F475428
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 690 | 294 | 690 | 205 |
Family's Representative Sequence
| Representative Sequence | 3300005455|Ga0070663_100727416|Ga0070663_1007274161 |
| Length | 239 |
| Sequence | LSPSARGGTLCEHTFGLLEETQNRMDIGKDLTKRQQEIFDFIKRYSASHGYPPTVRDIGKAVGLASSSTVHAHLANLEKVGLLRRDPSKPRAIELLDKVGSTATSALDAVKSAVLPGGLPLVGHVAAGQPLLAEENIEEYVHIPEIAGGEEGEYLLRVRGDSMIKAGIMPDDVVVVRKQDTAMDGEIVVALVGEEATVKRFFREDDHIRLQPENDALEPIRSREVNVLGRVVGVMRRVA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 6 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 32 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 36 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 44 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 45 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 46 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 48 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 49 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 50 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 51 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 52 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 53 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 54 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 55 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 56 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 57 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 58 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 59 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 60 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 65 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 66 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 67 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 68 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 69 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 70 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 71 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 72 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 73 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 97 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 98 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 99 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 100 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 101 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 102 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 103 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 104 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 105 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 163 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 166 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 167 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 168 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 169 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 170 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 171 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 172 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 173 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 174 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 175 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 176 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 177 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 178 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 179 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 180 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 181 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 182 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 183 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 184 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 185 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 186 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 187 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 188 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 189 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 190 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 191 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 192 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 193 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 194 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 195 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 196 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 197 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 198 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 199 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 200 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 201 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 202 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 203 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 204 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 205 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 206 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 207 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 208 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 209 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 210 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 211 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 212 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 241 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 242 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 243 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 244 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 245 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 246 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 247 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 248 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 249 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 250 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 251 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 252 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 253 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 254 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 255 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 256 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 257 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 263 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 266 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 272 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 279 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 280 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 281 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 282 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 283 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 284 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 285 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 286 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 291 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 293 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 294 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.84 |
| Metatranscriptomes | 1.16 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.58 |
| Nodule | 0 |
| Rhizoplane | 9.42 |
| Rhizosphere | 85.94 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.06 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10022910 | 3300003203 | Bacteria | 2477 |
