F475481

General Info

Members Datasets Scaffolds Average Seq Length
690 276 657 322

Family's Representative Sequence

Representative Sequence 3300046558|Ga0495633_0000470|Ga0495633_0000470_4817_5971
Length 384
Sequence MARTCKSSQISRLPRGAASSIPPQTASRGGDQIETLELDYPCFDFDPAAALSHRRSNTSHGRGKTMRLATRRDGSRDGRLILLSSDGSHFADAPVATLQAAMEAWADVHPVLSAIADFPHPLDPATLAAPLPRAWQWLDGSAFESHGALMDRVLGVVPEKTGRPLMYQGVSDHFYGPLDDVPMPDEALGIDFEGEFGVIVDTVPMGVTPDQAMAYIRLIVQINDWSLRALAGPEMKSGFGWVQAKPPCTMAPFAVTPDELGGQWRDGRVCMDLLVDWNGTRFGAANGEPMGFGFHDLVAHAARTRPLVAGTVIGSGTVSNPDFRQVGSSCIAERRGIEIVDEGAARTPFMRFGDRVRMEGRLPDGRAPFGIIDQQVVAYAGASS

Samples

Sample ID Description Type Environment
1 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
2 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
3 2643221558 Rhizobium sp. Root149 Isolate Unclassified
4 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
5 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
6 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
7 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
8 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
9 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
10 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
11 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
12 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
13 2896184354 Aurantiacibacter suaedae GH3-15 Isolate Rhizosphere
14 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
15 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
16 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
17 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
18 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere
19 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
20 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
21 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
22 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
23 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
24 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
25 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
26 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
27 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
28 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
29 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
30 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
31 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
32 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
33 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
34 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
35 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
36 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
37 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
38 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
39 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
40 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
41 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
42 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
43 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
44 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
45 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
46 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
47 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
48 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
49 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
50 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
51 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
52 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
53 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
54 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
55 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
56 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
57 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
58 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
59 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
60 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
61 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
62 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
63 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
64 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
65 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
66 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
67 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
68 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
69 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
70 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
71 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
72 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
73 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
74 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
75 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
76 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
77 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
78 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
79 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
80 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
81 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
82 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
83 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
84 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
86 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
100 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
101 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
102 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
103 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
110 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
111 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
112 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
113 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
114 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
115 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
118 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
169 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
173 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
174 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
175 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
176 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
177 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
178 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
179 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
180 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
181 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
182 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
183 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
184 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
185 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
186 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
187 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
188 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
189 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
190 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
191 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
192 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
193 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
194 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
195 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
196 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
197 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
198 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
199 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
200 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
201 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
202 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
203 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
204 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
205 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
206 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
207 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
208 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
209 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
210 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
211 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
212 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
213 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
214 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
215 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
216 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
217 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
218 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
219 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
220 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
221 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
222 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
223 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
224 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
225 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
226 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
227 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
228 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
229 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
230 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
231 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
232 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
233 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
234 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
235 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
236 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
237 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
238 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
239 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
240 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
241 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
242 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
243 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
244 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
245 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
246 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
247 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
248 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
249 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
250 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
251 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
253 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
254 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
255 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
256 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
257 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
258 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
259 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
260 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
261 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
262 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
263 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
264 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
265 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
266 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
267 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
268 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
269 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
270 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
271 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
272 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
273 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
274 8002745576 Marinomonas spartinae USM8 Isolate Rhizosphere
275 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
276 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.65
Metatranscriptomes 0
Isolates 4.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.67
Nodule 0
Rhizoplane 1.16
Rhizosphere 82.03
Stem 0
Stem Tuber 0
Unclassified 10.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1000219 3300001904 Bacteria 10342
2 JGI24741J21665_1000021 3300001915 Bacteria 37608
3 JGI24741J21665_1000068 3300001915 Bacteria 25347
4 JGI24741J21665_1000106 3300001915 Bacteria 22073
5 JGI24741J21665_1000204 3300001915 Bacteria 17636
6 JGI24741J21665_1001619 3300001915 Bacteria 6296
7 JGI24740J21852_10000043 3300001979 Bacteria 41252
8 JGI24740J21852_10001202 3300001979 Bacteria 11694
9 JGI24740J21852_10001360 3300001979 Bacteria 11160
10 JGI24740J21852_10004146 3300001979 Bacteria 6260
11 JGI24740J21852_10007599 3300001979 Bacteria 4390
12 JGI24739J22299_10001257 3300001989 Bacteria 9505
13 JGI24739J22299_10003195 3300001989 Bacteria 6247
14 JGI24739J22299_10007955 3300001989 Bacteria 3966
15 JGI24739J22299_10017169 3300001989 Bacteria 2614
16 JGI24737J22298_10000054 3300001990 Bacteria 33923
17 JGI24737J22298_10000947 3300001990 Bacteria 10302
18 JGI24737J22298_10001005 3300001990 Bacteria 9987
19 JGI24737J22298_10001250 3300001990 Bacteria 8990
20 JGI24737J22298_10003837 3300001990 Bacteria 5286
21 JGI24737J22298_10012428 3300001990 Bacteria 2776
22 JGI24737J22298_10022508 3300001990 Bacteria 2003
23 JGI24735J21928_10001235 3300002067 Bacteria 9077
24 JGI24735J21928_10003256 3300002067 Bacteria 5554
25 JGI24735J21928_10010665 3300002067 Bacteria 2924
26 JGI24738J21930_10000887 3300002075 Bacteria 8574
27 JGI24738J21930_10004705 3300002075 Bacteria 3324
28 JGI24744J21845_10004568 3300002077 Bacteria 2862
29 JGI25153J46596_10000005 3300003215 Bacteria 492839
30 rootH1_10058872 3300003316 Bacteria 9634
31 rootL2_10060416 3300003322 Bacteria 28530
32 rootL2_10095669 3300003322 Bacteria 1594
33 rootL2_10165326 3300003322 Bacteria 2278
34 rootL2_10201879 3300003322 Bacteria 2862
35 rootH1_10113965 3300003323 Bacteria 8147
36 Ga0055530_10028273 3300003791 Bacteria 1516
37 Ga0065704_10098629 3300005289 Bacteria 2345
38 Ga0070658_10000167 3300005327 Bacteria 57334
39 Ga0070658_10000180 3300005327 Bacteria 55242
40 Ga0070658_10000937 3300005327 Bacteria 24984
41 Ga0070658_10080612 3300005327 Bacteria 2673
42 Ga0070658_10153838 3300005327 Bacteria 1927
43 Ga0070658_10167781 3300005327 Bacteria 1843
44 Ga0070658_10287692 3300005327 Bacteria 1400
45 Ga0070676_10023574 3300005328 Bacteria 3460
46 Ga0070676_10210184 3300005328 Bacteria 1280
47 Ga0070683_100105391 3300005329 Bacteria 2658
