650_0000018 Ga0495650_0000018_26981_27811 276
678 3300046810 Ga0495660_0000004 Ga0495660_0000004_262048_262878 276
679 3300047470 Ga0495681_0053164 Ga0495681_0053164_64_894 276
680 3300048907 Ga0496104_0008460 Ga0496104_0008460_3090_3920 276
681 3300048919 Ga0496116_0000118 Ga0496116_0000118_140337_141167 276
682 3300048920 Ga0496117_0008647 Ga0496117_0008647_3184_4014 276
683 3300048921 Ga0496118_0006402 Ga0496118_0006402_3370_4200 276
684 3300048922 Ga0496119_0008701 Ga0496119_0008701_4164_4994 276
685 3300048923 Ga0496120_0059524 Ga0496120_0059524_903_1733 276
686 3300048925 Ga0496122_0000303 Ga0496122_0000303_27901_28731 276
687 3300048926 Ga0496123_0000250 Ga0496123_0000250_79938_80768 276
688 3300048927 Ga0496124_0000027 Ga0496124_0000027_253591_254421 276
689 3300048928 Ga0496125_0000052 Ga0496125_0000052_165772_166602 276
690 3300048929 Ga0496126_0001215 Ga0496126_0001215_14203_15033 276
691 iso_pu_bacteria 8055693939 8055696889 276

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01416

PseudoU_synth_1

tRNA pseudouridine synthase

143

249

0.97

PF01416

PseudoU_synth_1

tRNA pseudouridine synthase

8

102

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2nr0-assembly1.cif.gz_B crystal structure of pseudoudirinde synthase trua in complex with leucyl trna 0.9725 16 276
2nre-assembly1.cif.gz_A-2 crystal structure of pseudoudirinde synthase trua in complex with leucyl trna 0.9698 16 276
2nr0-assembly1.cif.gz_B crystal structure of pseudoudirinde synthase trua in complex with leucyl trna 0.9581 16 276
2nre-assembly1.cif.gz_A-2 crystal structure of pseudoudirinde synthase trua in complex with leucyl trna 0.9552 16 276
1vs3-assembly1.cif.gz_B crystal structure of the trna pseudouridine synthase trua from thermus thermophilus hb8 0.9261 16 260
ID Description Score Start End Superfamily
2nqpB01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Pseudouridine synthase I, catalytic domain, N-terminal subdomain 0.9932 16 119 3.30.70.580
2nreA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Pseudouridine synthase I, catalytic domain, C-terminal subdomain 0.9569 120 257 3.30.70.660
2nqpB01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Pseudouridine synthase I, catalytic domain, N-terminal subdomain 0.9566 16 119 3.30.70.580
af_A0A0R0F7R0_40_148_3.30.70.580 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Pseudouridine synthase I, catalytic domain, N-terminal subdomain 0.9514 16 119 3.30.70.580
af_Q2FW37_1_104_3.30.70.580 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Pseudouridine synthase I, catalytic domain, N-terminal subdomain 0.9505 17 117 3.30.70.580
ID Description Score Start End GO Terms
AF-A0A660N222-F1-model_v4 tRNA pseudouridine synthase (EC 5.4.99.12) 0.9874 17 107 GO:0003723
GO:0031119
GO:0160147
AF-A0A147GB59-F1-model_v4 deleted 0.9872 16 274
AF-A0A7Y7XU63-F1-model_v4 tRNA pseudouridine synthase A (EC 5.4.99.12) (tRNA pseudouridine(38-40) synthase) (tRNA pseudouridylate synthase I) (tRNA-uridine isomerase I) 0.9866 16 274 GO:0003723
GO:0031119
GO:0160147
AF-A0A2D8RG93-F1-model_v4 tRNA pseudouridine synthase A (EC 5.4.99.12) (tRNA pseudouridine(38-40) synthase) (tRNA pseudouridylate synthase I) (tRNA-uridine isomerase I) 0.9857 16 275 GO:0003723
GO:0031119
GO:0160147
AF-A0A3B1BD97-F1-model_v4 tRNA pseudouridine(38-40) synthase (EC 5.4.99.12) 0.9846 37 267 GO:0003723
GO:0031119
GO:0160147

Feature Viewer

pLDDT pTM Quality
89.5 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map