| 2 | Ga0070658_10103253 | 3300005327 | Bacteria | 2358 |
| 3 | Ga0070683_100007474 | 3300005329 | Bacteria | 9231 |
| 4 | Ga0070683_100397197 | 3300005329 | Bacteria | 1315 |
| 5 | Ga0070683_100435519 | 3300005329 | Bacteria | 1251 |
| 6 | Ga0070683_100598027 | 3300005329 | Bacteria | 1055 |
| 7 | Ga0070683_100709436 | 3300005329 | Bacteria | 963 |
| 8 | Ga0070683_100904746 | 3300005329 | Bacteria | 846 |
| 9 | Ga0070683_100925172 | 3300005329 | Bacteria | 837 |
| 10 | Ga0070670_100574968 | 3300005331 | Bacteria | 1007 |
| 11 | Ga0068869_100074910 | 3300005334 | Bacteria | 2513 |
| 12 | Ga0068869_100188753 | 3300005334 | Bacteria | 1620 |
| 13 | Ga0068869_100293988 | 3300005334 | Bacteria | 1310 |
| 14 | Ga0068869_100552244 | 3300005334 | Bacteria | 968 |
| 15 | Ga0070682_100047507 | 3300005337 | Bacteria | 2669 |
| 16 | Ga0070682_100161109 | 3300005337 | Bacteria | 1549 |
| 17 | Ga0068868_100005963 | 3300005338 | Bacteria | 8594 |
| 18 | Ga0068868_100078148 | 3300005338 | Bacteria | 2648 |
| 19 | Ga0068868_100109482 | 3300005338 | Bacteria | 2243 |
| 20 | Ga0070660_100143992 | 3300005339 | Bacteria | 1914 |
| 21 | Ga0070660_100170138 | 3300005339 | Bacteria | 1759 |
| 22 | Ga0070660_100260834 | 3300005339 | Bacteria | 1415 |
| 23 | Ga0070689_100341169 | 3300005340 | Bacteria | 1255 |
| 24 | Ga0070691_10089774 | 3300005341 | Bacteria | 1514 |
| 25 | Ga0070691_10106174 | 3300005341 | Bacteria | 1400 |
| 26 | Ga0070687_100102398 | 3300005343 | Bacteria | 1606 |
| 27 | Ga0070687_100222094 | 3300005343 | Bacteria | 1158 |
| 28 | Ga0070687_100349607 | 3300005343 | Bacteria | 954 |
| 29 | Ga0070661_100434999 | 3300005344 | Bacteria | 1042 |
| 30 | Ga0070692_10170693 | 3300005345 | Bacteria | 1254 |
| 31 | Ga0070668_100623194 | 3300005347 | Bacteria | 946 |
| 32 | Ga0070668_100754621 | 3300005347 | Bacteria | 861 |
| 33 | Ga0070675_100346975 | 3300005354 | Bacteria | 1316 |
| 34 | Ga0070675_100397607 | 3300005354 | Bacteria | 1229 |
| 35 | Ga0070675_100547907 | 3300005354 | Bacteria | 1046 |
| 36 | Ga0070671_100122715 | 3300005355 | Bacteria | 2187 |
| 37 | Ga0070671_100134398 | 3300005355 | Bacteria | 2085 |
| 38 | Ga0070671_100287356 | 3300005355 | Bacteria | 1399 |
| 39 | Ga0070674_100616750 | 3300005356 | Bacteria | 919 |
| 40 | Ga0070688_100070290 | 3300005365 | Bacteria | 2238 |
| 41 | Ga0070667_100679502 | 3300005367 | Bacteria | 952 |
| 42 | Ga0070709_10191253 | 3300005434 | Bacteria | 1443 |
| 43 | Ga0070709_10428276 | 3300005434 | Bacteria | 993 |
| 44 | Ga0070714_100024840 | 3300005435 | Bacteria | 4938 |
| 45 | Ga0070714_100232070 | 3300005435 | Bacteria | 1700 |
| 46 | Ga0070714_100322256 | 3300005435 | Bacteria | 1445 |
| 47 | Ga0070714_100343587 | 3300005435 | Bacteria | 1400 |
| 48 | Ga0070714_100533198 | 3300005435 | Bacteria | 1122 |
| 49 | Ga0070713_100493749 | 3300005436 | Bacteria | 1154 |
| 50 | Ga0070701_10156982 | 3300005438 | Bacteria | 1315 |
| 51 | Ga0070701_10687931 | 3300005438 | Bacteria | 687 |
| 52 | Ga0070711_100038639 | 3300005439 | Bacteria | 3210 |
| 53 | Ga0070700_100086754 | 3300005441 | Bacteria | 2033 |
| 54 | Ga0070700_100240866 | 3300005441 | Bacteria | 1292 |
| 55 | Ga0070700_100398899 | 3300005441 | Bacteria | 1034 |
| 56 | Ga0070700_100524341 | 3300005441 | Bacteria | 916 |
| 57 | Ga0070700_100815663 | 3300005441 | Bacteria | 753 |
| 58 | Ga0070694_100248474 | 3300005444 | Bacteria | 1345 |
| 59 | Ga0070663_100155717 | 3300005455 | Bacteria | 1755 |
| 60 | Ga0070663_100320919 | 3300005455 | Bacteria | 1245 |
| 61 | Ga0070663_100454233 | 3300005455 | Bacteria | 1056 |
| 62 | Ga0070663_100727416 | 3300005455 | Bacteria | 845 |
| 63 | Ga0070678_100096897 | 3300005456 | Bacteria | 2277 |
| 64 | Ga0070678_100210719 | 3300005456 | Bacteria | 1610 |
| 65 | Ga0070678_100851399 | 3300005456 | Bacteria | 831 |
| 66 | Ga0070662_100172380 | 3300005457 | Bacteria | 1700 |
| 67 | Ga0070662_100455320 | 3300005457 | Bacteria | 1063 |
| 68 | Ga0070662_100783515 | 3300005457 | Bacteria | 810 |
| 69 | Ga0070681_10110063 | 3300005458 | Bacteria | 2694 |
| 70 | Ga0070681_10763243 | 3300005458 | Bacteria | 884 |
| 71 | Ga0068867_100162593 | 3300005459 | Bacteria | 1762 |
| 72 | Ga0068867_100248407 | 3300005459 | Bacteria | 1446 |
| 73 | Ga0070685_10157935 | 3300005466 | Bacteria | 1443 |
| 74 | Ga0070685_10659685 | 3300005466 | Bacteria | 759 |
| 75 | Ga0070707_100312238 | 3300005468 | Bacteria | 1528 |
| 76 | Ga0070684_100036531 | 3300005535 | Bacteria | 4210 |
| 77 | Ga0070684_100365237 | 3300005535 | Bacteria | 1329 |
| 78 | Ga0068853_100692705 | 3300005539 | Bacteria | 971 |
| 79 | Ga0070672_100296111 | 3300005543 | Bacteria | 1371 |
| 80 | Ga0070686_100049879 | 3300005544 | Bacteria | 2657 |
| 81 | Ga0070686_100383467 | 3300005544 | Bacteria | 1065 |
| 82 | Ga0070695_100471560 | 3300005545 | Unclassified | 966 |
| 83 | Ga0070695_100557918 | 3300005545 | Bacteria | 894 |
| 84 | Ga0070696_100601262 | 3300005546 | Bacteria | 887 |
| 85 | Ga0070693_100693577 | 3300005547 | Bacteria | 745 |
| 86 | Ga0070704_100380602 | 3300005549 | Bacteria | 1199 |
| 87 | Ga0070704_100528808 | 3300005549 | Bacteria | 1027 |
| 88 | Ga0070664_100151364 | 3300005564 | Bacteria | 2048 |
| 89 | Ga0070664_100313727 | 3300005564 | Bacteria | 1419 |
| 90 | Ga0070664_100406439 | 3300005564 | Bacteria | 1246 |
| 91 | Ga0070664_100887580 | 3300005564 | Bacteria | 836 |
| 92 | Ga0068857_100310862 | 3300005577 | Bacteria | 1454 |
| 93 | Ga0068854_100270776 | 3300005578 | Bacteria | 1363 |
| 94 | Ga0068854_100310961 | 3300005578 | Bacteria | 1278 |
| 95 | Ga0068854_100538525 | 3300005578 | Bacteria | 988 |
| 96 | Ga0068854_100783629 | 3300005578 | Bacteria | 830 |
| 97 | Ga0068856_100093313 | 3300005614 | Bacteria | 2995 |
| 98 | Ga0070702_100014714 | 3300005615 | Bacteria | 3976 |
| 99 | Ga0070702_100074320 | 3300005615 | Bacteria | 2016 |
| 100 | Ga0068852_100178790 | 3300005616 | Bacteria | 1994 |
| 101 | Ga0068852_100607450 | 3300005616 | Bacteria | 1098 |
| 102 | Ga0068864_100116436 | 3300005618 | Bacteria | 2385 |
| 103 | Ga0068864_100200761 | 3300005618 | Bacteria | 1832 |
| 104 | Ga0068864_100578992 | 3300005618 | Bacteria | 1087 |
| 105 | Ga0068866_10250230 | 3300005718 | Bacteria | 1084 |
| 106 | Ga0068861_100057717 | 3300005719 | Bacteria | 2965 |
| 107 | Ga0068861_100374746 | 3300005719 | Bacteria | 1256 |
| 108 | Ga0068861_100400006 | 3300005719 | Bacteria | 1218 |
| 109 | Ga0068851_10052622 | 3300005834 | Bacteria | 2071 |
| 110 | Ga0068851_10267609 | 3300005834 | Bacteria | 974 |
| 111 | Ga0068870_10101845 | 3300005840 | Bacteria | 1624 |
| 112 | Ga0068870_10148656 | 3300005840 | Bacteria | 1378 |
| 113 | Ga0068858_100124880 | 3300005842 | Bacteria | 2408 |
| 114 | Ga0068858_100250944 | 3300005842 | Bacteria | 1681 |
| 115 | Ga0068860_100404654 | 3300005843 | Bacteria | 1351 |
| 116 | Ga0068862_100355326 | 3300005844 | Bacteria | 1360 |
| 117 | Ga0068862_100751223 | 3300005844 | Bacteria | 949 |
| 118 | Ga0081455_10166913 | 3300005937 | Bacteria | 1681 |
| 119 | Ga0081455_10260596 | 3300005937 | Bacteria | 1263 |
| 120 | Ga0081455_10399826 | 3300005937 | Bacteria | 954 |
| 121 | Ga0081455_10504441 | 3300005937 | Bacteria | 812 |
| 122 | Ga0081538_10000064 | 3300005981 | Bacteria | 99059 |
| 123 | Ga0081538_10000513 | 3300005981 | Bacteria | 43328 |
| 124 | Ga0081538_10008464 | 3300005981 | Bacteria | 8723 |
| 125 | Ga0081538_10009204 | 3300005981 | Bacteria | 8276 |
| 126 | Ga0081538_10026242 | 3300005981 | Bacteria | 4080 |
| 127 | Ga0081538_10038336 | 3300005981 | Bacteria | 3093 |
| 128 | Ga0081538_10046914 | 3300005981 | Bacteria | 2657 |