48 Ga0070683_100133055 3300005329 Bacteria 2354
49 Ga0070670_100008343 3300005331 Bacteria 8831
50 Ga0070670_100036548 3300005331 Bacteria 4227
51 Ga0070670_100117660 3300005331 Bacteria 2292
52 Ga0070677_10033610 3300005333 Bacteria 1976
53 Ga0068869_100025861 3300005334 Bacteria 4080
54 Ga0070666_10036790 3300005335 Bacteria 3251
55 Ga0070666_10072946 3300005335 Bacteria 2338
56 Ga0070666_10077232 3300005335 Bacteria 2273
57 Ga0070666_10086650 3300005335 Bacteria 2146
58 Ga0070680_100000486 3300005336 Bacteria 27276
59 Ga0070660_100005124 3300005339 Bacteria 9052
60 Ga0070660_100014169 3300005339 Bacteria 5740
61 Ga0070660_100121065 3300005339 Bacteria 2088
62 Ga0070689_100030340 3300005340 Bacteria 4103
63 Ga0070691_10017513 3300005341 Bacteria 3297
64 Ga0070687_100079499 3300005343 Bacteria 1785
65 Ga0070661_100002081 3300005344 Bacteria 13777
66 Ga0070661_100015978 3300005344 Bacteria 5299
67 Ga0070661_100016878 3300005344 Bacteria 5168
68 Ga0070661_100056982 3300005344 Bacteria 2863
69 Ga0070661_100081024 3300005344 Bacteria 2396
70 Ga0070661_100111753 3300005344 Bacteria 2041
71 Ga0070661_100117773 3300005344 Bacteria 1987
72 Ga0070661_100136144 3300005344 Bacteria 1848
73 Ga0070668_100016788 3300005347 Bacteria 5474
74 Ga0070669_100034151 3300005353 Bacteria 3683
75 Ga0070675_100017384 3300005354 Bacteria 5714
76 Ga0070675_100064017 3300005354 Bacteria 3040
77 Ga0070675_100072390 3300005354 Bacteria 2861
78 Ga0070671_100011172 3300005355 Bacteria 7211
79 Ga0070671_100011225 3300005355 Bacteria 7194
80 Ga0070671_100091423 3300005355 Bacteria 2549
81 Ga0070671_100121933 3300005355 Unclassified 2194
82 Ga0070674_100000078 3300005356 Bacteria 44919
83 Ga0070674_100003725 3300005356 Bacteria 8593
84 Ga0070673_100007256 3300005364 Bacteria 7295
85 Ga0070673_100026968 3300005364 Bacteria 4253
86 Ga0070673_100082551 3300005364 Bacteria 2609
87 Ga0070673_100087594 3300005364 Bacteria 2538
88 Ga0070688_100056433 3300005365 Bacteria 2467
89 Ga0070688_100062645 3300005365 Bacteria 2355
90 Ga0070659_100000573 3300005366 Bacteria 26939
91 Ga0070659_100008652 3300005366 Bacteria 7445
92 Ga0070659_100057839 3300005366 Bacteria 3058
93 Ga0070659_100309891 3300005366 Bacteria 1318
94 Ga0070667_100012614 3300005367 Bacteria 6990
95 Ga0070667_100210924 3300005367 Bacteria 1726
96 Ga0070663_100000203 3300005455 Bacteria 29587
97 Ga0070663_100005836 3300005455 Bacteria 7356
98 Ga0070663_100017206 3300005455 Bacteria 4713
99 Ga0070663_100028464 3300005455 Bacteria 3805
100 Ga0070663_100032188 3300005455 Bacteria 3612
101 Ga0070663_100038387 3300005455 Bacteria 3341
102 Ga0070663_100038633 3300005455 Bacteria 3330
103 Ga0070678_100000005 3300005456 Bacteria 70019
104 Ga0070678_100012235 3300005456 Bacteria 5325
105 Ga0070678_100032869 3300005456 Bacteria 3595
106 Ga0070678_100107199 3300005456 Bacteria 2179
107 Ga0070662_100031732 3300005457 Bacteria 3710
108 Ga0070662_100032403 3300005457 Bacteria 3673
109 Ga0070662_100036683 3300005457 Bacteria 3470
110 Ga0070662_100040872 3300005457 Bacteria 3304
111 Ga0070662_100176791 3300005457 Bacteria 1680
112 Ga0070681_10000836 3300005458 Bacteria 25786
113 Ga0070685_10018913 3300005466 Bacteria 3711
114 Ga0070679_100002376 3300005530 Bacteria 17059
115 Ga0068853_100134268 3300005539 Bacteria 2217
116 Ga0068853_100139822 3300005539 Bacteria 2173
117 Ga0068853_100377060 3300005539 Bacteria 1324
118 Ga0070672_100000872 3300005543 Bacteria 18058
119 Ga0070672_100049640 3300005543 Unclassified 3266
120 Ga0070672_100086646 3300005543 Bacteria 2519
121 Ga0070672_100284434 3300005543 Bacteria 1399
122 Ga0070686_100099367 3300005544 Bacteria 1963
123 Ga0070665_100036260 3300005548 Bacteria 4961
124 Ga0068855_100019318 3300005563 Bacteria 8188
125 Ga0068855_100035976 3300005563 Bacteria 5896
126 Ga0068855_100083107 3300005563 Bacteria 3710
127 Ga0068855_100116698 3300005563 Bacteria 3059
128 Ga0068855_100123559 3300005563 Bacteria 2961
129 Ga0068855_100133497 3300005563 Bacteria 2833
130 Ga0070664_100005524 3300005564 Bacteria 10149
131 Ga0070664_100007441 3300005564 Bacteria 8839
132 Ga0070664_100012745 3300005564 Bacteria 6841
133 Ga0070664_100020156 3300005564 Bacteria 5490
134 Ga0070664_100033301 3300005564 Bacteria 4315
135 Ga0070664_100109707 3300005564 Bacteria 2407
136 Ga0070664_100195369 3300005564 Bacteria 1803
137 Ga0068857_100030321 3300005577 Bacteria 4775
138 Ga0068857_100030580 3300005577 Bacteria 4755
139 Ga0068857_100152583 3300005577 Bacteria 2094
140 Ga0068857_100156240 3300005577 Bacteria 2068
141 Ga0068857_100237952 3300005577 Bacteria 1666
142 Ga0068854_100026091 3300005578 Bacteria 4013
143 Ga0068854_100032228 3300005578 Bacteria 3644
144 Ga0068854_100082980 3300005578 Bacteria 2369
145 Ga0068854_100130047 3300005578 Bacteria 1921
146 Ga0068854_100211949 3300005578 Bacteria 1528
147 Ga0068856_100032979 3300005614 Bacteria 5072
148 Ga0068856_100072774 3300005614 Bacteria 3403
149 Ga0068856_100078026 3300005614 Bacteria 3283
150 Ga0068856_100148208 3300005614 Bacteria 2354
151 Ga0068856_100165658 3300005614 Bacteria 2221
152 Ga0068856_100241538 3300005614 Bacteria 1821
153 Ga0068852_100006804 3300005616 Bacteria 8299
154 Ga0068852_100136243 3300005616 Bacteria 2267
155 Ga0068852_100138971 3300005616 Bacteria 2246
156 Ga0068852_100286635 3300005616 Bacteria 1589
157 Ga0068859_100055972 3300005617 Bacteria 3969
158 Ga0068859_100108799 3300005617 Bacteria 2833
159 Ga0068864_100063466 3300005618 Bacteria 3201
160 Ga0068864_100245242 3300005618 Bacteria 1661
161 Ga0068864_100401156 3300005618 Bacteria 1303
162 Ga0068861_100000085 3300005719 Bacteria 44952
163 Ga0068861_100298297 3300005719 Bacteria 1395
164 Ga0068861_100369219 3300005719 Unclassified 1264
165 Ga0068851_10004933 3300005834 Bacteria 6044
166 Ga0068851_10007046 3300005834 Bacteria 5154
167 Ga0068851_10044065 3300005834 Bacteria 2251
168 Ga0068870_10131776 3300005840 Bacteria 1453
169 Ga0068863_100038607 3300005841 Bacteria 4542
170 Ga0068863_100336005 3300005841 Bacteria 1469
171 Ga0068863_100523626 3300005841 Bacteria 1169
172 Ga0068858_100000310 3300005842 Bacteria 51909
173 Ga0068860_100002446 3300005843 Bacteria 19513
174 Ga0068860_100230210 3300005843 Bacteria 1801
175 Ga0068862_100000699 3300005844 Bacteria 34289
176 Ga0081539_10000001 3300005985 Bacteria 808331
177 Ga0075432_10003783 3300006058 Bacteria 5156
178 Ga0075432_10011066 3300006058 Bacteria 3064
179 Ga0075362_10000040 3300006177 Bacteria 46092
180 Ga0075362_10082446 3300006177 Bacteria 1484
181 Ga0075366_10021460 3300006195 Bacteria 3753
182 Ga0097621_100004748 3300006237 Bacteria 9502
183 Ga0097621_100186645 3300006237 Bacteria 1794
184 Ga0075370_10036614 3300006353 Bacteria 2757
185 Ga0075370_10042480 3300006353 Bacteria 2568
186 Ga0068871_100013227 3300006358 Bacteria 6120
187 Ga0068871_100330004 3300006358 Bacteria 1345
188 Ga0097620_100055973 3300006931 Bacteria 3969
189 Ga0097620_100108791 3300006931 Bacteria 2833
190 Ga0105251_10001809 3300009011 Bacteria 17722
191 Ga0105240_10000121 3300009093 Bacteria 163057
192 Ga0105240_10082383 3300009093 Bacteria 3951
193 Ga0105240_10097190 3300009093 Bacteria 3589
194 Ga0105240_10211402 3300009093 Bacteria 2267
195 Ga0105240_10509329 3300009093 Bacteria 1337
196 Ga0105240_10708390 3300009093 Bacteria 1098
197 Ga0105245_10001044 3300009098 Bacteria 25061
198 Ga0105247_10001062 3300009101 Bacteria 20537
199 Ga0105243_10000030 3300009148 Bacteria 190342
200 Ga0105243_10054917 3300009148 Bacteria 3164
201 Ga0105241_10000799 3300009174 Bacteria 23921
202 Ga0105241_10000903 3300009174 Bacteria 22440
203 Ga0105241_10017577 3300009174 Bacteria 5257
204 Ga0105241_10177281 3300009174 Bacteria 1765
205 Ga0105241_10217077 3300009174 Bacteria 1605
206 Ga0105248_10015048 3300009177 Bacteria 8519
207 Ga0105248_10055553 3300009177 Bacteria 4442
208 Ga0105248_10233496 3300009177 Bacteria 2071
209 Ga0105237_10055147 3300009545 Bacteria 3981
210 Ga0105237_10361523 3300009545 Bacteria 1456
211 Ga0105238_10007472 3300009551 Bacteria 10949
212 Ga0105238_10021395 3300009551 Bacteria 6589
213 Ga0105238_10076399 3300009551 Bacteria 3340
214 Ga0105249_10000196 3300009553 Bacteria 69134
215 Ga0105249_10033714 3300009553 Bacteria 4636
216 Ga0105239_10005768 3300010375 Bacteria 14444
217 Ga0105239_10061342 3300010375 Bacteria 4127
218 Ga0105239_10166688 3300010375 Bacteria 2463
219 Ga0105239_10267262 3300010375 Bacteria 1923
220 Ga0105239_10404293 3300010375 Bacteria 1545
221 Ga0105246_10263859 3300011119 Bacteria 1373
222 Ga0157373_10018661 3300013100 Bacteria 5049
223 Ga0157373_10019281 3300013100 Bacteria 4967
224 Ga0157373_10057484 3300013100 Bacteria 2759
225 Ga0157373_10127119 3300013100 Bacteria 1793
226 Ga0157373_10280132 3300013100 Bacteria 1181
227 Ga0157371_10000111 3300013102 Bacteria 123977
228 Ga0157371_10000757 3300013102 Bacteria 37321
229 Ga0157371_10009942 3300013102 Bacteria 7446
230 Ga0157370_10042645 3300013104 Bacteria 4371
231 Ga0157369_10071138 3300013105 Bacteria 3735
232 Ga0157369_10081176 3300013105 Bacteria 3471
233 Ga0157369_10129916 3300013105 Bacteria 2670
234 Ga0157374_10167170 3300013296 Bacteria 2144
235 Ga0163162_10131849 3300013306 Bacteria 2608
236 Ga0163162_10295572 3300013306 Bacteria 1751
237 Ga0157372_10115387 3300013307 Bacteria 3079
238 Ga0157372_10165991 3300013307 Bacteria 2553
239 Ga0157372_10204213 3300013307 Bacteria 2289
240 Ga0157372_10217348 3300013307 Bacteria 2215
241 Ga0157372_10405894 3300013307 Bacteria 1588
242 Ga0157375_10037462 3300013308 Bacteria 4647
243 Ga0157375_10252678 3300013308 Bacteria 1924
244 Ga0163163_10016474 3300014325 Bacteria 6872
245 Ga0157380_10126611 3300014326 Bacteria 2172
246 Ga0157380_10147364 3300014326 Bacteria 2030
247 Ga0157377_10006308 3300014745 Bacteria 5644
248 Ga0157379_10129206 3300014968 Bacteria 2273
249 Ga0157376_10235690 3300014969 Bacteria 1702
250 Ga0163161_10002180 3300017792 Bacteria 14123
251 Ga0163161_10016322 3300017792 Bacteria 5184
252 Ga0163161_10151988 3300017792 Bacteria 1760
253 Ga0163161_10209132 3300017792 Bacteria 1507
254 Ga0213872_10041975 3300021361 Bacteria 2087
255 Ga0213872_10084398 3300021361 Bacteria 1424
256 Ga0209147_100763 3300025229 Bacteria 15759
257 Ga0209455_1010049 3300025272 Bacteria 2434
258 Ga0209758_1000001 3300025297 Bacteria 1981790
259 Ga0209050_1001048 3300025298 Bacteria 34107
260 Ga0209050_1016290 3300025298 Bacteria 3053
261 Ga0207656_10004092 3300025321 Bacteria 5060
262 Ga0207656_10012645 3300025321 Bacteria 3213
263 Ga0207656_10018676 3300025321 Bacteria 2732
264 Ga0207656_10029633 3300025321 Bacteria 2256
265 Ga0207656_10037068 3300025321 Bacteria 2050
266 Ga0207656_10038474 3300025321 Bacteria 2018
267 Ga0207682_10006701 3300025893 Bacteria 4625
268 Ga0207710_10006828 3300025900 Bacteria 4860
269 Ga0207680_10019437 3300025903 Bacteria 3633
270 Ga0207680_10082882 3300025903 Bacteria 2020
271 Ga0207647_10002614 3300025904 Bacteria 13617
272 Ga0207647_10013943 3300025904 Bacteria 5560
273 Ga0207647_10027409 3300025904 Bacteria 3713
274 Ga0207647_10067164 3300025904 Bacteria 2174
275 Ga0207647_10082511 3300025904 Bacteria 1925
276 Ga0207647_10103528 3300025904 Bacteria 1688
277 Ga0207645_10029241 3300025907 Bacteria 3553
278 Ga0207643_10132844 3300025908 Bacteria 1482
279 Ga0207705_10000004 3300025909 Bacteria 705756
280 Ga0207705_10000157 3300025909 Bacteria 73563
281 Ga0207705_10000228 3300025909 Bacteria 55776
282 Ga0207705_10000784 3300025909 Bacteria 26096
283 Ga0207654_10001685 3300025911 Bacteria 11537
284 Ga0207654_10002302 3300025911 Bacteria 9796
285 Ga0207654_10024069 3300025911 Bacteria 3270
286 Ga0207654_10040965 3300025911 Bacteria 2613
287 Ga0207654_10048834 3300025911 Bacteria 2424
288 Ga0207707_10006188 3300025912 Bacteria 10457
289 Ga0207695_10000006 3300025913 Bacteria 1135309
290 Ga0207695_10007333 3300025913 Bacteria 14081
291 Ga0207695_10010978 3300025913 Bacteria 11009
292 Ga0207695_10027051 3300025913 Bacteria 6390
293 Ga0207695_10087375 3300025913 Bacteria 3141
294 Ga0207695_10108153 3300025913 Bacteria 2765
295 Ga0207695_10255720 3300025913 Bacteria 1650
296 Ga0207671_10003767 3300025914 Bacteria 14911
297 Ga0207671_10004267 3300025914 Bacteria 13756
298 Ga0207671_10006621 3300025914 Bacteria 10278
299 Ga0207671_10120423 3300025914 Bacteria 2006
300 Ga0207660_10004609 3300025917 Bacteria 8984
301 Ga0207662_10182485 3300025918 Bacteria 1351
302 Ga0207657_10000465 3300025919 Bacteria 42880
303 Ga0207657_10001164 3300025919 Bacteria 27924
304 Ga0207657_10001229 3300025919 Bacteria 27350
305 Ga0207657_10009609 3300025919 Bacteria 9707
306 Ga0207657_10010580 3300025919 Bacteria 9199
307 Ga0207657_10014853 3300025919 Bacteria 7579
308 Ga0207649_10001601 3300025920 Bacteria 13157
309 Ga0207649_10003068 3300025920 Bacteria 9170
310 Ga0207649_10010980 3300025920 Bacteria 4982
311 Ga0207649_10098820 3300025920 Bacteria 1927
312 Ga0207652_10018418 3300025921 Bacteria 5727
313 Ga0207681_10062976 3300025923 Bacteria 2556
314 Ga0207694_10009999 3300025924 Bacteria 7152
315 Ga0207694_10031707 3300025924 Bacteria 4040
316 Ga0207694_10049311 3300025924 Bacteria 3259
317 Ga0207694_10090041 3300025924 Bacteria 2420
318 Ga0207694_10112313 3300025924 Bacteria 2168
319 Ga0207650_10016772 3300025925 Bacteria 5122
320 Ga0207650_10096157 3300025925 Bacteria 2272
321 Ga0207659_10007271 3300025926 Bacteria 6802
322 Ga0207659_10065719 3300025926 Bacteria 2629
323 Ga0207687_10002747 3300025927 Bacteria 11933
324 Ga0207644_10021555 3300025931 Bacteria 4391
325 Ga0207690_10000368 3300025932 Bacteria 29888
326 Ga0207690_10001385 3300025932 Bacteria 15233
327 Ga0207690_10003924 3300025932 Bacteria 8792
328 Ga0207690_10299924 3300025932 Bacteria 1257
329 Ga0207706_10001587 3300025933 Bacteria 22571
330 Ga0207706_10022833 3300025933 Bacteria 5613
331 Ga0207706_10024381 3300025933 Bacteria 5423
332 Ga0207706_10041335 3300025933 Bacteria 4087
333 Ga0207706_10041697 3300025933 Bacteria 4068
334 Ga0207706_10042913 3300025933 Bacteria 4008
335 Ga0207706_10180760 3300025933 Bacteria 1852
336 Ga0207709_10000137 3300025935 Bacteria 106203
337 Ga0207670_10015539 3300025936 Bacteria 4551
338 Ga0207669_10000093 3300025937 Bacteria 45459
339 Ga0207669_10003436 3300025937 Bacteria 6845
340 Ga0207691_10005079 3300025940 Bacteria 12704
341 Ga0207691_10026614 3300025940 Bacteria 5427
342 Ga0207691_10096866 3300025940 Unclassified 2637
343 Ga0207711_10008752 3300025941 Bacteria 8464
344 Ga0207711_10024045 3300025941 Bacteria 5100
345 Ga0207689_10036853 3300025942 Bacteria 4059
346 Ga0207679_10000640 3300025945 Bacteria 23345
347 Ga0207679_10054153 3300025945 Bacteria 2952
348 Ga0207679_10100615 3300025945 Bacteria 2259
349 Ga0207679_10124169 3300025945 Bacteria 2060
350 Ga0207679_10160530 3300025945 Bacteria 1840