| 129 | Ga0081538_10118593 | 3300005981 | Bacteria | 1278 |
| 130 | Ga0081540_1067451 | 3300005983 | Bacteria | 1672 |
| 131 | Ga0081539_10001687 | 3300005985 | Bacteria | 35644 |
| 132 | Ga0081539_10024918 | 3300005985 | Bacteria | 3867 |
| 133 | Ga0081539_10121991 | 3300005985 | Bacteria | 1293 |
| 134 | Ga0070717_10298290 | 3300006028 | Bacteria | 1432 |
| 135 | Ga0070717_10367524 | 3300006028 | Bacteria | 1288 |
| 136 | Ga0070717_10501830 | 3300006028 | Bacteria | 1097 |
| 137 | Ga0070716_100191200 | 3300006173 | Bacteria | 1353 |
| 138 | Ga0070712_100038759 | 3300006175 | Bacteria | 3258 |
| 139 | Ga0070712_100060757 | 3300006175 | Bacteria | 2667 |
| 140 | Ga0070712_100164112 | 3300006175 | Bacteria | 1718 |
| 141 | Ga0097621_100428292 | 3300006237 | Bacteria | 1189 |
| 142 | Ga0075428_100177887 | 3300006844 | Bacteria | 2303 |
| 143 | Ga0075428_100270149 | 3300006844 | Bacteria | 1830 |
| 144 | Ga0075428_100838295 | 3300006844 | Bacteria | 976 |
| 145 | Ga0075430_100643311 | 3300006846 | Bacteria | 874 |
| 146 | Ga0075430_100699581 | 3300006846 | Bacteria | 835 |
| 147 | Ga0075431_100118799 | 3300006847 | Bacteria | 2728 |
| 148 | Ga0075431_100264317 | 3300006847 | Bacteria | 1745 |
| 149 | Ga0075433_10044931 | 3300006852 | Bacteria | 3838 |
| 150 | Ga0075433_10184379 | 3300006852 | Bacteria | 1857 |
| 151 | Ga0075434_100222264 | 3300006871 | Bacteria | 1908 |
| 152 | Ga0075434_100715516 | 3300006871 | Bacteria | 1018 |
| 153 | Ga0075429_100161931 | 3300006880 | Bacteria | 1959 |
| 154 | Ga0068865_100063291 | 3300006881 | Bacteria | 2600 |
| 155 | Ga0068865_100076405 | 3300006881 | Bacteria | 2390 |
| 156 | Ga0068865_100176344 | 3300006881 | Bacteria | 1643 |
| 157 | Ga0068865_100451848 | 3300006881 | Bacteria | 1062 |
| 158 | Ga0068865_100638369 | 3300006881 | Bacteria | 904 |
| 159 | Ga0075436_100070877 | 3300006914 | Bacteria | 2410 |
| 160 | Ga0075436_100090519 | 3300006914 | Bacteria | 2127 |
| 161 | Ga0075435_100431273 | 3300007076 | Bacteria | 1136 |
| 162 | Ga0105251_10075114 | 3300009011 | Bacteria | 1570 |
| 163 | Ga0111539_10012696 | 3300009094 | Bacteria | 10549 |
| 164 | Ga0111539_10023921 | 3300009094 | Bacteria | 7505 |
| 165 | Ga0111539_10201007 | 3300009094 | Bacteria | 2324 |
| 166 | Ga0111539_10259862 | 3300009094 | Bacteria | 2021 |
| 167 | Ga0111539_10408034 | 3300009094 | Bacteria | 1582 |
| 168 | Ga0111539_10452347 | 3300009094 | Bacteria | 1495 |
| 169 | Ga0111539_10946060 | 3300009094 | Bacteria | 1002 |
| 170 | Ga0111539_11216598 | 3300009094 | Bacteria | 875 |
| 171 | Ga0105245_10012366 | 3300009098 | Bacteria | 7427 |
| 172 | Ga0105245_10017686 | 3300009098 | Bacteria | 6223 |
| 173 | Ga0105245_10021731 | 3300009098 | Bacteria | 5633 |
| 174 | Ga0105245_10164973 | 3300009098 | Bacteria | 2105 |
| 175 | Ga0105245_10238654 | 3300009098 | Bacteria | 1761 |
| 176 | Ga0105245_10428424 | 3300009098 | Bacteria | 1327 |
| 177 | Ga0105245_10971753 | 3300009098 | Bacteria | 893 |
| 178 | Ga0105245_11316640 | 3300009098 | Bacteria | 771 |
| 179 | Ga0105247_10402854 | 3300009101 | Bacteria | 975 |
| 180 | Ga0114129_10011940 | 3300009147 | Bacteria | 12352 |
| 181 | Ga0114129_10407242 | 3300009147 | Bacteria | 1791 |
| 182 | Ga0105243_10005399 | 3300009148 | Bacteria | 9974 |
| 183 | Ga0105243_10176386 | 3300009148 | Bacteria | 1855 |
| 184 | Ga0105243_10289365 | 3300009148 | Bacteria | 1479 |
| 185 | Ga0105243_10331547 | 3300009148 | Bacteria | 1390 |
| 186 | Ga0105243_10332514 | 3300009148 | Bacteria | 1388 |
| 187 | Ga0105243_10450214 | 3300009148 | Bacteria | 1208 |
| 188 | Ga0105242_10147952 | 3300009176 | Bacteria | 2045 |
| 189 | Ga0105248_10420304 | 3300009177 | Bacteria | 1505 |
| 190 | Ga0105248_11196681 | 3300009177 | Bacteria | 859 |
| 191 | Ga0105237_10000030 | 3300009545 | Bacteria | 197884 |
| 192 | Ga0105237_10603223 | 3300009545 | Bacteria | 1105 |
| 193 | Ga0105238_10376870 | 3300009551 | Bacteria | 1410 |
| 194 | Ga0105238_10690523 | 3300009551 | Bacteria | 1032 |
| 195 | Ga0105249_10147889 | 3300009553 | Bacteria | 2259 |
| 196 | Ga0105249_10159658 | 3300009553 | Bacteria | 2177 |
| 197 | Ga0105239_10034414 | 3300010375 | Bacteria | 5563 |
| 198 | Ga0105239_10067690 | 3300010375 | Bacteria | 3923 |
| 199 | Ga0105239_10555043 | 3300010375 | Bacteria | 1308 |
| 200 | Ga0105239_11227692 | 3300010375 | Bacteria | 864 |
| 201 | Ga0105246_10014422 | 3300011119 | Bacteria | 4971 |
| 202 | Ga0105246_10251412 | 3300011119 | Bacteria | 1403 |
| 203 | Ga0157371_10380500 | 3300013102 | Bacteria | 1031 |
| 204 | Ga0157369_10365251 | 3300013105 | Bacteria | 1498 |
| 205 | Ga0157374_10185275 | 3300013296 | Bacteria | 2035 |
| 206 | Ga0157374_10252001 | 3300013296 | Bacteria | 1737 |
| 207 | Ga0157374_11359438 | 3300013296 | Bacteria | 733 |
| 208 | Ga0163162_11057002 | 3300013306 | Bacteria | 919 |
| 209 | Ga0157372_10275582 | 3300013307 | Bacteria | 1955 |
| 210 | Ga0157372_10956285 | 3300013307 | Bacteria | 993 |
| 211 | Ga0157372_11039099 | 3300013307 | Bacteria | 948 |
| 212 | Ga0157372_11108375 | 3300013307 | Bacteria | 916 |
| 213 | Ga0157372_11777304 | 3300013307 | Bacteria | 709 |
| 214 | Ga0157375_10592299 | 3300013308 | Bacteria | 1268 |
| 215 | Ga0157375_10618923 | 3300013308 | Bacteria | 1241 |
| 216 | Ga0157375_11350187 | 3300013308 | Unclassified | 839 |
| 217 | Ga0163163_10013456 | 3300014325 | Bacteria | 7493 |
| 218 | Ga0163163_10271078 | 3300014325 | Bacteria | 1748 |
| 219 | Ga0163163_10880191 | 3300014325 | Bacteria | 959 |
| 220 | Ga0157380_10085337 | 3300014326 | Bacteria | 2591 |
| 221 | Ga0157380_10107515 | 3300014326 | Bacteria | 2336 |
| 222 | Ga0157380_10239076 | 3300014326 | Bacteria | 1636 |
| 223 | Ga0157380_10361516 | 3300014326 | Bacteria | 1362 |
| 224 | Ga0157380_10371372 | 3300014326 | Bacteria | 1346 |
| 225 | Ga0157380_10608954 | 3300014326 | Bacteria | 1082 |
| 226 | Ga0157380_10661150 | 3300014326 | Bacteria | 1044 |
| 227 | Ga0157380_10670096 | 3300014326 | Bacteria | 1038 |
| 228 | Ga0157380_10896486 | 3300014326 | Bacteria | 912 |
| 229 | Ga0157377_10094942 | 3300014745 | Bacteria | 1767 |
| 230 | Ga0157377_10248350 | 3300014745 | Bacteria | 1152 |
| 231 | Ga0157379_10024734 | 3300014968 | Bacteria | 5331 |
| 232 | Ga0197907_11203372 | 3300020069 | Bacteria | 836 |
| 233 | Ga0206356_10148965 | 3300020070 | Bacteria | 891 |
| 234 | Ga0206351_10189663 | 3300020077 | Bacteria | 1005 |
| 235 | Ga0206350_10220966 | 3300020080 | Bacteria | 1774 |
| 236 | Ga0206350_10224355 | 3300020080 | Bacteria | 839 |
| 237 | Ga0206353_10040438 | 3300020082 | Bacteria | 732 |
| 238 | Ga0206353_11983971 | 3300020082 | Bacteria | 997 |
| 239 | Ga0213874_10033464 | 3300021377 | Bacteria | 1498 |
| 240 | Ga0213874_10036637 | 3300021377 | Bacteria | 1447 |
| 241 | Ga0213874_10077722 | 3300021377 | Bacteria | 1070 |
| 242 | Ga0213876_10009982 | 3300021384 | Bacteria | 5102 |
| 243 | Ga0213876_10023850 | 3300021384 | Bacteria | 3230 |
| 244 | Ga0213876_10153820 | 3300021384 | Bacteria | 1223 |
| 245 | Ga0213876_10155658 | 3300021384 | Bacteria | 1216 |
| 246 | Ga0213875_10000631 | 3300021388 | Bacteria | 28108 |
| 247 | Ga0213875_10019222 | 3300021388 | Bacteria | 3287 |
| 248 | Ga0224712_10143969 | 3300022467 | Bacteria | 1051 |
| 249 | Ga0207426_1063918 | 3300025302 | Bacteria | 1048 |
| 250 | Ga0207692_10490047 | 3300025898 | Bacteria | 779 |
| 251 | Ga0207642_10174263 | 3300025899 | Bacteria | 1166 |
| 252 | Ga0207642_10182666 | 3300025899 | Bacteria | 1144 |
| 253 | Ga0207710_10048116 | 3300025900 | Bacteria | 1908 |