351 Ga0207679_10334451 3300025945 Bacteria 1315
352 Ga0207667_10000004 3300025949 Bacteria 737718
353 Ga0207667_10000006 3300025949 Bacteria 679876
354 Ga0207667_10002681 3300025949 Bacteria 22015
355 Ga0207667_10016478 3300025949 Bacteria 8350
356 Ga0207667_10051010 3300025949 Bacteria 4363
357 Ga0207667_10056466 3300025949 Bacteria 4125
358 Ga0207667_10088965 3300025949 Bacteria 3193
359 Ga0207667_10120298 3300025949 Bacteria 2706
360 Ga0207651_10002413 3300025960 Bacteria 8928
361 Ga0207651_10002469 3300025960 Bacteria 8823
362 Ga0207651_10065019 3300025960 Unclassified 2556
363 Ga0207712_10000015 3300025961 Bacteria 346689
364 Ga0207668_10005778 3300025972 Bacteria 7291
365 Ga0207640_10005079 3300025981 Bacteria 7160
366 Ga0207640_10028932 3300025981 Bacteria 3395
367 Ga0207640_10071113 3300025981 Bacteria 2342
368 Ga0207640_10222105 3300025981 Bacteria 1447
369 Ga0207658_10056441 3300025986 Bacteria 2914
370 Ga0207703_10000757 3300026035 Bacteria 31884
371 Ga0207639_10000160 3300026041 Bacteria 51548
372 Ga0207639_10000185 3300026041 Bacteria 48694
373 Ga0207639_10001020 3300026041 Bacteria 19060
374 Ga0207639_10013092 3300026041 Bacteria 5792
375 Ga0207639_10050242 3300026041 Bacteria 3166
376 Ga0207639_10065385 3300026041 Bacteria 2823
377 Ga0207639_10125066 3300026041 Bacteria 2119
378 Ga0207639_10261251 3300026041 Bacteria 1514
379 Ga0207678_10000083 3300026067 Bacteria 77023
380 Ga0207678_10000491 3300026067 Bacteria 35916
381 Ga0207678_10000545 3300026067 Bacteria 34437
382 Ga0207678_10000801 3300026067 Bacteria 28842
383 Ga0207678_10008944 3300026067 Bacteria 8818
384 Ga0207678_10053121 3300026067 Bacteria 3493
385 Ga0207678_10089483 3300026067 Bacteria 2631
386 Ga0207678_10121804 3300026067 Bacteria 2226
387 Ga0207702_10004461 3300026078 Bacteria 12438
388 Ga0207702_10004499 3300026078 Bacteria 12374
389 Ga0207702_10009174 3300026078 Bacteria 8319
390 Ga0207702_10009706 3300026078 Bacteria 8083
391 Ga0207702_10016210 3300026078 Bacteria 6169
392 Ga0207702_10118736 3300026078 Bacteria 2363
393 Ga0207702_10323644 3300026078 Bacteria 1469
394 Ga0207702_10395284 3300026078 Bacteria 1332
395 Ga0207641_10001505 3300026088 Bacteria 22818
396 Ga0207641_10052577 3300026088 Bacteria 3450
397 Ga0207648_10044737 3300026089 Bacteria 3884
398 Ga0207676_10054692 3300026095 Bacteria 3129
399 Ga0207676_10145144 3300026095 Bacteria 2037
400 Ga0207676_10317648 3300026095 Bacteria 1428
401 Ga0207674_10017103 3300026116 Bacteria 7916
402 Ga0207674_10031539 3300026116 Bacteria 5566
403 Ga0207674_10033636 3300026116 Bacteria 5366
404 Ga0207674_10085338 3300026116 Bacteria 3153
405 Ga0207674_10138473 3300026116 Bacteria 2395
406 Ga0207674_10141171 3300026116 Bacteria 2368
407 Ga0207674_10446228 3300026116 Bacteria 1250
408 Ga0207675_100000012 3300026118 Bacteria 140594
409 Ga0207675_100255201 3300026118 Bacteria 1698
410 Ga0207683_10000115 3300026121 Bacteria 65630
411 Ga0207683_10053762 3300026121 Bacteria 3531
412 Ga0207683_10141231 3300026121 Bacteria 2170
413 Ga0207698_10000019 3300026142 Bacteria 145910
414 Ga0207698_10003456 3300026142 Bacteria 9511
415 Ga0207698_10007180 3300026142 Bacteria 6976
416 Ga0207698_10011849 3300026142 Bacteria 5676
417 Ga0207698_10018236 3300026142 Bacteria 4778
418 Ga0207698_10041531 3300026142 Bacteria 3428
419 Ga0207698_10077164 3300026142 Bacteria 2670
420 Ga0207698_10153584 3300026142 Bacteria 2002
421 Ga0207428_10013576 3300027907 Bacteria 7109
422 Ga0207428_10096876 3300027907 Bacteria 2284
423 Ga0268266_10119155 3300028379 Bacteria 2347
424 Ga0268266_10122130 3300028379 Bacteria 2319
425 Ga0268265_10000658 3300028380 Bacteria 34307
426 Ga0268264_10002774 3300028381 Bacteria 15281
427 Ga0268264_10028752 3300028381 Bacteria 4550
428 Ga0268264_10219456 3300028381 Bacteria 1750
429 Ga0265334_10019913 3300028573 Bacteria 2753
430 Ga0307515_10051473 3300028794 Bacteria 6139
431 Ga0307515_10140118 3300028794 Bacteria 2600
432 Ga0265338_10008334 3300028800 Bacteria 12608
433 Ga0265338_10026416 3300028800 Bacteria 5857
434 Ga0265338_10059595 3300028800 Bacteria 3362
435 Ga0265340_10019040 3300031247 Bacteria 3536
436 Ga0265340_10028348 3300031247 Bacteria 2817
437 Ga0265327_10002198 3300031251 Bacteria 21377
438 Ga0307513_10000034 3300031456 Bacteria 185012
439 Ga0307513_10057878 3300031456 Bacteria 4125
440 Ga0307513_10090272 3300031456 Bacteria 3126
441 Ga0307509_10232840 3300031507 Bacteria 1643
442 Ga0307408_100055766 3300031548 Bacteria 2862
443 Ga0307408_100079323 3300031548 Bacteria 2449
444 Ga0307508_10025651 3300031616 Bacteria 5341
445 Ga0265314_10036108 3300031711 Bacteria 3595
446 Ga0307405_10062371 3300031731 Bacteria 2360
447 Ga0307405_10062434 3300031731 Bacteria 2359
448 Ga0307413_10051151 3300031824 Bacteria 2488
449 Ga0307413_10113942 3300031824 Bacteria 1816
450 Ga0307406_10051052 3300031901 Bacteria 2624
451 Ga0307406_10064151 3300031901 Bacteria 2382
452 Ga0307407_10206864 3300031903 Bacteria 1319
453 Ga0307412_10035794 3300031911 Bacteria 3174
454 Ga0307412_10077360 3300031911 Bacteria 2288
455 Ga0307412_10099599 3300031911 Bacteria 2052
456 Ga0307412_10101111 3300031911 Bacteria 2039
457 Ga0307412_10144528 3300031911 Bacteria 1746
458 Ga0307409_100053268 3300031995 Bacteria 3108
459 Ga0307409_100209284 3300031995 Bacteria 1751
460 Ga0307409_100375577 3300031995 Bacteria 1349
461 Ga0307416_100025913 3300032002 Bacteria 4310
462 Ga0307414_10003631 3300032004 Bacteria 8266
463 Ga0307414_10012568 3300032004 Bacteria 5012
464 Ga0307414_10154722 3300032004 Bacteria 1813
465 Ga0307414_10263110 3300032004 Bacteria 1440
466 Ga0307411_10204174 3300032005 Bacteria 1520
467 Ga0307510_10002596 3300033180 Bacteria 20627
468 Ga0373931_0024623 3300035691 Bacteria 3052
469 Ga0373935_0027934 3300035692 Bacteria 3487
470 Ga0373927_0001162 3300035695 Bacteria 19918
471 Ga0316582_0000197 3300036647 Bacteria 19119
472 Ga0316584_0092524 3300036712 Unclassified 2264
473 Ga0316584_0213817 3300036712 Bacteria 1418
474 Ga0373925_0000991 3300037068 Bacteria 25768
475 Ga0400483_048519 3300039062 Bacteria 5904
476 Ga0400483_050097 3300039062 Bacteria 4038
477 Ga0400483_161893 3300039062 Bacteria 2469
478 Ga0436361_0812819 3300039447 Bacteria 11508
479 Ga0439443_004810 3300042003 Bacteria 1780
480 Ga0439435_0018676 3300042436 Bacteria 1767
481 Ga0466972_0020132 3300044658 Bacteria 3335
482 Ga0466966_0032567 3300044684 Bacteria 3377
483 Ga0466961_0091244 3300044693 Bacteria 1923
484 Ga0466960_0086101 3300044901 Bacteria 1593
485 Ga0466959_0039932 3300045049 Bacteria 3468
486 Ga0451576_0001437 3300045051 Bacteria 40602
487 Ga0451576_0051839 3300045051 Bacteria 4301
488 Ga0466958_0000355 3300045836 Bacteria 18454
489 Ga0466958_0036857 3300045836 Bacteria 2929
490 Ga0495627_000305 3300046453 Bacteria 48602
491 Ga0495627_000520 3300046453 Bacteria 31871
492 Ga0495627_000804 3300046453 Bacteria 22900
493 Ga0495627_033046 3300046453 Bacteria 1624
494 Ga0495603_0166890 3300046455 Bacteria 1276
495 Ga0495638_0000024 3300046460 Bacteria 362116
496 Ga0495638_0000074 3300046460 Bacteria 163843
497 Ga0495650_0000325 3300046471 Bacteria 85327
498 Ga0495650_0001824 3300046471 Bacteria 19114
499 Ga0495650_0073563 3300046471 Bacteria 1335
500 Ga0495584_0053281 3300046491 Bacteria 2036
501 Ga0495584_0194802 3300046491 Bacteria 1030
502 Ga0495585_0000339 3300046492 Bacteria 45404
503 Ga0495585_0001102 3300046492 Bacteria 22234
504 Ga0495585_0044720 3300046492 Bacteria 2473
505 Ga0495585_0104795 3300046492 Bacteria 1509
506 Ga0495585_0127167 3300046492 Bacteria 1344
507 Ga0495594_0051755 3300046499 Bacteria 2260
508 Ga0495596_0000136 3300046500 Bacteria 50455
509 Ga0495596_0000187 3300046500 Bacteria 43214
510 Ga0495596_0001732 3300046500 Bacteria 12249
511 Ga0495596_0002742 3300046500 Bacteria 9247
512 Ga0495583_0000275 3300046506 Bacteria 83178
513 Ga0495583_0000527 3300046506 Bacteria 54086
514 Ga0495583_0022408 3300046506 Bacteria 3223
515 Ga0495606_0027879 3300046507 Bacteria 3995
516 Ga0495610_0000034 3300046512 Bacteria 201408
517 Ga0495610_0002224 3300046512 Bacteria 16409
518 Ga0495610_0003976 3300046512 Bacteria 11174
519 Ga0495610_0005525 3300046512 Bacteria 8956
520 Ga0495610_0026473 3300046512 Bacteria 3096
521 Ga0495610_0042899 3300046512 Bacteria 2258
522 Ga0495610_0052989 3300046512 Bacteria 1967
523 Ga0495620_0001019 3300046515 Bacteria 17232
524 Ga0495632_0000001 3300046519 Bacteria 873295
525 Ga0495632_0000053 3300046519 Bacteria 131977
526 Ga0495632_0000498 3300046519 Bacteria 36972
527 Ga0495632_0000813 3300046519 Bacteria 27616
528 Ga0495632_0006591 3300046519 Bacteria 7432
529 Ga0495632_0070173 3300046519 Bacteria 1685
530 Ga0495637_0000717 3300046520 Bacteria 22702
531 Ga0495637_0000826 3300046520 Bacteria 20447
532 Ga0495637_0000850 3300046520 Bacteria 20082
533 Ga0495643_0000006 3300046522 Bacteria 419524
534 Ga0495643_0000020 3300046522 Bacteria 294973
535 Ga0495643_0000061 3300046522 Bacteria 185933
536 Ga0495643_0000859 3300046522 Bacteria 32706
537 Ga0495643_0001729 3300046522 Bacteria 18882
538 Ga0495643_0071188 3300046522 Bacteria 1826
539 Ga0495643_0099853 3300046522 Bacteria 1488
540 Ga0495648_0000005 3300046524 Bacteria 362116
541 Ga0495648_0000050 3300046524 Bacteria 163843
542 Ga0495648_0000051 3300046524 Bacteria 162502
543 Ga0495648_0005515 3300046524 Bacteria 10498
544 Ga0495648_0006642 3300046524 Bacteria 9369
545 Ga0495648_0030955 3300046524 Bacteria 3531
546 Ga0495648_0039517 3300046524 Bacteria 3002
547 Ga0495663_0000002 3300046525 Bacteria 495384
548 Ga0495663_0000012 3300046525 Bacteria 157546
549 Ga0495654_0025597 3300046530 Bacteria 3039
550 Ga0495654_0061125 3300046530 Bacteria 1810
551 Ga0495622_0042546 3300046557 Bacteria 2112
552 Ga0495633_0000208 3300046558 Bacteria 74469
553 Ga0495633_0000312 3300046558 Bacteria 55371
554 Ga0495633_0000413 3300046558 Bacteria 44456
555 Ga0495633_0000470 3300046558 Bacteria 41242
556 Ga0495633_0004138 3300046558 Bacteria 9329
557 Ga0495633_0013178 3300046558 Bacteria 4367
558 Ga0495633_0034785 3300046558 Bacteria 2422
559 Ga0495625_0010009 3300046660 Bacteria 7885
560 Ga0495625_0032733 3300046660 Bacteria 3852
561 Ga0495625_0225685 3300046660 Bacteria 1225
562 Ga0495671_0000008 3300046692 Bacteria 419524
563 Ga0495671_0000016 3300046692 Bacteria 294821
564 Ga0495671_0000036 3300046692 Bacteria 181192
565 Ga0495671_0000096 3300046692 Bacteria 82384
566 Ga0495671_0000187 3300046692 Bacteria 54674
567 Ga0495671_0010581 3300046692 Bacteria 5101
568 Ga0495671_0017625 3300046692 Bacteria 3799
569 Ga0495673_0000157 3300047469 Bacteria 117733
570 Ga0495673_0000365 3300047469 Bacteria 54674
571 Ga0495681_0000037 3300047470 Bacteria 122686
572 Ga0495681_0000208 3300047470 Bacteria 48683
573 Ga0495681_0000437 3300047470 Bacteria 31989
574 Ga0495681_0001363 3300047470 Bacteria 18446
575 Ga0495681_0002391 3300047470 Bacteria 13438
576 Ga0495686_0009263 3300047472 Bacteria 7111
577 Ga0495686_0069693 3300047472 Bacteria 2167
578 Ga0495686_0078788 3300047472 Bacteria 2016
579 Ga0495686_0191365 3300047472 Bacteria 1179
580 Ga0495615_0000002 3300048090 Bacteria 167871
581 Ga0495626_0000852 3300048091 Bacteria 27166
582 Ga0496102_0164084 3300048905 Bacteria 2090
583 Ga0496109_0114978 3300048912 Bacteria 2503
584 Ga0496109_0146367 3300048912 Bacteria 2211
585 Ga0496110_0053470 3300048913 Bacteria 3550
586 Ga0496111_0058545 3300048914 Bacteria 2789
587 Ga0496113_0036418 3300048916 Bacteria 3605
588 Ga0496114_0006351 3300048917 Bacteria 9299
589 Ga0496116_0000093 3300048919 Bacteria 205660
590 Ga0496116_0019366 3300048919 Bacteria 5212
591 Ga0496117_0057598 3300048920 Bacteria 2697
592 Ga0496117_0062063 3300048920 Bacteria 2564
593 Ga0496117_0125437 3300048920 Bacteria 1568
594 Ga0496118_0004744 3300048921 Bacteria 15911
595 Ga0496118_0005210 3300048921 Bacteria 14872
596 Ga0496118_0033605 3300048921 Bacteria 4205
597 Ga0496118_0056320 3300048921 Bacteria 2957
598 Ga0496118_0183043 3300048921 Bacteria 1263
599 Ga0496121_0004428 3300048924 Bacteria 18910
600 Ga0496121_0014480 3300048924 Bacteria 8363
601 Ga0496121_0025046 3300048924 Bacteria 5680
602 Ga0496122_0000702 3300048925 Bacteria 66240
603 Ga0496122_0010843 3300048925 Bacteria 9330
604 Ga0496122_0017535 3300048925 Bacteria 6688
605 Ga0496122_0097126 3300048925 Bacteria 1983
606 Ga0496123_0000914 3300048926 Bacteria 46373
607 Ga0496123_0061160 3300048926 Bacteria 2422
608 Ga0496124_0000374 3300048927 Bacteria 81451
609 Ga0496124_0008549 3300048927 Bacteria 10687
610 Ga0496124_0025049 3300048927 Bacteria 5410
611 Ga0496124_0034344 3300048927 Bacteria 4452
612 Ga0496124_0095884 3300048927 Bacteria 2410
613 Ga0496125_0000373 3300048928 Bacteria 84239
614 Ga0496125_0007575 3300048928 Bacteria 11530
615 Ga0496125_0030387 3300048928 Bacteria 4834
616 Ga0496126_0000512 3300048929 Bacteria 75587
617 Ga0496126_0022194 3300048929 Bacteria 6181
618 Ga0496126_0053896 3300048929 Bacteria 3646
619 Ga0496126_0072905 3300048929 Bacteria 3053
620 Ga0496126_0301825 3300048929 Bacteria 1321
621 Ga0496126_0368496 3300048929 Bacteria 1172
622 Ga0501033_0000059 3300049570 Bacteria 105311
623 Ga0501035_0000213 3300049822 Bacteria 69670
624 nmdc:mga03683_24869_c1 3300050489 Bacteria 2346
625 nmdc:mga03683_2_c1 3300050489 Bacteria 289140
626 nmdc:mga03683_48550_c1 3300050489 Bacteria 1764
627 nmdc:mga03n38_1707_c1 3300050490 Bacteria 6471
628 nmdc:mga0k408_2_c1 3300050493 Bacteria 395671
629 nmdc:mga0k408_84305_c1 3300050493 Bacteria 1864
630 nmdc:mga0k408_85160_c1 3300050493 Bacteria 1855
631 nmdc:mga0sz30_3405_c2 3300050516 Bacteria 3961
632 Ga0500635_0001737 3300053080 Bacteria 5300
633 Ga0500643_000162 3300053087 Bacteria 66736
634 Ga0500643_020651 3300053087 Bacteria 2148
635 Ga0500562_000306 3300053108 Bacteria 11974
636 Ga0500562_004347 3300053108 Bacteria 3586
637 Ga0500594_0004429 3300053118 Bacteria 3095
638 Ga0500594_0007498 3300053118 Bacteria 2469
639 Ga0500594_0056774 3300053118 Bacteria 1117
640 Ga0500595_021185 3300053119 Bacteria 2324
641 Ga0500597_009023 3300053120 Bacteria 3486
642 Ga0500607_000045 3300053121 Bacteria 84084
643 Ga0500618_000993 3300053125 Bacteria 14349
644 Ga0500618_001122 3300053125 Bacteria 13055
645 Ga0500642_0000003 3300053130 Bacteria 544899
646 Ga0500559_0002057 3300053136 Bacteria 10771
647 Ga0500559_0012209 3300053136 Bacteria 3655
648 Ga0500559_0022654 3300053136 Bacteria 2664
649 Ga0500559_0027306 3300053136 Bacteria 2436
650 Ga0500564_001755 3300053138 Bacteria 7674
651 Ga0500624_000098 3300053157 Bacteria 42544
652 Ga0500636_0064800 3300053177 Bacteria 2128
653 Ga0500637_0000055 3300053178 Bacteria 42526
654 Ga0500637_0029458 3300053178 Bacteria 3045
655 Ga0500567_001363 3300053723 Bacteria 9772
656 Ga0500625_000012 3300053729 Bacteria 127269
657 Ga0500645_017281 3300053730 Bacteria 2263

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053177 Ga0500636_0064800 Ga0500636_0064800_1231_2079 278
2 3300048929 Ga0496126_0301825 Ga0496126_0301825_14_904 290
3 3300026041 Ga0207639_10013092 Ga0207639_100130924 308
4 3300046524 Ga0495648_0039517 Ga0495648_0039517_91_1050 308
5 iso_pu_bacteria 2582581305 2585264107 310
6 iso_pu_bacteria 2738541275 2738712967 310
7 iso_pu_bacteria 2738541301 2738851391 310
8 iso_pu_bacteria 2738541304 2738867121 310
9 iso_pu_bacteria 2738543022 2739299638 310
10 iso_pu_bacteria 2738543033 2739361317 310
11 iso_pu_bacteria 2739367664 2739650244 310
12 iso_pu_bacteria 2739367865 2740028717 310
13 iso_pu_bacteria 2919138771 2919139512 310
14 iso_pu_bacteria 2928100450 2928103578 310
15 iso_pu_bacteria 2928959182 2928963277 310
16 3300039062 Ga0400483_161893 Ga0400483_161893_852_1829 311
17 3300025936 Ga0207670_10015539 Ga0207670_100155392 313
18 3300053125 Ga0500618_001122 Ga0500618_001122_2659_3600 313
19 3300001915 JGI24741J21665_1000068 JGI24741J21665_100006817 314
20 3300001915 JGI24741J21665_1000106 JGI24741J21665_100010611 314
21 3300001979 JGI24740J21852_10001360 JGI24740J21852_1000136013 314
22 3300001989 JGI24739J22299_10001257 JGI24739J22299_100012578 314
23 3300001989 JGI24739J22299_10003195 JGI24739J22299_100031954 314
24 3300001989 JGI24739J22299_10007955 JGI24739J22299_100079552 314
25 3300001990 JGI24737J22298_10001250 JGI24737J22298_1000125011 314
26 3300001990 JGI24737J22298_10003837 JGI24737J22298_100038375 314
27 3300001990 JGI24737J22298_10012428 JGI24737J22298_100124284 314
28 3300002067 JGI24735J21928_10003256 JGI24735J21928_100032563 314
29 3300002075 JGI24738J21930_10000887 JGI24738J21930_1000088711 314
30 3300003323 rootH1_10113965 rootH1_101139658 314
31 3300003791 Ga0055530_10028273 Ga0055530_100282732 314
32 3300005327 Ga0070658_10000167 Ga0070658_1000016754 314
33 3300005327 Ga0070658_10000180 Ga0070658_1000018043 314
34 3300005327 Ga0070658_10080612 Ga0070658_100806121 314
35 3300005327 Ga0070658_10153838 Ga0070658_101538383 314
36 3300005333 Ga0070677_10033610 Ga0070677_100336103 314
37 3300005336 Ga0070680_100000486 Ga0070680_1000004865 314
38 3300005339 Ga0070660_100005124 Ga0070660_1000051249 314
39 3300005339 Ga0070660_100014169 Ga0070660_1000141694 314
40 3300005341 Ga0070691_10017513 Ga0070691_100175132 314
41 3300005344 Ga0070661_100002081 Ga0070661_1000020814 314
42 3300005344 Ga0070661_100056982 Ga0070661_1000569822 314
43 3300005344 Ga0070661_100111753 Ga0070661_1001117532 314
44 3300005366 Ga0070659_100000573 Ga0070659_1000005734 314
45 3300005366 Ga0070659_100008652 Ga0070659_1000086526 314
46 3300005366 Ga0070659_100309891 Ga0070659_1003098911 314
47 3300005455 Ga0070663_100000203 Ga0070663_10000020318 314
48 3300005455 Ga0070663_100017206 Ga0070663_1000172062 314
49 3300005455 Ga0070663_100038387 Ga0070663_1000383872 314
50 3300005457 Ga0070662_100032403 Ga0070662_1000324032 314
51 3300005458 Ga0070681_10000836 Ga0070681_1000083619 314
52 3300005530 Ga0070679_100002376 Ga0070679_10000237615 314
53 3300005563 Ga0068855_100035976 Ga0068855_1000359765 314
54 3300005563 Ga0068855_100083107 Ga0068855_1000831072 314
55 3300005563 Ga0068855_100116698 Ga0068855_1001166984 314
56 3300005563 Ga0068855_100133497 Ga0068855_1001334974 314
57 3300005564 Ga0070664_100005524 Ga0070664_1000055249 314
58 3300005564 Ga0070664_100007441 Ga0070664_1000074419 314
59 3300005564 Ga0070664_100033301 Ga0070664_1000333013 314
60 3300005577 Ga0068857_100030580 Ga0068857_1000305805 314
61 3300005577 Ga0068857_100152583 Ga0068857_1001525833 314
62 3300005578 Ga0068854_100026091 Ga0068854_1000260913 314
63 3300005578 Ga0068854_100032228 Ga0068854_1000322282 314
64 3300005578 Ga0068854_100082980 Ga0068854_1000829802 314
65 3300005578 Ga0068854_100130047 Ga0068854_1001300472 314
66 3300005614 Ga0068856_100072774 Ga0068856_1000727742 314
67 3300005614 Ga0068856_100078026 Ga0068856_1000780264 314
68 3300005614 Ga0068856_100148208 Ga0068856_1001482084 314
69 3300005614 Ga0068856_100241538 Ga0068856_1002415382 314
70 3300005616 Ga0068852_100006804 Ga0068852_1000068046 314
71 3300005719 Ga0068861_100000085 Ga0068861_10000008528 314
72 3300005834 Ga0068851_10007046 Ga0068851_100070465 314
73 3300006058 Ga0075432_10003783 Ga0075432_100037832 314
74 3300006058 Ga0075432_10011066 Ga0075432_100110662 314
75 3300006177 Ga0075362_10082446 Ga0075362_100824462 314
76 3300006353 Ga0075370_10036614 Ga0075370_100366142 314
77 3300006353 Ga0075370_10042480 Ga0075370_100424803 314
78 3300009093 Ga0105240_10097190 Ga0105240_100971904 314
79 3300009093 Ga0105240_10211402 Ga0105240_102114022 314
80 3300009174 Ga0105241_10000903 Ga0105241_1000090316 314
81 3300009174 Ga0105241_10017577 Ga0105241_100175771 314
82 3300009174 Ga0105241_10217077 Ga0105241_102170772 314
83 3300009177 Ga0105248_10015048 Ga0105248_100150487 314
84 3300009551 Ga0105238_10021395 Ga0105238_100213952 314
85 3300009551 Ga0105238_10076399 Ga0105238_100763992 314
86 3300010375 Ga0105239_10061342 Ga0105239_100613425 314
87 3300010375 Ga0105239_10166688 Ga0105239_101666882 314
88 3300013100 Ga0157373_10018661 Ga0157373_100186614 314
89 3300013100 Ga0157373_10057484 Ga0157373_100574843 314
90 3300013100 Ga0157373_10127119 Ga0157373_101271191 314
91 3300013100 Ga0157373_10280132 Ga0157373_102801321 314
92 3300013102 Ga0157371_10000111 Ga0157371_100001119 314
93 3300013102 Ga0157371_10009942 Ga0157371_100099422 314
94 3300013104 Ga0157370_10042645 Ga0157370_100426452 314
95 3300013105 Ga0157369_10081176 Ga0157369_100811764 314
96 3300013307 Ga0157372_10115387 Ga0157372_101153872 314
97 3300013307 Ga0157372_10165991 Ga0157372_101659913 314
98 3300017792 Ga0163161_10209132 Ga0163161_102091322 314
99 3300025298 Ga0209050_1016290 Ga0209050_10162903 314
100 3300025321 Ga0207656_10018676 Ga0207656_100186762 314
101 3300025904 Ga0207647_10013943 Ga0207647_100139433 314
102 3300025904 Ga0207647_10103528 Ga0207647_101035282 314
103 3300025909 Ga0207705_10000004 Ga0207705_10000004199 314
104 3300025909 Ga0207705_10000228 Ga0207705_1000022843 314
105 3300025909 Ga0207705_10000784 Ga0207705_1000078419 314
106 3300025911 Ga0207654_10002302 Ga0207654_100023027 314
107 3300025911 Ga0207654_10048834 Ga0207654_100488342 314
108 3300025912 Ga0207707_10006188 Ga0207707_100061882 314
109 3300025913 Ga0207695_10010978 Ga0207695_100109782 314
110 3300025913 Ga0207695_10027051 Ga0207695_100270515 314
111 3300025913 Ga0207695_10087375 Ga0207695_100873752 314
112 3300025913 Ga0207695_10108153 Ga0207695_101081532 314
113 3300025914 Ga0207671_10003767 Ga0207671_100037677 314
114 3300025917 Ga0207660_10004609 Ga0207660_100046094 314
115 3300025919 Ga0207657_10000465 Ga0207657_1000046511 314
116 3300025919 Ga0207657_10001164 Ga0207657_100011642 314
117 3300025919 Ga0207657_10009609 Ga0207657_100096094 314
118 3300025919 Ga0207657_10010580 Ga0207657_1001058011 314
119 3300025920 Ga0207649_10001601 Ga0207649_100016015 314
120 3300025920 Ga0207649_10003068 Ga0207649_100030688 314
121 3300025921 Ga0207652_10018418 Ga0207652_100184181 314
122 3300025924 Ga0207694_10009999 Ga0207694_100099992 314
123 3300025924 Ga0207694_10031707 Ga0207694_100317071 314
124 3300025924 Ga0207694_10049311 Ga0207694_100493113 314
125 3300025932 Ga0207690_10001385 Ga0207690_100013856 314
126 3300025932 Ga0207690_10003924 Ga0207690_100039246 314
127 3300025933 Ga0207706_10001587 Ga0207706_100015872 314
128 3300025933 Ga0207706_10022833 Ga0207706_100228335 314
129 3300025941 Ga0207711_10008752 Ga0207711_100087527 314
130 3300025945 Ga0207679_10100615 Ga0207679_101006152 314
131 3300025945 Ga0207679_10334451 Ga0207679_103344512 314
132 3300025949 Ga0207667_10000004 Ga0207667_10000004629 314
133 3300025949 Ga0207667_10056466 Ga0207667_100564663 314
134 3300025949 Ga0207667_10088965 Ga0207667_100889654 314
135 3300025949 Ga0207667_10120298 Ga0207667_101202984 314
136 3300025981 Ga0207640_10005079 Ga0207640_100050795 314
137 3300025981 Ga0207640_10028932 Ga0207640_100289323 314
138 3300025981 Ga0207640_10071113 Ga0207640_100711132 314
139 3300025981 Ga0207640_10222105 Ga0207640_102221052 314
140 3300026041 Ga0207639_10000160 Ga0207639_100001604 314
141 3300026041 Ga0207639_10065385 Ga0207639_100653852 314
142 3300026041 Ga0207639_10125066 Ga0207639_101250662 314
143 3300026067 Ga0207678_10000083 Ga0207678_1000008356 314
144 3300026067 Ga0207678_10000491 Ga0207678_1000049119 314
145 3300026067 Ga0207678_10008944 Ga0207678_100089442 314
146 3300026067 Ga0207678_10089483 Ga0207678_100894833 314
147 3300026078 Ga0207702_10009174 Ga0207702_100091743 314
148 3300026078 Ga0207702_10118736 Ga0207702_101187362 314
149 3300026078 Ga0207702_10395284 Ga0207702_103952842 314
150 3300026116 Ga0207674_10017103 Ga0207674_100171032 314
151 3300026116 Ga0207674_10033636 Ga0207674_100336364 314
152 3300026116 Ga0207674_10138473 Ga0207674_101384732 314
153 3300026116 Ga0207674_10141171 Ga0207674_101411714 314
154 3300026118 Ga0207675_100000012 Ga0207675_100000012121 314
155 3300026142 Ga0207698_10000019 Ga0207698_100000196 314
156 3300026142 Ga0207698_10003456 Ga0207698_100034561 314
157 3300026142 Ga0207698_10018236 Ga0207698_100182363 314
158 3300026142 Ga0207698_10077164 Ga0207698_100771642 314
159 3300027907 Ga0207428_10013576 Ga0207428_100135762 314
160 3300027907 Ga0207428_10096876 Ga0207428_100968761 314
161 3300031247 Ga0265340_10019040 Ga0265340_100190403 314
162 3300031548 Ga0307408_100055766 Ga0307408_1000557662 314
163 3300031548 Ga0307408_100079323 Ga0307408_1000793232 314
164 3300031616 Ga0307508_10025651 Ga0307508_100256515 314
165 3300031731 Ga0307405_10062371 Ga0307405_100623712 314
166 3300031824 Ga0307413_10051151 Ga0307413_100511512 314
167 3300031824 Ga0307413_10113942 Ga0307413_101139422 314
168 3300031903 Ga0307407_10206864 Ga0307407_102068642 314
169 3300031911 Ga0307412_10099599 Ga0307412_100995992 314
170 3300031911 Ga0307412_10144528 Ga0307412_101445281 314
171 3300031995 Ga0307409_100375577 Ga0307409_1003755771 314
172 3300032002 Ga0307416_100025913 Ga0307416_1000259133 314
173 3300032004 Ga0307414_10154722 Ga0307414_101547222 314
174 3300032004 Ga0307414_10263110 Ga0307414_102631101 314
175 3300032005 Ga0307411_10204174 Ga0307411_102041741 314
176 3300035691 Ga0373931_0024623 Ga0373931_0024623_2080_3024 314
177 3300042003 Ga0439443_004810 Ga0439443_004810_81_1025 314
178 3300042436 Ga0439435_0018676 Ga0439435_0018676_249_1193 314