| 254 | Ga0207688_10046049 | 3300025901 | Bacteria | 2435 |
| 255 | Ga0207688_10064990 | 3300025901 | Bacteria | 2061 |
| 256 | Ga0207688_10091947 | 3300025901 | Bacteria | 1743 |
| 257 | Ga0207688_10136134 | 3300025901 | Bacteria | 1443 |
| 258 | Ga0207688_10619431 | 3300025901 | Bacteria | 683 |
| 259 | Ga0207647_10162067 | 3300025904 | Bacteria | 1304 |
| 260 | Ga0207699_10201205 | 3300025906 | Bacteria | 1350 |
| 261 | Ga0207699_10528116 | 3300025906 | Bacteria | 854 |
| 262 | Ga0207645_10126816 | 3300025907 | Bacteria | 1659 |
| 263 | Ga0207643_10155517 | 3300025908 | Bacteria | 1373 |
| 264 | Ga0207705_10652843 | 3300025909 | Bacteria | 818 |
| 265 | Ga0207705_10703566 | 3300025909 | Bacteria | 785 |
| 266 | Ga0207707_10720452 | 3300025912 | Bacteria | 836 |
| 267 | Ga0207707_10834497 | 3300025912 | Bacteria | 766 |
| 268 | Ga0207671_10000385 | 3300025914 | Bacteria | 62626 |
| 269 | Ga0207693_10099802 | 3300025915 | Bacteria | 2276 |
| 270 | Ga0207693_10238880 | 3300025915 | Bacteria | 1426 |
| 271 | Ga0207693_10410040 | 3300025915 | Bacteria | 1059 |
| 272 | Ga0207663_10035621 | 3300025916 | Bacteria | 2987 |
| 273 | Ga0207660_10158944 | 3300025917 | Bacteria | 1742 |
| 274 | Ga0207662_10037804 | 3300025918 | Bacteria | 2827 |
| 275 | Ga0207662_10080553 | 3300025918 | Bacteria | 1986 |
| 276 | Ga0207657_10155631 | 3300025919 | Bacteria | 1859 |
| 277 | Ga0207657_10169427 | 3300025919 | Bacteria | 1770 |
| 278 | Ga0207657_10272171 | 3300025919 | Bacteria | 1346 |
| 279 | Ga0207649_10256117 | 3300025920 | Bacteria | 1263 |
| 280 | Ga0207649_10336188 | 3300025920 | Bacteria | 1114 |
| 281 | Ga0207646_10256070 | 3300025922 | Bacteria | 1582 |
| 282 | Ga0207694_10133277 | 3300025924 | Bacteria | 1993 |
| 283 | Ga0207659_10287719 | 3300025926 | Bacteria | 1345 |
| 284 | Ga0207659_10387774 | 3300025926 | Bacteria | 1166 |
| 285 | Ga0207659_10836321 | 3300025926 | Bacteria | 791 |
| 286 | Ga0207687_10080925 | 3300025927 | Bacteria | 2346 |
| 287 | Ga0207687_10091814 | 3300025927 | Bacteria | 2216 |
| 288 | Ga0207687_10432868 | 3300025927 | Bacteria | 1088 |
| 289 | Ga0207687_10769088 | 3300025927 | Bacteria | 820 |
| 290 | Ga0207687_10794488 | 3300025927 | Bacteria | 807 |
| 291 | Ga0207700_10178041 | 3300025928 | Bacteria | 1779 |
| 292 | Ga0207664_10019246 | 3300025929 | Bacteria | 5042 |
| 293 | Ga0207664_10448732 | 3300025929 | Bacteria | 1151 |
| 294 | Ga0207644_10140584 | 3300025931 | Bacteria | 1859 |
| 295 | Ga0207690_10113062 | 3300025932 | Bacteria | 1959 |
| 296 | Ga0207690_10180030 | 3300025932 | Bacteria | 1591 |
| 297 | Ga0207690_10357747 | 3300025932 | Bacteria | 1156 |
| 298 | Ga0207690_10477184 | 3300025932 | Bacteria | 1006 |
| 299 | Ga0207706_10146702 | 3300025933 | Bacteria | 2075 |
| 300 | Ga0207706_10155460 | 3300025933 | Bacteria | 2012 |
| 301 | Ga0207686_10433608 | 3300025934 | Bacteria | 1008 |
| 302 | Ga0207709_10089208 | 3300025935 | Bacteria | 2010 |
| 303 | Ga0207709_10203241 | 3300025935 | Bacteria | 1416 |
| 304 | Ga0207709_10222135 | 3300025935 | Bacteria | 1363 |
| 305 | Ga0207709_10361781 | 3300025935 | Bacteria | 1099 |
| 306 | Ga0207709_10430301 | 3300025935 | Bacteria | 1016 |
| 307 | Ga0207709_10551444 | 3300025935 | Bacteria | 907 |
| 308 | Ga0207670_10054117 | 3300025936 | Bacteria | 2707 |
| 309 | Ga0207670_10167181 | 3300025936 | Bacteria | 1646 |
| 310 | Ga0207670_10864272 | 3300025936 | Bacteria | 756 |
| 311 | Ga0207669_10380133 | 3300025937 | Bacteria | 1100 |
| 312 | Ga0207669_10454335 | 3300025937 | Bacteria | 1016 |
| 313 | Ga0207704_10056371 | 3300025938 | Bacteria | 2407 |
| 314 | Ga0207704_10110809 | 3300025938 | Bacteria | 1855 |
| 315 | Ga0207704_10201305 | 3300025938 | Bacteria | 1457 |
| 316 | Ga0207665_10062783 | 3300025939 | Bacteria | 2521 |
| 317 | Ga0207665_10115649 | 3300025939 | Bacteria | 1890 |
| 318 | Ga0207691_10055577 | 3300025940 | Bacteria | 3607 |
| 319 | Ga0207711_10676904 | 3300025941 | Bacteria | 962 |
| 320 | Ga0207711_11178525 | 3300025941 | Bacteria | 707 |
| 321 | Ga0207689_10196188 | 3300025942 | Bacteria | 1666 |
| 322 | Ga0207689_10378863 | 3300025942 | Bacteria | 1178 |
| 323 | Ga0207689_10544157 | 3300025942 | Bacteria | 975 |
| 324 | Ga0207661_10152543 | 3300025944 | Bacteria | 1998 |
| 325 | Ga0207661_10249534 | 3300025944 | Bacteria | 1577 |
| 326 | Ga0207661_10280979 | 3300025944 | Bacteria | 1488 |
| 327 | Ga0207661_10577953 | 3300025944 | Bacteria | 1030 |
| 328 | Ga0207679_10040852 | 3300025945 | Bacteria | 3323 |
| 329 | Ga0207679_10088080 | 3300025945 | Bacteria | 2392 |
| 330 | Ga0207679_10720309 | 3300025945 | Bacteria | 906 |
| 331 | Ga0207667_10332275 | 3300025949 | Bacteria | 1552 |
| 332 | Ga0207651_10476166 | 3300025960 | Bacteria | 1075 |
| 333 | Ga0207651_10530754 | 3300025960 | Bacteria | 1021 |
| 334 | Ga0207712_10541226 | 3300025961 | Bacteria | 1000 |
| 335 | Ga0207668_10675507 | 3300025972 | Bacteria | 906 |
| 336 | Ga0207640_10378063 | 3300025981 | Bacteria | 1147 |
| 337 | Ga0207640_10664420 | 3300025981 | Bacteria | 889 |
| 338 | Ga0207658_10335912 | 3300025986 | Bacteria | 1312 |
| 339 | Ga0207658_10373606 | 3300025986 | Bacteria | 1247 |
| 340 | Ga0207677_10036644 | 3300026023 | Bacteria | 3199 |
| 341 | Ga0207677_10347355 | 3300026023 | Bacteria | 1242 |
| 342 | Ga0207677_10507148 | 3300026023 | Bacteria | 1044 |
| 343 | Ga0207703_10041174 | 3300026035 | Bacteria | 3700 |
| 344 | Ga0207703_10056243 | 3300026035 | Bacteria | 3203 |
| 345 | Ga0207639_10221163 | 3300026041 | Bacteria | 1635 |
| 346 | Ga0207678_10085105 | 3300026067 | Bacteria | 2703 |
| 347 | Ga0207678_10425884 | 3300026067 | Bacteria | 1151 |
| 348 | Ga0207678_10629110 | 3300026067 | Bacteria | 942 |
| 349 | Ga0207708_10002314 | 3300026075 | Bacteria | 14007 |
| 350 | Ga0207708_10005162 | 3300026075 | Bacteria | 9633 |
| 351 | Ga0207708_10142585 | 3300026075 | Bacteria | 1881 |
| 352 | Ga0207708_10183033 | 3300026075 | Bacteria | 1664 |
| 353 | Ga0207708_10241103 | 3300026075 | Bacteria | 1454 |
| 354 | Ga0207708_10727776 | 3300026075 | Bacteria | 850 |
| 355 | Ga0207702_10309272 | 3300026078 | Bacteria | 1502 |
| 356 | Ga0207641_10553856 | 3300026088 | Bacteria | 1122 |
| 357 | Ga0207648_10038255 | 3300026089 | Bacteria | 4222 |
| 358 | Ga0207648_10066490 | 3300026089 | Bacteria | 3144 |
| 359 | Ga0207648_10350984 | 3300026089 | Bacteria | 1330 |
| 360 | Ga0207648_10385060 | 3300026089 | Bacteria | 1268 |
| 361 | Ga0207648_10906888 | 3300026089 | Bacteria | 823 |
| 362 | Ga0207648_10962606 | 3300026089 | Bacteria | 799 |
| 363 | Ga0207676_10488303 | 3300026095 | Bacteria | 1167 |
| 364 | Ga0207676_10877763 | 3300026095 | Bacteria | 879 |
| 365 | Ga0207674_10202355 | 3300026116 | Bacteria | 1935 |
| 366 | Ga0207674_10571305 | 3300026116 | Bacteria | 1092 |
| 367 | Ga0207675_100015696 | 3300026118 | Bacteria | 7063 |
| 368 | Ga0207675_100063828 | 3300026118 | Bacteria | 3441 |
| 369 | Ga0207675_100094396 | 3300026118 | Bacteria | 2814 |
| 370 | Ga0207675_100477876 | 3300026118 | Bacteria | 1238 |
| 371 | Ga0207683_10085067 | 3300026121 | Bacteria | 2812 |
| 372 | Ga0207683_10262839 | 3300026121 | Bacteria | 1576 |
| 373 | Ga0207698_10647717 | 3300026142 | Bacteria | 1046 |
| 374 | Ga0207428_10029616 | 3300027907 | Bacteria | 4534 |
| 375 | Ga0207428_10052037 | 3300027907 | Bacteria | 3272 |
| 376 | Ga0207428_10065045 | 3300027907 | Bacteria | 2878 |
| 377 | Ga0207428_10702290 | 3300027907 | Bacteria | 723 |
| 378 | Ga0268265_10071585 | 3300028380 | Bacteria | 2701 |
| 379 | Ga0268264_10241393 | 3300028381 | Bacteria | 1674 |