179 3300046453 Ga0495627_000305 Ga0495627_000305_28745_29689 314
180 3300046471 Ga0495650_0000325 Ga0495650_0000325_10785_11729 314
181 3300046491 Ga0495584_0053281 Ga0495584_0053281_615_1559 314
182 3300046492 Ga0495585_0001102 Ga0495585_0001102_6366_7310 314
183 3300046492 Ga0495585_0104795 Ga0495585_0104795_305_1339 314
184 3300046500 Ga0495596_0000187 Ga0495596_0000187_33431_34375 314
185 3300046500 Ga0495596_0002742 Ga0495596_0002742_4895_5926 314
186 3300046512 Ga0495610_0000034 Ga0495610_0000034_91539_92483 314
187 3300046512 Ga0495610_0002224 Ga0495610_0002224_5734_6678 314
188 3300046519 Ga0495632_0000053 Ga0495632_0000053_17829_18773 314
189 3300046519 Ga0495632_0000498 Ga0495632_0000498_16331_17275 314
190 3300046520 Ga0495637_0000717 Ga0495637_0000717_18247_19191 314
191 3300046522 Ga0495643_0000061 Ga0495643_0000061_163283_164227 314
192 3300046522 Ga0495643_0099853 Ga0495643_0099853_16_987 314
193 3300046524 Ga0495648_0000051 Ga0495648_0000051_161364_162308 314
194 3300046524 Ga0495648_0005515 Ga0495648_0005515_2624_3568 314
195 3300046524 Ga0495648_0030955 Ga0495648_0030955_1764_2708 314
196 3300046525 Ga0495663_0000012 Ga0495663_0000012_113212_114156 314
197 3300046530 Ga0495654_0025597 Ga0495654_0025597_246_1190 314
198 3300046530 Ga0495654_0061125 Ga0495654_0061125_194_1138 314
199 3300046558 Ga0495633_0000312 Ga0495633_0000312_21412_22356 314
200 3300046692 Ga0495671_0000036 Ga0495671_0000036_163273_164217 314
201 3300047470 Ga0495681_0000037 Ga0495681_0000037_35362_36306 314
202 3300047470 Ga0495681_0002391 Ga0495681_0002391_475_1419 314
203 3300048090 Ga0495615_0000002 Ga0495615_0000002_22488_23432 314
204 3300048091 Ga0495626_0000852 Ga0495626_0000852_20124_21068 314
205 3300048919 Ga0496116_0000093 Ga0496116_0000093_148031_149050 314
206 3300048921 Ga0496118_0033605 Ga0496118_0033605_1017_2036 314
207 3300048924 Ga0496121_0004428 Ga0496121_0004428_1518_2462 314
208 3300048925 Ga0496122_0000702 Ga0496122_0000702_9040_10059 314
209 3300048925 Ga0496122_0010843 Ga0496122_0010843_5094_6038 314
210 3300048926 Ga0496123_0000914 Ga0496123_0000914_5229_6248 314
211 3300048926 Ga0496123_0061160 Ga0496123_0061160_1050_1994 314
212 3300048927 Ga0496124_0008549 Ga0496124_0008549_4713_5732 314
213 3300048927 Ga0496124_0025049 Ga0496124_0025049_2326_3270 314
214 3300048927 Ga0496124_0034344 Ga0496124_0034344_1308_2252 314
215 3300048928 Ga0496125_0000373 Ga0496125_0000373_51932_52876 314
216 3300048928 Ga0496125_0030387 Ga0496125_0030387_3710_4729 314
217 3300048929 Ga0496126_0000512 Ga0496126_0000512_17929_18948 314
218 3300048929 Ga0496126_0368496 Ga0496126_0368496_190_1134 314
219 3300050489 nmdc:mga03683_24869_c1 nmdc:mga03683_24869_c1_725_1669 314
220 3300050489 nmdc:mga03683_48550_c1 nmdc:mga03683_48550_c1_191_1135 314
221 3300050493 nmdc:mga0k408_84305_c1 nmdc:mga0k408_84305_c1_339_1283 314
222 3300050493 nmdc:mga0k408_85160_c1 nmdc:mga0k408_85160_c1_751_1695 314
223 3300053118 Ga0500594_0056774 Ga0500594_0056774_34_978 314
224 3300053138 Ga0500564_001755 Ga0500564_001755_207_1151 314
225 3300053723 Ga0500567_001363 Ga0500567_001363_1362_2306 314
226 3300053729 Ga0500625_000012 Ga0500625_000012_80597_81541 314
227 iso_pu_bacteria 2919709256 2919709961 314
228 3300001915 JGI24741J21665_1000204 JGI24741J21665_100020412 315
229 3300001979 JGI24740J21852_10000043 JGI24740J21852_1000004317 315
230 3300001990 JGI24737J22298_10000947 JGI24737J22298_100009474 315
231 3300005539 Ga0068853_100139822 Ga0068853_1001398222 315
232 3300005616 Ga0068852_100138971 Ga0068852_1001389712 315
233 3300025904 Ga0207647_10082511 Ga0207647_100825112 315
234 3300026078 Ga0207702_10323644 Ga0207702_103236442 315
235 3300026142 Ga0207698_10153584 Ga0207698_101535842 315
236 3300031911 Ga0307412_10077360 Ga0307412_100773602 315
237 3300031995 Ga0307409_100053268 Ga0307409_1000532682 315
238 3300032004 Ga0307414_10012568 Ga0307414_100125682 315
239 iso_pu_bacteria 2643221558 2643814998 315
240 3300009093 Ga0105240_10509329 Ga0105240_105093291 316
241 iso_pu_bacteria 2919138771 2919139549 316
242 iso_pu_bacteria 8055431914 8055432559 316
243 3300039062 Ga0400483_048519 Ga0400483_048519_4847_5806 317
244 3300045836 Ga0466958_0000355 Ga0466958_0000355_11631_12620 317
245 3300046500 Ga0495596_0001732 Ga0495596_0001732_2523_3476 317
246 3300047472 Ga0495686_0069693 Ga0495686_0069693_779_1732 317
247 3300053080 Ga0500635_0001737 Ga0500635_0001737_1600_2556 317
248 iso_pu_bacteria 2599185359 2600226176 317
249 iso_pu_bacteria 3000865235 3000867523 317
250 3300046460 Ga0495638_0000024 Ga0495638_0000024_179_1135 318
251 3300046460 Ga0495638_0000074 Ga0495638_0000074_72744_73700 318
252 3300046506 Ga0495583_0000275 Ga0495583_0000275_54522_55478 318
253 3300046506 Ga0495583_0000527 Ga0495583_0000527_575_1531 318
254 3300046512 Ga0495610_0042899 Ga0495610_0042899_387_1343 318
255 3300046519 Ga0495632_0000001 Ga0495632_0000001_117795_118751 318
256 3300046519 Ga0495632_0000813 Ga0495632_0000813_6037_6993 318
257 3300046519 Ga0495632_0006591 Ga0495632_0006591_3949_4905 318
258 3300046520 Ga0495637_0000850 Ga0495637_0000850_11358_12314 318
259 3300046522 Ga0495643_0000020 Ga0495643_0000020_102556_103512 318
260 3300046524 Ga0495648_0000005 Ga0495648_0000005_179_1135 318
261 3300046524 Ga0495648_0000050 Ga0495648_0000050_72744_73700 318
262 3300046525 Ga0495663_0000002 Ga0495663_0000002_116125_117081 318
263 3300046558 Ga0495633_0000413 Ga0495633_0000413_29391_30347 318
264 3300046558 Ga0495633_0013178 Ga0495633_0013178_480_1436 318
265 3300046558 Ga0495633_0034785 Ga0495633_0034785_310_1266 318
266 3300046692 Ga0495671_0000016 Ga0495671_0000016_102556_103512 318
267 3300046692 Ga0495671_0000096 Ga0495671_0000096_27335_28291 318
268 3300046692 Ga0495671_0000187 Ga0495671_0000187_587_1543 318
269 3300047469 Ga0495673_0000157 Ga0495673_0000157_27335_28291 318
270 3300047469 Ga0495673_0000365 Ga0495673_0000365_587_1543 318
271 3300047470 Ga0495681_0000208 Ga0495681_0000208_6577_7533 318
272 3300047472 Ga0495686_0009263 Ga0495686_0009263_5870_6826 318
273 3300003316 rootH1_10058872 rootH1_100588727 319
274 3300003322 rootL2_10060416 rootL2_1006041611 319
275 3300005841 Ga0068863_100336005 Ga0068863_1003360052 319
276 3300006237 Ga0097621_100186645 Ga0097621_1001866452 319
277 3300006358 Ga0068871_100330004 Ga0068871_1003300042 319
278 3300009093 Ga0105240_10000121 Ga0105240_1000012144 319
279 3300021361 Ga0213872_10041975 Ga0213872_100419751 319
280 3300025229 Ga0209147_100763 Ga0209147_1007633 319
281 3300025913 Ga0207695_10000006 Ga0207695_10000006441 319
282 3300046453 Ga0495627_000804 Ga0495627_000804_1421_2380 319
283 3300046453 Ga0495627_033046 Ga0495627_033046_154_1113 319
284 3300046491 Ga0495584_0194802 Ga0495584_0194802_11_970 319
285 3300046492 Ga0495585_0127167 Ga0495585_0127167_183_1160 319
286 3300046512 Ga0495610_0026473 Ga0495610_0026473_1485_2612 319
287 3300046512 Ga0495610_0052989 Ga0495610_0052989_325_1284 319
288 3300046519 Ga0495632_0000001 Ga0495632_0000001_384885_385844 319
289 3300046520 Ga0495637_0000826 Ga0495637_0000826_11486_12445 319
290 3300046522 Ga0495643_0000006 Ga0495643_0000006_75047_76006 319
291 3300046522 Ga0495643_0071188 Ga0495643_0071188_645_1622 319
292 3300046525 Ga0495663_0000002 Ga0495663_0000002_383215_384174 319
293 3300046558 Ga0495633_0000208 Ga0495633_0000208_49050_50009 319
294 3300046558 Ga0495633_0000470 Ga0495633_0000470_4817_5971 319
295 3300046558 Ga0495633_0004138 Ga0495633_0004138_3574_4533 319
296 3300046660 Ga0495625_0225685 Ga0495625_0225685_94_1053 319
297 3300046692 Ga0495671_0000008 Ga0495671_0000008_75047_76006 319
298 3300047470 Ga0495681_0001363 Ga0495681_0001363_13052_14011 319
299 3300047472 Ga0495686_0078788 Ga0495686_0078788_608_1573 319
300 3300047472 Ga0495686_0191365 Ga0495686_0191365_177_1136 319
301 3300048928 Ga0496125_0007575 Ga0496125_0007575_8203_9177 319
302 3300048929 Ga0496126_0053896 Ga0496126_0053896_1424_2398 319
303 3300053087 Ga0500643_000162 Ga0500643_000162_13699_14658 319
304 3300053108 Ga0500562_000306 Ga0500562_000306_3166_4125 319
305 3300053108 Ga0500562_004347 Ga0500562_004347_2283_3242 319
306 3300053121 Ga0500607_000045 Ga0500607_000045_73028_73987 319
307 3300053125 Ga0500618_000993 Ga0500618_000993_8299_9258 319
308 3300053136 Ga0500559_0002057 Ga0500559_0002057_9244_10203 319
309 3300053136 Ga0500559_0022654 Ga0500559_0022654_319_1278 319
310 3300053178 Ga0500637_0029458 Ga0500637_0029458_82_1041 319
311 3300053730 Ga0500645_017281 Ga0500645_017281_397_1356 319
312 iso_pu_bacteria 8002745576 8002747221 319
313 3300005289 Ga0065704_10098629 Ga0065704_100986292 320
314 3300005331 Ga0070670_100036548 Ga0070670_1000365483 320
315 3300005347 Ga0070668_100016788 Ga0070668_1000167884 320
316 3300005355 Ga0070671_100011225 Ga0070671_1000112256 320
317 3300005355 Ga0070671_100121933 Ga0070671_1001219332 320
318 3300005548 Ga0070665_100036260 Ga0070665_1000362605 320
319 3300005577 Ga0068857_100030321 Ga0068857_1000303218 320
320 3300005618 Ga0068864_100063466 Ga0068864_1000634662 320
321 3300005618 Ga0068864_100245242 Ga0068864_1002452422 320
322 3300005719 Ga0068861_100369219 Ga0068861_1003692192 320
323 3300009011 Ga0105251_10001809 Ga0105251_1000180912 320
324 3300009553 Ga0105249_10033714 Ga0105249_100337143 320
325 3300017792 Ga0163161_10002180 Ga0163161_100021809 320
326 3300017792 Ga0163161_10016322 Ga0163161_100163224 320
327 3300025923 Ga0207681_10062976 Ga0207681_100629762 320
328 3300025925 Ga0207650_10096157 Ga0207650_100961572 320
329 3300025931 Ga0207644_10021555 Ga0207644_100215554 320
330 3300025972 Ga0207668_10005778 Ga0207668_100057785 320
331 3300026095 Ga0207676_10054692 Ga0207676_100546922 320
332 3300026095 Ga0207676_10145144 Ga0207676_101451442 320
333 3300026118 Ga0207675_100255201 Ga0207675_1002552012 320
334 3300028379 Ga0268266_10119155 Ga0268266_101191552 320
335 3300031251 Ga0265327_10002198 Ga0265327_1000219812 320
336 3300031456 Ga0307513_10090272 Ga0307513_100902722 320
337 3300031711 Ga0265314_10036108 Ga0265314_100361083 320
338 3300035692 Ga0373935_0027934 Ga0373935_0027934_595_1566 320
339 3300035695 Ga0373927_0001162 Ga0373927_0001162_1898_2869 320
340 3300037068 Ga0373925_0000991 Ga0373925_0000991_7976_8947 320
341 3300045051 Ga0451576_0051839 Ga0451576_0051839_2048_3037 320
342 3300048905 Ga0496102_0164084 Ga0496102_0164084_398_1369 320
343 3300048912 Ga0496109_0114978 Ga0496109_0114978_1374_2345 320
344 3300048913 Ga0496110_0053470 Ga0496110_0053470_410_1381 320
345 3300048914 Ga0496111_0058545 Ga0496111_0058545_963_1934 320
346 3300048916 Ga0496113_0036418 Ga0496113_0036418_2603_3574 320
347 3300048917 Ga0496114_0006351 Ga0496114_0006351_946_1908 320
348 3300048919 Ga0496116_0019366 Ga0496116_0019366_405_1376 320
349 3300048920 Ga0496117_0057598 Ga0496117_0057598_428_1408 320
350 3300048920 Ga0496117_0062063 Ga0496117_0062063_964_1935 320
351 3300048920 Ga0496117_0125437 Ga0496117_0125437_77_1072 320
352 3300048921 Ga0496118_0005210 Ga0496118_0005210_4700_5695 320
353 3300048921 Ga0496118_0056320 Ga0496118_0056320_970_1941 320
354 3300048921 Ga0496118_0183043 Ga0496118_0183043_82_1062 320
355 3300048924 Ga0496121_0025046 Ga0496121_0025046_3420_4391 320
356 3300048925 Ga0496122_0097126 Ga0496122_0097126_858_1829 320
357 3300048927 Ga0496124_0095884 Ga0496124_0095884_492_1463 320
358 3300048929 Ga0496126_0072905 Ga0496126_0072905_1999_2970 320
359 3300053119 Ga0500595_021185 Ga0500595_021185_263_1243 320
360 iso_pu_bacteria 2818991438 2819555468 320
361 iso_pu_bacteria 2896184354 2896187030 320
362 3300005327 Ga0070658_10287692 Ga0070658_102876922 321
363 3300005328 Ga0070676_10210184 Ga0070676_102101842 321
364 3300005331 Ga0070670_100008343 Ga0070670_1000083435 321
365 3300005335 Ga0070666_10072946 Ga0070666_100729463 321
366 3300005353 Ga0070669_100034151 Ga0070669_1000341512 321
367 3300005354 Ga0070675_100064017 Ga0070675_1000640173 321
368 3300005354 Ga0070675_100072390 Ga0070675_1000723902 321
369 3300005355 Ga0070671_100091423 Ga0070671_1000914233 321
370 3300005364 Ga0070673_100007256 Ga0070673_1000072565 321
371 3300005365 Ga0070688_100056433 Ga0070688_1000564332 321
372 3300005367 Ga0070667_100210924 Ga0070667_1002109242 321
373 3300005455 Ga0070663_100032188 Ga0070663_1000321884 321
374 3300005457 Ga0070662_100031732 Ga0070662_1000317323 321
375 3300005543 Ga0070672_100000872 Ga0070672_1000008726 321
376 3300005543 Ga0070672_100284434 Ga0070672_1002844342 321
377 3300005563 Ga0068855_100123559 Ga0068855_1001235593 321
378 3300005618 Ga0068864_100401156 Ga0068864_1004011562 321
379 3300005719 Ga0068861_100298297 Ga0068861_1002982972 321
380 3300005843 Ga0068860_100230210 Ga0068860_1002302102 321
381 3300005985 Ga0081539_10000001 Ga0081539_1000000116 321
382 3300006177 Ga0075362_10000040 Ga0075362_1000004012 321
383 3300006195 Ga0075366_10021460 Ga0075366_100214604 321
384 3300009177 Ga0105248_10055553 Ga0105248_100555535 321
385 3300013306 Ga0163162_10131849 Ga0163162_101318493 321
386 3300013306 Ga0163162_10295572 Ga0163162_102955722 321
387 3300013307 Ga0157372_10204213 Ga0157372_102042133 321
388 3300013308 Ga0157375_10037462 Ga0157375_100374623 321
389 3300014326 Ga0157380_10147364 Ga0157380_101473642 321
390 3300025272 Ga0209455_1010049 Ga0209455_10100493 321
391 3300025904 Ga0207647_10067164 Ga0207647_100671643 321
392 3300025913 Ga0207695_10255720 Ga0207695_102557202 321
393 3300025920 Ga0207649_10098820 Ga0207649_100988203 321
394 3300025925 Ga0207650_10016772 Ga0207650_100167722 321
395 3300025926 Ga0207659_10065719 Ga0207659_100657192 321
396 3300025933 Ga0207706_10024381 Ga0207706_100243816 321
397 3300025940 Ga0207691_10005079 Ga0207691_1000507911 321
398 3300025941 Ga0207711_10024045 Ga0207711_100240454 321
399 3300025949 Ga0207667_10002681 Ga0207667_100026813 321
400 3300025960 Ga0207651_10002469 Ga0207651_100024695 321
401 3300025960 Ga0207651_10065019 Ga0207651_100650193 321
402 3300026095 Ga0207676_10317648 Ga0207676_103176482 321
403 3300028379 Ga0268266_10122130 Ga0268266_101221304 321
404 3300028381 Ga0268264_10219456 Ga0268264_102194562 321
405 3300031456 Ga0307513_10000034 Ga0307513_1000003490 321
406 3300045051 Ga0451576_0001437 Ga0451576_0001437_20950_21939 321
407 3300046506 Ga0495583_0022408 Ga0495583_0022408_1794_2759 321
408 3300046660 Ga0495625_0032733 Ga0495625_0032733_154_1128 321
409 3300046692 Ga0495671_0010581 Ga0495671_0010581_2925_3899 321
410 3300048921 Ga0496118_0004744 Ga0496118_0004744_6235_7200 321
411 3300048924 Ga0496121_0014480 Ga0496121_0014480_5835_6815 321
412 3300049570 Ga0501033_0000059 Ga0501033_0000059_19434_20411 321
413 3300049822 Ga0501035_0000213 Ga0501035_0000213_452_1429 321
414 3300050489 nmdc:mga03683_2_c1 nmdc:mga03683_2_c1_106749_107723 321
415 3300050490 nmdc:mga03n38_1707_c1 nmdc:mga03n38_1707_c1_3859_4833 321
416 3300050493 nmdc:mga0k408_2_c1 nmdc:mga0k408_2_c1_14864_15838 321
417 3300050516 nmdc:mga0sz30_3405_c2 nmdc:mga0sz30_3405_c2_2975_3949 321
418 3300053118 Ga0500594_0007498 Ga0500594_0007498_872_1846 321
419 3300053130 Ga0500642_0000003 Ga0500642_0000003_208411_209376 321
420 iso_pu_bacteria 2582581305 2585263466 321
421 iso_pu_bacteria 2751185897 2753763571 321
422 3300001915 JGI24741J21665_1000021 JGI24741J21665_100002118 322
423 3300001979 JGI24740J21852_10007599 JGI24740J21852_100075992 322
424 3300001990 JGI24737J22298_10001005 JGI24737J22298_100010055 322
425 3300002067 JGI24735J21928_10010665 JGI24735J21928_100106653 322
426 3300003215 JGI25153J46596_10000005 JGI25153J46596_10000005113 322
427 3300005327 Ga0070658_10167781 Ga0070658_101677811 322
428 3300005339 Ga0070660_100121065 Ga0070660_1001210652 322
429 3300005344 Ga0070661_100016878 Ga0070661_1000168781 322
430 3300005366 Ga0070659_100057839 Ga0070659_1000578392 322
431 3300005455 Ga0070663_100005836 Ga0070663_1000058366 322
432 3300005563 Ga0068855_100019318 Ga0068855_10001931811 322
433 3300005564 Ga0070664_100195369 Ga0070664_1001953692 322
434 3300005577 Ga0068857_100237952 Ga0068857_1002379522 322
435 3300005614 Ga0068856_100165658 Ga0068856_1001656582 322
436 3300009174 Ga0105241_10177281 Ga0105241_101772813 322
437 3300009545 Ga0105237_10055147 Ga0105237_100551473 322
438 3300010375 Ga0105239_10005768 Ga0105239_1000576818 322
439 3300013308 Ga0157375_10252678 Ga0157375_102526781 322
440 3300025297 Ga0209758_1000001 Ga0209758_1000001113 322
441 3300025298 Ga0209050_1001048 Ga0209050_10010486 322
442 3300025321 Ga0207656_10012645 Ga0207656_100126453 322
443 3300025321 Ga0207656_10038474 Ga0207656_100384742 322
444 3300025911 Ga0207654_10024069 Ga0207654_100240692 322
445 3300025914 Ga0207671_10120423 Ga0207671_101204231 322
446 3300025919 Ga0207657_10014853 Ga0207657_100148537 322
447 3300025945 Ga0207679_10054153 Ga0207679_100541532 322
448 3300025949 Ga0207667_10016478 Ga0207667_1001647812 322
449 3300026041 Ga0207639_10001020 Ga0207639_1000102011 322
450 3300026067 Ga0207678_10000801 Ga0207678_100008019 322
451 3300026078 Ga0207702_10004499 Ga0207702_100044996 322
452 3300026116 Ga0207674_10446228 Ga0207674_104462282 322
453 3300026142 Ga0207698_10007180 Ga0207698_100071803 322
454 3300031247 Ga0265340_10028348 Ga0265340_100283483 322
455 3300031731 Ga0307405_10062434 Ga0307405_100624344 322
456 3300031901 Ga0307406_10051052 Ga0307406_100510523 322
457 3300031901 Ga0307406_10064151 Ga0307406_100641512 322
458 3300031911 Ga0307412_10035794 Ga0307412_100357941 322
459 3300031911 Ga0307412_10101111 Ga0307412_101011112 322
460 3300031995 Ga0307409_100209284 Ga0307409_1002092842 322
461 3300032004 Ga0307414_10003631 Ga0307414_100036311 322
462 3300039062 Ga0400483_050097 Ga0400483_050097_96_1070 322
463 3300046500 Ga0495596_0000136 Ga0495596_0000136_44331_45305 322
464 3300046512 Ga0495610_0005525 Ga0495610_0005525_3405_4379 322
465 3300046524 Ga0495648_0006642 Ga0495648_0006642_1490_2461 322
466 3300046692 Ga0495671_0017625 Ga0495671_0017625_454_1422 322
467 3300048925 Ga0496122_0017535 Ga0496122_0017535_3578_4546 322
468 3300048927 Ga0496124_0000374 Ga0496124_0000374_26089_27057 322
469 3300048928 Ga0496125_0000373 Ga0496125_0000373_20527_21495 322
470 3300048929 Ga0496126_0022194 Ga0496126_0022194_3074_4042 322
471 3300053118 Ga0500594_0004429 Ga0500594_0004429_1065_2033 322
472 iso_pu_bacteria 2738541275 2738710778 322
473 iso_pu_bacteria 2738541301 2738849203 322
474 iso_pu_bacteria 2738541304 2738864932 322
475 iso_pu_bacteria 2738543022 2739297450 322
476 iso_pu_bacteria 2738543033 2739359128 322
477 iso_pu_bacteria 2928100450 2928100880 322
478 iso_pu_bacteria 2928959182 2928962287 322
479 iso_pu_bacteria 8057101203 8057102197 322
480 3300005328 Ga0070676_10023574 Ga0070676_100235742 323
481 3300005329 Ga0070683_100133055 Ga0070683_1001330552 323
482 3300005331 Ga0070670_100117660 Ga0070670_1001176602 323
483 3300005334 Ga0068869_100025861 Ga0068869_1000258613 323
484 3300005335 Ga0070666_10036790 Ga0070666_100367903 323
485 3300005340 Ga0070689_100030340 Ga0070689_1000303403 323
486 3300005343 Ga0070687_100079499 Ga0070687_1000794992 323
487 3300005344 Ga0070661_100015978 Ga0070661_1000159783 323
488 3300005344 Ga0070661_100081024 Ga0070661_1000810242 323
489 3300005354 Ga0070675_100017384 Ga0070675_1000173843 323
490 3300005356 Ga0070674_100003725 Ga0070674_1000037255 323
491 3300005364 Ga0070673_100026968 Ga0070673_1000269683 323
492 3300005365 Ga0070688_100062645 Ga0070688_1000626452 323
493 3300005367 Ga0070667_100012614 Ga0070667_1000126146 323
494 3300005455 Ga0070663_100028464 Ga0070663_1000284644 323
495 3300005456 Ga0070678_100032869 Ga0070678_1000328695 323
496 3300005457 Ga0070662_100036683 Ga0070662_1000366832 323
497 3300005466 Ga0070685_10018913 Ga0070685_100189132 323
498 3300005543 Ga0070672_100086646 Ga0070672_1000866462 323
499 3300005544 Ga0070686_100099367 Ga0070686_1000993672 323
500 3300005564 Ga0070664_100012745 Ga0070664_1000127454 323
501 3300005617 Ga0068859_100055972 Ga0068859_1000559722 323
502 3300005617 Ga0068859_100108799 Ga0068859_1001087992 323
503 3300005834 Ga0068851_10044065 Ga0068851_100440652 323
504 3300005841 Ga0068863_100038607 Ga0068863_1000386072 323
505 3300006931 Ga0097620_100055973 Ga0097620_1000559732 323
506 3300006931 Ga0097620_100108791 Ga0097620_1001087912 323
507 3300009177 Ga0105248_10233496 Ga0105248_102334962 323
508 3300014326 Ga0157380_10126611 Ga0157380_101266112 323
509 3300014745 Ga0157377_10006308 Ga0157377_100063084 323
510 3300014968 Ga0157379_10129206 Ga0157379_101292062 323
511 3300025321 Ga0207656_10029633 Ga0207656_100296332 323
512 3300025893 Ga0207682_10006701 Ga0207682_100067012 323
513 3300025903 Ga0207680_10019437 Ga0207680_100194373 323
514 3300025907 Ga0207645_10029241 Ga0207645_100292412 323
515 3300025918 Ga0207662_10182485 Ga0207662_101824852 323
516 3300025926 Ga0207659_10007271 Ga0207659_100072713 323
517 3300025933 Ga0207706_10041697 Ga0207706_100416973 323