| 380 | Ga0268264_10713473 | 3300028381 | Bacteria | 997 |
| 381 | Ga0265319_1000088 | 3300028563 | Bacteria | 71590 |
| 382 | Ga0307408_100495597 | 3300031548 | Bacteria | 1068 |
| 383 | Ga0307408_100841182 | 3300031548 | Bacteria | 836 |
| 384 | Ga0307405_10153382 | 3300031731 | Bacteria | 1623 |
| 385 | Ga0307413_10013249 | 3300031824 | Bacteria | 4137 |
| 386 | Ga0307413_10462725 | 3300031824 | Bacteria | 1009 |
| 387 | Ga0307413_10586634 | 3300031824 | Bacteria | 910 |
| 388 | Ga0307413_10710076 | 3300031824 | Bacteria | 836 |
| 389 | Ga0307410_10174821 | 3300031852 | Bacteria | 1621 |
| 390 | Ga0307410_10285243 | 3300031852 | Bacteria | 1297 |
| 391 | Ga0307406_10229488 | 3300031901 | Bacteria | 1385 |
| 392 | Ga0307406_10282829 | 3300031901 | Bacteria | 1266 |
| 393 | Ga0307406_10405643 | 3300031901 | Bacteria | 1082 |
| 394 | Ga0307406_10503654 | 3300031901 | Bacteria | 982 |
| 395 | Ga0307407_10544173 | 3300031903 | Bacteria | 857 |
| 396 | Ga0307412_10179783 | 3300031911 | Bacteria | 1590 |
| 397 | Ga0307409_100094495 | 3300031995 | Bacteria | 2460 |
| 398 | Ga0307409_100259353 | 3300031995 | Bacteria | 1594 |
| 399 | Ga0307409_100419598 | 3300031995 | Bacteria | 1283 |
| 400 | Ga0307409_100457229 | 3300031995 | Bacteria | 1233 |
| 401 | Ga0307409_100585592 | 3300031995 | Bacteria | 1100 |
| 402 | Ga0307409_100819990 | 3300031995 | Bacteria | 939 |
| 403 | Ga0307409_100990799 | 3300031995 | Bacteria | 858 |
| 404 | Ga0307416_100017740 | 3300032002 | Bacteria | 4991 |
| 405 | Ga0307416_100263050 | 3300032002 | Bacteria | 1687 |
| 406 | Ga0307416_100680469 | 3300032002 | Bacteria | 1116 |
| 407 | Ga0307416_100782283 | 3300032002 | Bacteria | 1049 |
| 408 | Ga0307416_100926476 | 3300032002 | Bacteria | 972 |
| 409 | Ga0307416_100984077 | 3300032002 | Bacteria | 946 |
| 410 | Ga0307416_101430091 | 3300032002 | Bacteria | 797 |
| 411 | Ga0307414_10257881 | 3300032004 | Bacteria | 1453 |
| 412 | Ga0307411_10147661 | 3300032005 | Bacteria | 1743 |
| 413 | Ga0307411_10244975 | 3300032005 | Bacteria | 1406 |
| 414 | Ga0307411_10298342 | 3300032005 | Bacteria | 1291 |
| 415 | Ga0307411_10514812 | 3300032005 | Bacteria | 1014 |
| 416 | Ga0307415_100131902 | 3300032126 | Bacteria | 1893 |
| 417 | Ga0307415_100351567 | 3300032126 | Bacteria | 1241 |
| 418 | Ga0307415_100472513 | 3300032126 | Bacteria | 1089 |
| 419 | Ga0307415_100605325 | 3300032126 | Bacteria | 976 |
| 420 | Ga0307415_101159718 | 3300032126 | Bacteria | 726 |
| 421 | Ga0373946_0147890 | 3300035171 | Bacteria | 1094 |
| 422 | Ga0373955_0558887 | 3300035172 | Bacteria | 700 |
| 423 | Ga0373924_0054919 | 3300035410 | Bacteria | 1657 |
| 424 | Ga0373933_0105699 | 3300035724 | Bacteria | 1751 |
| 425 | Ga0373937_0121864 | 3300036401 | Bacteria | 2430 |
| 426 | Ga0373937_1487976 | 3300036401 | Bacteria | 625 |
| 427 | Ga0395899_0098644 | 3300037312 | Bacteria | 2111 |
| 428 | Ga0395899_0327697 | 3300037312 | Bacteria | 1030 |
| 429 | Ga0395900_0302661 | 3300037418 | Bacteria | 1585 |
| 430 | Ga0395900_0558712 | 3300037418 | Bacteria | 1088 |
| 431 | Ga0395898_0186602 | 3300037466 | Bacteria | 1982 |
| 432 | Ga0395898_0229394 | 3300037466 | Bacteria | 1771 |
| 433 | Ga0395898_0702006 | 3300037466 | Bacteria | 953 |
| 434 | Ga0395898_0742099 | 3300037466 | Bacteria | 923 |
| 435 | Ga0395898_1031209 | 3300037466 | Bacteria | 758 |
| 436 | Ga0395905_0947662 | 3300037471 | Bacteria | 764 |
| 437 | Ga0436364_0083893 | 3300037853 | Bacteria | 1777 |
| 438 | Ga0436364_0415415 | 3300037853 | Bacteria | 1831 |
| 439 | Ga0436364_0844887 | 3300037853 | Bacteria | 24845 |
| 440 | Ga0436364_1001540 | 3300037853 | Bacteria | 1069 |
| 441 | Ga0436364_1077960 | 3300037853 | Bacteria | 1121 |
| 442 | Ga0436364_1299031 | 3300037853 | Bacteria | 819 |
| 443 | Ga0436364_1543506 | 3300037853 | Bacteria | 10359 |
| 444 | Ga0395901_0116963 | 3300038443 | Bacteria | 2801 |
| 445 | Ga0395901_0355299 | 3300038443 | Bacteria | 1512 |
| 446 | Ga0395901_0405540 | 3300038443 | Bacteria | 1400 |
| 447 | Ga0395901_0427832 | 3300038443 | Bacteria | 1357 |
| 448 | Ga0395901_0452026 | 3300038443 | Bacteria | 1314 |
| 449 | Ga0395901_0616775 | 3300038443 | Bacteria | 1092 |
| 450 | Ga0395901_0651993 | 3300038443 | Bacteria | 1056 |
| 451 | Ga0395901_1076783 | 3300038443 | Bacteria | 775 |
| 452 | Ga0436365_0782639 | 3300039437 | Bacteria | 820 |
| 453 | Ga0436365_0851257 | 3300039437 | Bacteria | 18616 |
| 454 | Ga0436365_0861691 | 3300039437 | Bacteria | 19086 |
| 455 | Ga0436365_0990694 | 3300039437 | Bacteria | 8623 |
| 456 | Ga0436365_1372237 | 3300039437 | Bacteria | 1203 |
| 457 | Ga0436360_1042459 | 3300039438 | Bacteria | 1168 |
| 458 | Ga0436361_0395337 | 3300039447 | Bacteria | 1152 |
| 459 | Ga0436361_0954279 | 3300039447 | Bacteria | 1145 |
| 460 | Ga0436363_0228724 | 3300039450 | Bacteria | 1412 |
| 461 | Ga0436363_0684606 | 3300039450 | Bacteria | 1352 |
| 462 | Ga0436363_0713209 | 3300039450 | Bacteria | 4770 |
| 463 | Ga0436363_0834497 | 3300039450 | Bacteria | 1582 |
| 464 | Ga0436363_0990710 | 3300039450 | Bacteria | 9020 |
| 465 | Ga0436362_0310533 | 3300039453 | Bacteria | 1677 |
| 466 | Ga0436362_0778145 | 3300039453 | Bacteria | 3174 |
| 467 | Ga0436362_1067159 | 3300039453 | Bacteria | 1565 |
| 468 | Ga0439465_0109927 | 3300041413 | Bacteria | 959 |
| 469 | Ga0451791_0826655 | 3300041451 | Bacteria | 1237 |
| 470 | Ga0451795_0316391 | 3300041456 | Bacteria | 905 |
| 471 | Ga0451833_0507176 | 3300041491 | Bacteria | 1197 |
| 472 | Ga0439455_0061488 | 3300042012 | Bacteria | 997 |
| 473 | Ga0466965_0211445 | 3300044683 | Bacteria | 1031 |
| 474 | Ga0466966_0014293 | 3300044684 | Bacteria | 5255 |
| 475 | Ga0466966_0073280 | 3300044684 | Bacteria | 2142 |
| 476 | Ga0466966_0144364 | 3300044684 | Bacteria | 1453 |
| 477 | Ga0466961_0004445 | 3300044693 | Bacteria | 8778 |
| 478 | Ga0466961_0055307 | 3300044693 | Bacteria | 2530 |
| 479 | Ga0466961_0067770 | 3300044693 | Bacteria | 2267 |
| 480 | Ga0466961_0114071 | 3300044693 | Bacteria | 1699 |
| 481 | Ga0466963_0011045 | 3300044694 | Bacteria | 5491 |
| 482 | Ga0466963_0031101 | 3300044694 | Bacteria | 3449 |
| 483 | Ga0466963_0035718 | 3300044694 | Bacteria | 3239 |
| 484 | Ga0466963_0039090 | 3300044694 | Bacteria | 3106 |
| 485 | Ga0466963_0200425 | 3300044694 | Bacteria | 1396 |
| 486 | Ga0466963_0258328 | 3300044694 | Bacteria | 1223 |
| 487 | Ga0466963_0421809 | 3300044694 | Bacteria | 941 |
| 488 | Ga0466964_0138484 | 3300044706 | Bacteria | 1116 |
| 489 | Ga0466964_0370946 | 3300044706 | Bacteria | 740 |
| 490 | Ga0466971_0003800 | 3300044719 | Bacteria | 6464 |
| 491 | Ga0466971_0055482 | 3300044719 | Bacteria | 1786 |
| 492 | Ga0466971_0245140 | 3300044719 | Bacteria | 853 |
| 493 | Ga0466971_0417147 | 3300044719 | Bacteria | 656 |
| 494 | Ga0466968_0082692 | 3300044735 | Bacteria | 1413 |
| 495 | Ga0466968_0144886 | 3300044735 | Bacteria | 1089 |
| 496 | Ga0466970_0010466 | 3300044765 | Bacteria | 4709 |
| 497 | Ga0466970_0082756 | 3300044765 | Bacteria | 1736 |
| 498 | Ga0466970_0413084 | 3300044765 | Bacteria | 771 |
| 499 | Ga0466957_0079873 | 3300044842 | Bacteria | 2036 |
| 500 | Ga0466957_0233622 | 3300044842 | Bacteria | 1218 |
| 501 | Ga0466957_0392467 | 3300044842 | Bacteria | 948 |
| 502 | Ga0466960_0001210 | 3300044901 | Bacteria | 9295 |
| 503 | Ga0466960_0116032 | 3300044901 | Bacteria | 1397 |
| 504 | Ga0466959_0016584 | 3300045049 | Bacteria | 5386 |
| 505 | Ga0466959_0036938 | 3300045049 | Bacteria | 3609 |
| 506 | Ga0466959_0041915 | 3300045049 | Bacteria | 3378 |
| 507 | Ga0466959_0044668 | 3300045049 | Bacteria | 3264 |