518 3300025937 Ga0207669_10003436 Ga0207669_100034362 323
519 3300025942 Ga0207689_10036853 Ga0207689_100368533 323
520 3300025945 Ga0207679_10000640 Ga0207679_1000064012 323
521 3300025960 Ga0207651_10002413 Ga0207651_100024137 323
522 3300025986 Ga0207658_10056441 Ga0207658_100564413 323
523 3300026067 Ga0207678_10053121 Ga0207678_100531213 323
524 3300026088 Ga0207641_10052577 Ga0207641_100525772 323
525 3300028381 Ga0268264_10028752 Ga0268264_100287522 323
526 3300036712 Ga0316584_0092524 Ga0316584_0092524_48_1019 323
527 3300046453 Ga0495627_000520 Ga0495627_000520_15566_16549 323
528 3300046455 Ga0495603_0166890 Ga0495603_0166890_87_1118 323
529 3300046471 Ga0495650_0001824 Ga0495650_0001824_2556_3539 323
530 3300046499 Ga0495594_0051755 Ga0495594_0051755_111_1142 323
531 3300046512 Ga0495610_0003976 Ga0495610_0003976_8036_9019 323
532 3300046515 Ga0495620_0001019 Ga0495620_0001019_566_1549 323
533 3300046519 Ga0495632_0070173 Ga0495632_0070173_537_1520 323
534 3300047470 Ga0495681_0000437 Ga0495681_0000437_15417_16400 323
535 3300048912 Ga0496109_0146367 Ga0496109_0146367_402_1400 323
536 3300053087 Ga0500643_020651 Ga0500643_020651_1061_2041 323
537 3300053120 Ga0500597_009023 Ga0500597_009023_2119_3090 323
538 3300053157 Ga0500624_000098 Ga0500624_000098_9746_10717 323
539 3300053178 Ga0500637_0000055 Ga0500637_0000055_9746_10717 323
540 3300005335 Ga0070666_10077232 Ga0070666_100772323 324
541 3300005364 Ga0070673_100087594 Ga0070673_1000875942 324
542 3300021361 Ga0213872_10084398 Ga0213872_100843983 324
543 3300025933 Ga0207706_10042913 Ga0207706_100429132 324
544 3300025940 Ga0207691_10026614 Ga0207691_100266145 324
545 3300028794 Ga0307515_10051473 Ga0307515_100514733 324
546 3300031456 Ga0307513_10057878 Ga0307513_100578784 324
547 3300039447 Ga0436361_0812819 Ga0436361_0812819_3622_4605 324
548 3300001915 JGI24741J21665_1001619 JGI24741J21665_10016196 325
549 3300001979 JGI24740J21852_10004146 JGI24740J21852_100041464 325
550 3300001990 JGI24737J22298_10000054 JGI24737J22298_100000544 325
551 3300003322 rootL2_10095669 rootL2_100956691 325
552 3300005327 Ga0070658_10000937 Ga0070658_100009373 325
553 3300005329 Ga0070683_100105391 Ga0070683_1001053914 325
554 3300005344 Ga0070661_100117773 Ga0070661_1001177732 325
555 3300005356 Ga0070674_100000078 Ga0070674_10000007829 325
556 3300005456 Ga0070678_100000005 Ga0070678_10000000528 325
557 3300005564 Ga0070664_100020156 Ga0070664_1000201567 325
558 3300005578 Ga0068854_100211949 Ga0068854_1002119492 325
559 3300005616 Ga0068852_100136243 Ga0068852_1001362432 325
560 3300006237 Ga0097621_100004748 Ga0097621_10000474811 325
561 3300006358 Ga0068871_100013227 Ga0068871_1000132274 325
562 3300009093 Ga0105240_10708390 Ga0105240_107083901 325
563 3300009148 Ga0105243_10000030 Ga0105243_1000003042 325
564 3300009174 Ga0105241_10000799 Ga0105241_1000079917 325
565 3300010375 Ga0105239_10267262 Ga0105239_102672622 325
566 3300011119 Ga0105246_10263859 Ga0105246_102638591 325
567 3300013100 Ga0157373_10019281 Ga0157373_100192813 325
568 3300013102 Ga0157371_10000757 Ga0157371_1000075732 325
569 3300013105 Ga0157369_10129916 Ga0157369_101299162 325
570 3300013296 Ga0157374_10167170 Ga0157374_101671702 325
571 3300013307 Ga0157372_10217348 Ga0157372_102173483 325
572 3300014969 Ga0157376_10235690 Ga0157376_102356901 325
573 3300017792 Ga0163161_10151988 Ga0163161_101519882 325
574 3300025321 Ga0207656_10004092 Ga0207656_100040924 325
575 3300025904 Ga0207647_10027409 Ga0207647_100274093 325
576 3300025909 Ga0207705_10000157 Ga0207705_1000015762 325
577 3300025911 Ga0207654_10040965 Ga0207654_100409652 325
578 3300025913 Ga0207695_10007333 Ga0207695_1000733314 325
579 3300025914 Ga0207671_10006621 Ga0207671_100066212 325
580 3300025919 Ga0207657_10001229 Ga0207657_100012293 325
581 3300025920 Ga0207649_10010980 Ga0207649_100109804 325
582 3300025924 Ga0207694_10112313 Ga0207694_101123132 325
583 3300025932 Ga0207690_10000368 Ga0207690_1000036814 325
584 3300025935 Ga0207709_10000137 Ga0207709_1000013742 325
585 3300025937 Ga0207669_10000093 Ga0207669_100000936 325
586 3300025945 Ga0207679_10160530 Ga0207679_101605302 325
587 3300025949 Ga0207667_10000006 Ga0207667_10000006290 325
588 3300026041 Ga0207639_10000185 Ga0207639_1000018537 325
589 3300026067 Ga0207678_10000545 Ga0207678_100005453 325
590 3300026078 Ga0207702_10016210 Ga0207702_100162105 325
591 3300026116 Ga0207674_10031539 Ga0207674_100315392 325
592 3300026121 Ga0207683_10000115 Ga0207683_1000011530 325
593 3300026142 Ga0207698_10011849 Ga0207698_100118494 325
594 3300026142 Ga0207698_10041531 Ga0207698_100415312 325
595 3300028794 Ga0307515_10140118 Ga0307515_101401183 325
596 3300028800 Ga0265338_10059595 Ga0265338_100595953 325
597 3300031507 Ga0307509_10232840 Ga0307509_102328402 325
598 3300033180 Ga0307510_10002596 Ga0307510_1000259613 325
599 3300036647 Ga0316582_0000197 Ga0316582_0000197_1465_2448 325
600 3300036712 Ga0316584_0213817 Ga0316584_0213817_167_1150 325
601 3300046471 Ga0495650_0073563 Ga0495650_0073563_241_1218 325
602 3300046557 Ga0495622_0042546 Ga0495622_0042546_214_1191 325
603 3300053136 Ga0500559_0012209 Ga0500559_0012209_1566_2543 325
604 3300053136 Ga0500559_0027306 Ga0500559_0027306_815_1792 325
605 3300001904 JGI24736J21556_1000219 JGI24736J21556_10002199 326
606 3300001979 JGI24740J21852_10001202 JGI24740J21852_100012027 326
607 3300001989 JGI24739J22299_10017169 JGI24739J22299_100171692 326
608 3300001990 JGI24737J22298_10022508 JGI24737J22298_100225082 326
609 3300002067 JGI24735J21928_10001235 JGI24735J21928_100012354 326
610 3300002075 JGI24738J21930_10004705 JGI24738J21930_100047053 326
611 3300002077 JGI24744J21845_10004568 JGI24744J21845_100045683 326
612 3300003322 rootL2_10165326 rootL2_101653262 326
613 3300003322 rootL2_10201879 rootL2_102018794 326
614 3300005335 Ga0070666_10086650 Ga0070666_100866501 326
615 3300005344 Ga0070661_100136144 Ga0070661_1001361442 326
616 3300005355 Ga0070671_100011172 Ga0070671_1000111727 326
617 3300005364 Ga0070673_100082551 Ga0070673_1000825513 326
618 3300005455 Ga0070663_100038633 Ga0070663_1000386332 326
619 3300005456 Ga0070678_100012235 Ga0070678_1000122355 326
620 3300005456 Ga0070678_100107199 Ga0070678_1001071992 326
621 3300005457 Ga0070662_100040872 Ga0070662_1000408724 326
622 3300005457 Ga0070662_100176791 Ga0070662_1001767912 326
623 3300005539 Ga0068853_100134268 Ga0068853_1001342682 326
624 3300005539 Ga0068853_100377060 Ga0068853_1003770602 326
625 3300005543 Ga0070672_100049640 Ga0070672_1000496402 326
626 3300005564 Ga0070664_100109707 Ga0070664_1001097072 326
627 3300005577 Ga0068857_100156240 Ga0068857_1001562402 326
628 3300005614 Ga0068856_100032979 Ga0068856_1000329792 326
629 3300005616 Ga0068852_100286635 Ga0068852_1002866352 326
630 3300005834 Ga0068851_10004933 Ga0068851_100049332 326
631 3300005840 Ga0068870_10131776 Ga0068870_101317762 326
632 3300005841 Ga0068863_100523626 Ga0068863_1005236261 326
633 3300005842 Ga0068858_100000310 Ga0068858_1000003105 326
634 3300005843 Ga0068860_100002446 Ga0068860_1000024461 326
635 3300005844 Ga0068862_100000699 Ga0068862_10000069928 326
636 3300009093 Ga0105240_10082383 Ga0105240_100823831 326
637 3300009098 Ga0105245_10001044 Ga0105245_100010449 326
638 3300009101 Ga0105247_10001062 Ga0105247_1000106218 326
639 3300009148 Ga0105243_10054917 Ga0105243_100549173 326
640 3300009545 Ga0105237_10361523 Ga0105237_103615231 326
641 3300009551 Ga0105238_10007472 Ga0105238_100074722 326
642 3300009553 Ga0105249_10000196 Ga0105249_100001961 326
643 3300010375 Ga0105239_10404293 Ga0105239_104042932 326
644 3300013105 Ga0157369_10071138 Ga0157369_100711383 326
645 3300013307 Ga0157372_10405894 Ga0157372_104058941 326
646 3300014325 Ga0163163_10016474 Ga0163163_100164744 326
647 3300025321 Ga0207656_10037068 Ga0207656_100370682 326
648 3300025900 Ga0207710_10006828 Ga0207710_100068282 326
649 3300025903 Ga0207680_10082882 Ga0207680_100828821 326
650 3300025904 Ga0207647_10002614 Ga0207647_100026147 326
651 3300025908 Ga0207643_10132844 Ga0207643_101328442 326
652 3300025911 Ga0207654_10001685 Ga0207654_100016852 326
653 3300025914 Ga0207671_10004267 Ga0207671_1000426712 326
654 3300025924 Ga0207694_10090041 Ga0207694_100900414 326
655 3300025927 Ga0207687_10002747 Ga0207687_100027472 326
656 3300025932 Ga0207690_10299924 Ga0207690_102999242 326
657 3300025933 Ga0207706_10041335 Ga0207706_100413353 326
658 3300025933 Ga0207706_10180760 Ga0207706_101807602 326
659 3300025940 Ga0207691_10096866 Ga0207691_100968662 326
660 3300025945 Ga0207679_10124169 Ga0207679_101241692 326
661 3300025949 Ga0207667_10051010 Ga0207667_100510105 326
662 3300025961 Ga0207712_10000015 Ga0207712_10000015365 326
663 3300026035 Ga0207703_10000757 Ga0207703_1000075718 326
664 3300026041 Ga0207639_10050242 Ga0207639_100502424 326
665 3300026041 Ga0207639_10261251 Ga0207639_102612512 326
666 3300026067 Ga0207678_10121804 Ga0207678_101218043 326
667 3300026078 Ga0207702_10004461 Ga0207702_1000446111 326
668 3300026078 Ga0207702_10009706 Ga0207702_100097066 326
669 3300026088 Ga0207641_10001505 Ga0207641_100015059 326
670 3300026089 Ga0207648_10044737 Ga0207648_100447373 326
671 3300026116 Ga0207674_10085338 Ga0207674_100853382 326
672 3300026121 Ga0207683_10053762 Ga0207683_100537623 326
673 3300026121 Ga0207683_10141231 Ga0207683_101412312 326
674 3300028380 Ga0268265_10000658 Ga0268265_1000065827 326
675 3300028381 Ga0268264_10002774 Ga0268264_100027745 326
676 3300028573 Ga0265334_10019913 Ga0265334_100199131 326
677 3300028800 Ga0265338_10008334 Ga0265338_1000833413 326
678 3300028800 Ga0265338_10026416 Ga0265338_100264163 326
679 3300044658 Ga0466972_0020132 Ga0466972_0020132_234_1214 326
680 3300044684 Ga0466966_0032567 Ga0466966_0032567_473_1453 326
681 3300044693 Ga0466961_0091244 Ga0466961_0091244_473_1453 326
682 3300044901 Ga0466960_0086101 Ga0466960_0086101_280_1260 326
683 3300045049 Ga0466959_0039932 Ga0466959_0039932_1399_2379 326
684 3300045836 Ga0466958_0036857 Ga0466958_0036857_601_1581 326
685 3300046492 Ga0495585_0000339 Ga0495585_0000339_26479_27459 326
686 3300046492 Ga0495585_0044720 Ga0495585_0044720_591_1571 326
687 3300046507 Ga0495606_0027879 Ga0495606_0027879_1806_2786 326
688 3300046522 Ga0495643_0000859 Ga0495643_0000859_22433_23413 326
689 3300046522 Ga0495643_0001729 Ga0495643_0001729_11603_12583 326
690 3300046660 Ga0495625_0010009 Ga0495625_0010009_5216_6196 326