| 508 | Ga0466959_0343195 | 3300045049 | Bacteria | 1019 |
| 509 | Ga0466959_0442240 | 3300045049 | Bacteria | 882 |
| 510 | Ga0466958_0034508 | 3300045836 | Bacteria | 3018 |
| 511 | Ga0466958_0057843 | 3300045836 | Bacteria | 2356 |
| 512 | Ga0466958_0096134 | 3300045836 | Bacteria | 1837 |
| 513 | Ga0466958_0108989 | 3300045836 | Bacteria | 1728 |
| 514 | Ga0466958_0268093 | 3300045836 | Bacteria | 1093 |
| 515 | Ga0466958_0281187 | 3300045836 | Bacteria | 1066 |
| 516 | Ga0466958_0282342 | 3300045836 | Bacteria | 1064 |
| 517 | Ga0466958_0298594 | 3300045836 | Bacteria | 1034 |
| 518 | Ga0466958_0389045 | 3300045836 | Bacteria | 900 |
| 519 | Ga0466958_0444356 | 3300045836 | Bacteria | 839 |
| 520 | Ga0466967_0068655 | 3300045976 | Bacteria | 3166 |
| 521 | Ga0466967_0078873 | 3300045976 | Bacteria | 2967 |
| 522 | Ga0466967_0191436 | 3300045976 | Bacteria | 1933 |
| 523 | Ga0466967_0369082 | 3300045976 | Bacteria | 1392 |
| 524 | Ga0466967_0379355 | 3300045976 | Bacteria | 1372 |
| 525 | Ga0466967_0585761 | 3300045976 | Bacteria | 1100 |
| 526 | Ga0495592_0310431 | 3300046454 | Bacteria | 1022 |
| 527 | Ga0495653_0163869 | 3300046463 | Bacteria | 1541 |
| 528 | Ga0495650_0000063 | 3300046471 | Bacteria | 277841 |
| 529 | Ga0495664_0052389 | 3300046477 | Bacteria | 2425 |
| 530 | Ga0495584_0297364 | 3300046491 | Bacteria | 820 |
| 531 | Ga0495608_0004342 | 3300046511 | Bacteria | 10156 |
| 532 | Ga0495628_0043511 | 3300046516 | Bacteria | 3577 |
| 533 | Ga0495628_0593318 | 3300046516 | Bacteria | 792 |
| 534 | Ga0495630_0312758 | 3300046517 | Bacteria | 1201 |
| 535 | Ga0495652_0029989 | 3300046529 | Bacteria | 4773 |
| 536 | Ga0495640_0062807 | 3300046533 | Bacteria | 2518 |
| 537 | Ga0495587_0105726 | 3300046536 | Bacteria | 1619 |
| 538 | Ga0495645_0374762 | 3300046543 | Bacteria | 912 |
| 539 | Ga0495667_0069168 | 3300046559 | Bacteria | 2304 |
| 540 | Ga0495634_0040347 | 3300046642 | Bacteria | 3176 |
| 541 | Ga0495634_0080838 | 3300046642 | Bacteria | 2126 |
| 542 | Ga0495635_0013027 | 3300046663 | Bacteria | 5821 |
| 543 | Ga0495657_0003521 | 3300046675 | Bacteria | 12764 |
| 544 | Ga0495599_0265388 | 3300046678 | Bacteria | 1042 |
| 545 | Ga0495623_0117857 | 3300046679 | Bacteria | 1602 |
| 546 | Ga0495646_0010567 | 3300046680 | Bacteria | 5865 |
| 547 | Ga0495613_0156707 | 3300046689 | Bacteria | 1622 |
| 548 | Ga0495600_0093268 | 3300046809 | Bacteria | 1963 |
| 549 | Ga0495604_0018888 | 3300047317 | Bacteria | 5520 |
| 550 | Ga0495674_0022060 | 3300047319 | Bacteria | 5876 |
| 551 | Ga0495674_0168441 | 3300047319 | Bacteria | 1829 |
| 552 | Ga0495674_0514455 | 3300047319 | Bacteria | 956 |
| 553 | Ga0495672_0126642 | 3300047320 | Bacteria | 1349 |
| 554 | Ga0495680_0104558 | 3300047322 | Bacteria | 2106 |
| 555 | Ga0495680_0121769 | 3300047322 | Bacteria | 1925 |
| 556 | Ga0495680_0831659 | 3300047322 | Bacteria | 601 |
| 557 | Ga0495675_0206064 | 3300047444 | Bacteria | 1195 |
| 558 | Ga0495684_0156919 | 3300047471 | Bacteria | 1699 |
| 559 | Ga0495602_0025131 | 3300048088 | Bacteria | 5768 |
| 560 | Ga0495602_0396024 | 3300048088 | Bacteria | 986 |
| 561 | Ga0496100_0000222 | 3300048903 | Bacteria | 30993 |
| 562 | Ga0496100_0050106 | 3300048903 | Bacteria | 2704 |
| 563 | Ga0496100_0181244 | 3300048903 | Bacteria | 1523 |
| 564 | Ga0496100_0463797 | 3300048903 | Bacteria | 972 |
| 565 | Ga0496101_0032554 | 3300048904 | Bacteria | 3671 |
| 566 | Ga0496101_0080160 | 3300048904 | Bacteria | 2411 |
| 567 | Ga0496101_0194442 | 3300048904 | Bacteria | 1566 |
| 568 | Ga0496101_0198984 | 3300048904 | Bacteria | 1548 |
| 569 | Ga0496102_0063644 | 3300048905 | Bacteria | 3378 |
| 570 | Ga0496102_0088040 | 3300048905 | Bacteria | 2870 |
| 571 | Ga0496102_0216516 | 3300048905 | Bacteria | 1805 |
| 572 | Ga0496102_0752584 | 3300048905 | Bacteria | 897 |
| 573 | Ga0496102_0870736 | 3300048905 | Bacteria | 823 |
| 574 | Ga0496102_1054078 | 3300048905 | Bacteria | 733 |
| 575 | Ga0496102_1128970 | 3300048905 | Bacteria | 703 |
| 576 | Ga0496103_0132357 | 3300048906 | Bacteria | 1593 |
| 577 | Ga0496103_0147796 | 3300048906 | Bacteria | 1505 |
| 578 | Ga0496103_0398432 | 3300048906 | Unclassified | 884 |
| 579 | Ga0496103_0452303 | 3300048906 | Bacteria | 824 |
| 580 | Ga0496103_0540549 | 3300048906 | Bacteria | 744 |
| 581 | Ga0496104_0126097 | 3300048907 | Bacteria | 2458 |
| 582 | Ga0496104_0288779 | 3300048907 | Bacteria | 1552 |
| 583 | Ga0496105_0052944 | 3300048908 | Bacteria | 3352 |
| 584 | Ga0496105_0406962 | 3300048908 | Bacteria | 1079 |
| 585 | Ga0496105_0711072 | 3300048908 | Bacteria | 770 |
| 586 | Ga0496106_0081217 | 3300048909 | Bacteria | 2490 |
| 587 | Ga0496106_0081387 | 3300048909 | Bacteria | 2488 |
| 588 | Ga0496106_0155065 | 3300048909 | Bacteria | 1808 |
| 589 | Ga0496106_0327433 | 3300048909 | Bacteria | 1230 |
| 590 | Ga0496107_0041023 | 3300048910 | Bacteria | 3323 |
| 591 | Ga0496107_0455202 | 3300048910 | Bacteria | 950 |
| 592 | Ga0496107_0492247 | 3300048910 | Bacteria | 910 |
| 593 | Ga0496108_0026855 | 3300048911 | Bacteria | 4751 |
| 594 | Ga0496108_0074040 | 3300048911 | Bacteria | 2875 |
| 595 | Ga0496108_0322553 | 3300048911 | Bacteria | 1347 |
| 596 | Ga0496108_0455763 | 3300048911 | Bacteria | 1117 |
| 597 | Ga0496108_0480712 | 3300048911 | Bacteria | 1085 |
| 598 | Ga0496109_0056451 | 3300048912 | Bacteria | 3583 |
| 599 | Ga0496109_0057783 | 3300048912 | Bacteria | 3542 |
| 600 | Ga0496109_0157028 | 3300048912 | Bacteria | 2131 |
| 601 | Ga0496109_0532473 | 3300048912 | Bacteria | 1108 |
| 602 | Ga0496109_0665515 | 3300048912 | Bacteria | 978 |
| 603 | Ga0496109_0868579 | 3300048912 | Bacteria | 840 |
| 604 | Ga0496110_0065377 | 3300048913 | Bacteria | 3215 |
| 605 | Ga0496110_0168239 | 3300048913 | Bacteria | 1988 |
| 606 | Ga0496110_0207829 | 3300048913 | Bacteria | 1779 |
| 607 | Ga0496110_0231577 | 3300048913 | Bacteria | 1680 |
| 608 | Ga0496110_0277247 | 3300048913 | Bacteria | 1527 |
| 609 | Ga0496110_0520053 | 3300048913 | Bacteria | 1082 |
| 610 | Ga0496111_0135301 | 3300048914 | Bacteria | 1825 |
| 611 | Ga0496111_0195863 | 3300048914 | Bacteria | 1502 |
| 612 | Ga0496111_0416724 | 3300048914 | Bacteria | 992 |
| 613 | Ga0496111_0486882 | 3300048914 | Bacteria | 908 |
| 614 | Ga0496112_0051576 | 3300048915 | Bacteria | 4035 |
| 615 | Ga0496112_0052232 | 3300048915 | Bacteria | 4011 |
| 616 | Ga0496112_0211474 | 3300048915 | Bacteria | 1897 |
| 617 | Ga0496112_0663772 | 3300048915 | Bacteria | 972 |
| 618 | Ga0496112_0828219 | 3300048915 | Bacteria | 849 |
| 619 | Ga0496113_0040057 | 3300048916 | Bacteria | 3451 |
| 620 | Ga0496113_0103215 | 3300048916 | Bacteria | 2211 |
| 621 | Ga0496114_0377760 | 3300048917 | Bacteria | 1254 |
| 622 | Ga0496114_0528915 | 3300048917 | Bacteria | 1042 |
| 623 | Ga0496115_0234635 | 3300048918 | Bacteria | 1512 |
| 624 | Ga0496121_0084402 | 3300048924 | Bacteria | 2504 |
| 625 | Ga0501031_0092557 | 3300049568 | Bacteria | 1973 |
| 626 | Ga0501032_0287849 | 3300049569 | Bacteria | 1063 |
| 627 | Ga0501032_0380301 | 3300049569 | Bacteria | 908 |
| 628 | Ga0501033_0040646 | 3300049570 | Bacteria | 3472 |
| 629 | Ga0501034_0061149 | 3300049571 | Bacteria | 3783 |
| 630 | Ga0501036_0235418 | 3300049572 | Bacteria | 1536 |
| 631 | Ga0501039_0275594 | 3300049575 | Bacteria | 1322 |
| 632 | Ga0501039_0281060 | 3300049575 | Bacteria | 1308 |
| 633 | Ga0501040_0385638 | 3300049576 | Bacteria | 1005 |
| 634 | Ga0501040_0604206 | 3300049576 | Bacteria | 792 |
| 635 | Ga0501040_0873339 | 3300049576 | Bacteria | 651 |
| 636 | Ga0501041_0199415 | 3300049577 | Bacteria | 1254 |
| 637 | Ga0501042_0220039 | 3300049578 | Unclassified | 1369 |
| 638 | Ga0501042_0775122 | 3300049578 | Bacteria | 698 |
| 639 | Ga0501048_0199816 | 3300049582 | Bacteria | 1417 |
| 640 | Ga0501071_0073591 | 3300049587 | Bacteria | 2493 |
| 641 | Ga0501071_0411468 | 3300049587 | Bacteria | 1033 |
| 642 | Ga0501072_0097212 | 3300049588 | Bacteria | 2340 |
| 643 | Ga0501073_0179394 | 3300049589 | Bacteria | 1466 |
| 644 | Ga0501074_0059008 | 3300049590 | Bacteria | 2765 |
| 645 | Ga0501074_0073661 | 3300049590 | Bacteria | 2453 |
| 646 | Ga0501075_0124843 | 3300049591 | Bacteria | 1959 |
| 647 | Ga0501075_0379667 | 3300049591 | Bacteria | 1077 |
| 648 | Ga0501075_0612353 | 3300049591 | Bacteria | 831 |
| 649 | Ga0501076_0599960 | 3300049592 | Bacteria | 908 |
| 650 | Ga0501079_0457370 | 3300049741 | Bacteria | 1002 |
| 651 | Ga0501079_0571068 | 3300049741 | Bacteria | 890 |
| 652 | Ga0501080_0191484 | 3300049742 | Bacteria | 1879 |
| 653 | Ga0501081_0491075 | 3300049743 | Unclassified | 914 |
| 654 | Ga0501081_0648556 | 3300049743 | Bacteria | 791 |
| 655 | Ga0501044_0757052 | 3300049823 | Unclassified | 853 |
| 656 | Ga0501045_0176475 | 3300049824 | Bacteria | 1591 |
| 657 | nmdc:mga03n38_320066_c1 | 3300050490 | Bacteria | 837 |
| 658 | nmdc:mga05p37_2122_c1 | 3300050507 | Bacteria | 23159 |
| 659 | nmdc:mga05p37_236328_c1 | 3300050507 | Bacteria | 2199 |
| 660 | nmdc:mga05p37_308263_c1 | 3300050507 | Bacteria | 1877 |
| 661 | nmdc:mga0qj67_11801_c1 | 3300050509 | Bacteria | 6558 |
| 662 | nmdc:mga0qj67_535484_c1 | 3300050509 | Bacteria | 940 |
| 663 | nmdc:mga06r32_91754_c1 | 3300050510 | Bacteria | 2969 |
| 664 | nmdc:mga08y16_227452_c1 | 3300050511 | Bacteria | 1930 |
| 665 | nmdc:mga08y16_265349_c1 | 3300050511 | Bacteria | 1773 |
| 666 | nmdc:mga08y16_47566_c1 | 3300050511 | Bacteria | 4490 |
| 667 | nmdc:mga08y16_522702_c1 | 3300050511 | Bacteria | 1203 |
| 668 | nmdc:mga08y16_523584_c1 | 3300050511 | Bacteria | 1202 |
| 669 | nmdc:mga0n895_28832_c1 | 3300050512 | Bacteria | 5286 |
| 670 | nmdc:mga0n895_651350_c1 | 3300050512 | Bacteria | 1052 |
| 671 | nmdc:mga08x19_222059_c1 | 3300050514 | Unclassified | 1298 |
| 672 | nmdc:mga08x19_74609_c1 | 3300050514 | Bacteria | 2216 |
| 673 | nmdc:mga0a205_26378_c1 | 3300050515 | Bacteria | 5541 |
| 674 | nmdc:mga0a205_591231_c1 | 3300050515 | Bacteria | 963 |
| 675 | Ga0495601_0000876 | 3300053077 | Bacteria | 16414 |
| 676 | Ga0495601_0409120 | 3300053077 | Bacteria | 879 |
| 677 | Ga0495612_0000025 | 3300053078 | Bacteria | 115305 |
| 678 | Ga0495655_0052423 | 3300053083 | Bacteria | 1085 |
| 679 | Ga0495619_0023700 | 3300053085 | Bacteria | 3936 |
| 680 | Ga0500616_0013570 | 3300053153 | Bacteria | 4723 |
| 681 | Ga0500616_0092395 | 3300053153 | Bacteria | 1496 |
| 682 | Ga0501084_0041736 | 3300054114 | Bacteria | 3838 |
| 683 | Ga0501084_0080679 | 3300054114 | Bacteria | 2728 |
| 684 | Ga0501084_0313060 | 3300054114 | Bacteria | 1326 |
| 685 | Ga0590075_073568 | 3300059424 | Bacteria | 884 |
| 686 | Ga0466962_0031827 | 3300061719 | Bacteria | 2526 |
| 687 | Ga0466962_0032896 | 3300061719 | Bacteria | 2481 |
| 688 | Ga0466962_0072093 | 3300061719 | Bacteria | 1650 |
| 689 | Ga0466962_0114853 | 3300061719 | Bacteria | 1297 |
| 690 | Ga0530510_0409042 | 3300061734 | Unclassified | 1023 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300047322 | Ga0495680_0831659 | Ga0495680_0831659_75_587 | 168 |
| 2 | 3300049576 | Ga0501040_0873339 | Ga0501040_0873339_105_629 | 169 |
| 3 | 3300036401 | Ga0373937_1487976 | Ga0373937_1487976_20_553 | 175 |
| 4 | 3300005578 | Ga0068854_100783629 | Ga0068854_1007836291 | 176 |
| 5 | 3300020082 | Ga0206353_11983971 | Ga0206353_119839712 | 176 |
| 6 | 3300005983 | Ga0081540_1067451 | Ga0081540_10674512 | 177 |
| 7 | 3300005329 | Ga0070683_100007474 | Ga0070683_1000074744 | 178 |
| 8 | 3300005458 | Ga0070681_10110063 | Ga0070681_101100633 | 178 |
| 9 | 3300025912 | Ga0207707_10720452 | Ga0207707_107204522 | 178 |
| 10 | 3300006914 | Ga0075436_100090519 | Ga0075436_1000905193 | 179 |
| 11 | 3300050507 | nmdc:mga05p37_308263_c1 | nmdc:mga05p37_308263_c1_984_1586 | 179 |
| 12 | 3300050514 | nmdc:mga08x19_222059_c1 | nmdc:mga08x19_222059_c1_534_1136 | 179 |
| 13 | 3300006871 | Ga0075434_100715516 | Ga0075434_1007155162 | 180 |
| 14 | 3300007076 | Ga0075435_100431273 | Ga0075435_1004312733 | 180 |
| 15 | 3300013308 | Ga0157375_11350187 | Ga0157375_113501872 | 180 |
| 16 | 3300020080 | Ga0206350_10220966 | Ga0206350_102209662 | 180 |
| 17 | 3300038443 | Ga0395901_0452026 | Ga0395901_0452026_450_1094 | 180 |
| 18 | 3300045976 | Ga0466967_0585761 | Ga0466967_0585761_254_898 | 180 |
| 19 | 3300050512 | nmdc:mga0n895_28832_c1 | nmdc:mga0n895_28832_c1_2347_2949 | 180 |
| 20 | 3300005331 | Ga0070670_100574968 | Ga0070670_1005749682 | 181 |
| 21 | 3300005334 | Ga0068869_100293988 | Ga0068869_1002939883 | 181 |
| 22 | 3300005337 | Ga0070682_100161109 | Ga0070682_1001611092 | 181 |
| 23 | 3300005338 | Ga0068868_100078148 | Ga0068868_1000781484 | 181 |
| 24 | 3300005338 | Ga0068868_100109482 | Ga0068868_1001094822 | 181 |
| 25 | 3300005339 | Ga0070660_100143992 | Ga0070660_1001439923 | 181 |
| 26 | 3300005343 | Ga0070687_100222094 | Ga0070687_1002220942 | 181 |
| 27 | 3300005355 | Ga0070671_100122715 | Ga0070671_1001227153 | 181 |
| 28 | 3300005365 | Ga0070688_100070290 | Ga0070688_1000702904 | 181 |
| 29 | 3300005367 | Ga0070667_100679502 | Ga0070667_1006795022 | 181 |
| 30 | 3300005438 | Ga0070701_10687931 | Ga0070701_106879311 | 181 |
| 31 | 3300005439 | Ga0070711_100038639 | Ga0070711_1000386393 | 181 |
| 32 | 3300005444 | Ga0070694_100248474 | Ga0070694_1002484743 | 181 |
| 33 | 3300005455 | Ga0070663_100320919 | Ga0070663_1003209192 | 181 |
| 34 | 3300005459 | Ga0068867_100248407 | Ga0068867_1002484073 | 181 |
| 35 | 3300005539 | Ga0068853_100692705 | Ga0068853_1006927052 | 181 |
| 36 | 3300005544 | Ga0070686_100049879 | Ga0070686_1000498792 | 181 |
| 37 | 3300005578 | Ga0068854_100270776 | Ga0068854_1002707762 | 181 |
| 38 | 3300005615 | Ga0070702_100074320 | Ga0070702_1000743202 | 181 |
| 39 | 3300005616 | Ga0068852_100607450 | Ga0068852_1006074502 | 181 |
| 40 | 3300005719 | Ga0068861_100400006 | Ga0068861_1004000061 | 181 |
| 41 | 3300005840 | Ga0068870_10101845 | Ga0068870_101018453 | 181 |
| 42 | 3300005842 | Ga0068858_100250944 | Ga0068858_1002509443 | 181 |
| 43 | 3300005844 | Ga0068862_100355326 | Ga0068862_1003553261 | 181 |
| 44 | 3300006175 | Ga0070712_100164112 | Ga0070712_1001641122 | 181 |
| 45 | 3300006852 | Ga0075433_10184379 | Ga0075433_101843793 | 181 |
| 46 | 3300006881 | Ga0068865_100076405 | Ga0068865_1000764053 | 181 |
| 47 | 3300009094 | Ga0111539_10408034 | Ga0111539_104080343 | 181 |
| 48 | 3300009098 | Ga0105245_10012366 | Ga0105245_100123668 | 181 |
| 49 | 3300009098 | Ga0105245_10238654 | Ga0105245_102386542 | 181 |
| 50 | 3300009148 | Ga0105243_10331547 | Ga0105243_103315473 | 181 |
| 51 | 3300009148 | Ga0105243_10450214 | Ga0105243_104502142 | 181 |
| 52 | 3300009545 | Ga0105237_10603223 | Ga0105237_106032232 | 181 |
| 53 | 3300009553 | Ga0105249_10159658 | Ga0105249_101596583 | 181 |
| 54 | 3300010375 | Ga0105239_10034414 | Ga0105239_100344147 | 181 |
| 55 | 3300011119 | Ga0105246_10251412 | Ga0105246_102514123 | 181 |
| 56 | 3300013296 | Ga0157374_10252001 | Ga0157374_102520013 | 181 |
| 57 | 3300013306 | Ga0163162_11057002 | Ga0163162_110570022 | 181 |
| 58 | 3300013308 | Ga0157375_10592299 | Ga0157375_105922992 | 181 |