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF18288

FAA_hydro_N_2

Fumarylacetoacetase N-terminal domain 2

66

133

0.96

PF01557

FAA_hydrolase

Fumarylacetoacetate (FAA) hydrolase family

136

377

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lzk-assembly1.cif.gz_B the crystal structure of a probably aromatic amino acid degradation protein from sinorhizobium meliloti 1021 0.9726 1 322
3lzk-assembly1.cif.gz_B the crystal structure of a probably aromatic amino acid degradation protein from sinorhizobium meliloti 1021 0.9579 1 322
6sbj-assembly1.cif.gz_B x-ray structure of mus musculus fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) apo-form uuncomplexed 0.8603 76 321
1saw-assembly1.cif.gz_A x-ray structure of homo sapiens protein flj36880 0.8579 76 322
6sbi-assembly2.cif.gz_C x-ray structure of murine fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) in complex with inhibitor oxalate 0.8557 76 321
ID Description Score Start End Superfamily
3lzkB00 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9478 2 322 3.90.850.10
3lzkB00 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9307 2 322 3.90.850.10
af_Q9VDE2_1_220_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.8715 76 322 3.90.850.10
1wzoC02 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.8654 78 320 3.90.850.10
af_P34673_5_211_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.8629 76 315 3.90.850.10
ID Description Score Start End GO Terms
AF-I4N1P0-F1-model_v4 Hydrolase 0.9886 1 323 GO:0016787
AF-A0A520I8J2-F1-model_v4 Fumarylacetoacetate hydrolase 0.9878 1 325 GO:0003824
AF-A0A1E4MBN2-F1-model_v4 Fumarylacetoacetate hydrolase 0.9871 22 321 GO:0016787
AF-A0A7Z8LJX5-F1-model_v4 deleted 0.9866 1 321
AF-A0A519KLD5-F1-model_v4 Fumarylacetoacetate hydrolase 0.9856 172 322 GO:0016787

Feature Viewer

pLDDT pTM Quality
96.12 0.94 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map