| 59 | 3300014326 | Ga0157380_10107515 | Ga0157380_101075153 | 181 |
| 60 | 3300014326 | Ga0157380_10896486 | Ga0157380_108964861 | 181 |
| 61 | 3300025900 | Ga0207710_10048116 | Ga0207710_100481162 | 181 |
| 62 | 3300025901 | Ga0207688_10046049 | Ga0207688_100460493 | 181 |
| 63 | 3300025904 | Ga0207647_10162067 | Ga0207647_101620673 | 181 |
| 64 | 3300025907 | Ga0207645_10126816 | Ga0207645_101268163 | 181 |
| 65 | 3300025915 | Ga0207693_10410040 | Ga0207693_104100401 | 181 |
| 66 | 3300025916 | Ga0207663_10035621 | Ga0207663_100356212 | 181 |
| 67 | 3300025918 | Ga0207662_10037804 | Ga0207662_100378043 | 181 |
| 68 | 3300025919 | Ga0207657_10272171 | Ga0207657_102721713 | 181 |
| 69 | 3300025924 | Ga0207694_10133277 | Ga0207694_101332773 | 181 |
| 70 | 3300025927 | Ga0207687_10080925 | Ga0207687_100809253 | 181 |
| 71 | 3300025927 | Ga0207687_10432868 | Ga0207687_104328682 | 181 |
| 72 | 3300025932 | Ga0207690_10113062 | Ga0207690_101130623 | 181 |
| 73 | 3300025935 | Ga0207709_10089208 | Ga0207709_100892082 | 181 |
| 74 | 3300025935 | Ga0207709_10430301 | Ga0207709_104303012 | 181 |
| 75 | 3300025936 | Ga0207670_10054117 | Ga0207670_100541172 | 181 |
| 76 | 3300025937 | Ga0207669_10380133 | Ga0207669_103801332 | 181 |
| 77 | 3300025938 | Ga0207704_10201305 | Ga0207704_102013052 | 181 |
| 78 | 3300025939 | Ga0207665_10115649 | Ga0207665_101156493 | 181 |
| 79 | 3300025942 | Ga0207689_10378863 | Ga0207689_103788631 | 181 |
| 80 | 3300025960 | Ga0207651_10476166 | Ga0207651_104761662 | 181 |
| 81 | 3300025986 | Ga0207658_10373606 | Ga0207658_103736063 | 181 |
| 82 | 3300026023 | Ga0207677_10036644 | Ga0207677_100366443 | 181 |
| 83 | 3300026023 | Ga0207677_10347355 | Ga0207677_103473553 | 181 |
| 84 | 3300026035 | Ga0207703_10056243 | Ga0207703_100562435 | 181 |
| 85 | 3300026067 | Ga0207678_10085105 | Ga0207678_100851053 | 181 |
| 86 | 3300026089 | Ga0207648_10066490 | Ga0207648_100664903 | 181 |
| 87 | 3300026089 | Ga0207648_10962606 | Ga0207648_109626061 | 181 |
| 88 | 3300026118 | Ga0207675_100094396 | Ga0207675_1000943963 | 181 |
| 89 | 3300028380 | Ga0268265_10071585 | Ga0268265_100715853 | 181 |
| 90 | 3300048903 | Ga0496100_0463797 | Ga0496100_0463797_174_818 | 181 |
| 91 | 3300048904 | Ga0496101_0080160 | Ga0496101_0080160_645_1289 | 181 |
| 92 | 3300048905 | Ga0496102_1054078 | Ga0496102_1054078_62_706 | 181 |
| 93 | 3300048905 | Ga0496102_1128970 | Ga0496102_1128970_45_689 | 181 |
| 94 | 3300048906 | Ga0496103_0132357 | Ga0496103_0132357_13_657 | 181 |
| 95 | 3300048910 | Ga0496107_0455202 | Ga0496107_0455202_261_905 | 181 |
| 96 | 3300048911 | Ga0496108_0026855 | Ga0496108_0026855_3329_3973 | 181 |
| 97 | 3300048912 | Ga0496109_0057783 | Ga0496109_0057783_2661_3305 | 181 |
| 98 | 3300048913 | Ga0496110_0520053 | Ga0496110_0520053_155_799 | 181 |
| 99 | 3300048915 | Ga0496112_0828219 | Ga0496112_0828219_139_783 | 181 |
| 100 | 3300048916 | Ga0496113_0040057 | Ga0496113_0040057_2021_2665 | 181 |
| 101 | 3300050511 | nmdc:mga08y16_523584_c1 | nmdc:mga08y16_523584_c1_511_1155 | 181 |
| 102 | 3300009094 | Ga0111539_10946060 | Ga0111539_109460602 | 185 |
| 103 | 3300025932 | Ga0207690_10477184 | Ga0207690_104771841 | 185 |
| 104 | 3300032002 | Ga0307416_100782283 | Ga0307416_1007822831 | 186 |
| 105 | 3300046471 | Ga0495650_0000063 | Ga0495650_0000063_215029_215682 | 186 |
| 106 | 3300013307 | Ga0157372_11777304 | Ga0157372_117773041 | 187 |
| 107 | 3300031824 | Ga0307413_10462725 | Ga0307413_104627251 | 187 |
| 108 | 3300031852 | Ga0307410_10285243 | Ga0307410_102852432 | 187 |
| 109 | 3300031901 | Ga0307406_10229488 | Ga0307406_102294882 | 187 |
| 110 | 3300031995 | Ga0307409_100585592 | Ga0307409_1005855921 | 187 |
| 111 | 3300032002 | Ga0307416_100263050 | Ga0307416_1002630503 | 187 |
| 112 | 3300032005 | Ga0307411_10514812 | Ga0307411_105148121 | 187 |
| 113 | 3300032126 | Ga0307415_100131902 | Ga0307415_1001319022 | 187 |
| 114 | 3300038443 | Ga0395901_0651993 | Ga0395901_0651993_298_951 | 187 |
| 115 | 3300044706 | Ga0466964_0138484 | Ga0466964_0138484_457_1068 | 193 |
| 116 | 3300045976 | Ga0466967_0191436 | Ga0466967_0191436_766_1377 | 193 |
| 117 | 3300005456 | Ga0070678_100210719 | Ga0070678_1002107193 | 195 |
| 118 | 3300031824 | Ga0307413_10586634 | Ga0307413_105866342 | 195 |
| 119 | 3300048903 | Ga0496100_0181244 | Ga0496100_0181244_506_1150 | 195 |
| 120 | 3300048904 | Ga0496101_0194442 | Ga0496101_0194442_200_844 | 195 |
| 121 | 3300048905 | Ga0496102_0088040 | Ga0496102_0088040_2062_2706 | 195 |
| 122 | 3300048905 | Ga0496102_0752584 | Ga0496102_0752584_102_704 | 195 |
| 123 | 3300048906 | Ga0496103_0398432 | Ga0496103_0398432_169_771 | 195 |
| 124 | 3300048909 | Ga0496106_0081217 | Ga0496106_0081217_1520_2164 | 195 |
| 125 | 3300048910 | Ga0496107_0041023 | Ga0496107_0041023_2091_2735 | 195 |
| 126 | 3300048917 | Ga0496114_0377760 | Ga0496114_0377760_555_1199 | 195 |
| 127 | 3300048918 | Ga0496115_0234635 | Ga0496115_0234635_538_1182 | 195 |
| 128 | 3300049578 | Ga0501042_0775122 | Ga0501042_0775122_44_646 | 195 |
| 129 | 3300049587 | Ga0501071_0411468 | Ga0501071_0411468_41_643 | 195 |
| 130 | 3300049592 | Ga0501076_0599960 | Ga0501076_0599960_173_775 | 195 |
| 131 | 3300009098 | Ga0105245_11316640 | Ga0105245_113166401 | 196 |
| 132 | 3300021388 | Ga0213875_10000631 | Ga0213875_1000063120 | 196 |
| 133 | 3300025917 | Ga0207660_10158944 | Ga0207660_101589443 | 196 |
| 134 | 3300025927 | Ga0207687_10769088 | Ga0207687_107690881 | 196 |
| 135 | 3300032002 | Ga0307416_101430091 | Ga0307416_1014300912 | 196 |
| 136 | 3300037853 | Ga0436364_0844887 | Ga0436364_0844887_13619_14230 | 196 |
| 137 | 3300048912 | Ga0496109_0868579 | Ga0496109_0868579_96_710 | 196 |
| 138 | 3300048913 | Ga0496110_0231577 | Ga0496110_0231577_420_1034 | 196 |
| 139 | 3300048914 | Ga0496111_0195863 | Ga0496111_0195863_43_657 | 196 |
| 140 | 3300048915 | Ga0496112_0663772 | Ga0496112_0663772_346_960 | 196 |
| 141 | 3300005327 | Ga0070658_10103253 | Ga0070658_101032534 | 197 |
| 142 | 3300005339 | Ga0070660_100170138 | Ga0070660_1001701383 | 197 |
| 143 | 3300005355 | Ga0070671_100287356 | Ga0070671_1002873561 | 197 |
| 144 | 3300005545 | Ga0070695_100471560 | Ga0070695_1004715601 | 197 |
| 145 | 3300006846 | Ga0075430_100699581 | Ga0075430_1006995812 | 197 |
| 146 | 3300009098 | Ga0105245_10164973 | Ga0105245_101649732 | 197 |
| 147 | 3300009148 | Ga0105243_10289365 | Ga0105243_102893652 | 197 |
| 148 | 3300014326 | Ga0157380_10361516 | Ga0157380_103615163 | 197 |
| 149 | 3300025909 | Ga0207705_10652843 | Ga0207705_106528431 | 197 |
| 150 | 3300025919 | Ga0207657_10169427 | Ga0207657_101694273 | 197 |
| 151 | 3300025935 | Ga0207709_10203241 | Ga0207709_102032413 | 197 |
| 152 | 3300026089 | Ga0207648_10906888 | Ga0207648_109068882 | 197 |
| 153 | 3300044684 | Ga0466966_0073280 | Ga0466966_0073280_1175_1801 | 197 |
| 154 | 3300045836 | Ga0466958_0282342 | Ga0466958_0282342_120_779 | 197 |
| 155 | 3300049590 | Ga0501074_0059008 | Ga0501074_0059008_688_1314 | 197 |
| 156 | 3300049742 | Ga0501080_0191484 | Ga0501080_0191484_588_1214 | 197 |
| 157 | 3300050509 | nmdc:mga0qj67_11801_c1 | nmdc:mga0qj67_11801_c1_5818_6444 | 197 |
| 158 | 3300005441 | Ga0070700_100815663 | Ga0070700_1008156631 | 198 |
| 159 | 3300005545 | Ga0070695_100557918 | Ga0070695_1005579182 | 198 |
| 160 | 3300005549 | Ga0070704_100528808 | Ga0070704_1005288082 | 198 |
| 161 | 3300005981 | Ga0081538_10000064 | Ga0081538_1000006447 | 198 |
| 162 | 3300005981 | Ga0081538_10000513 | Ga0081538_100005134 | 198 |
| 163 | 3300005981 | Ga0081538_10008464 | Ga0081538_1000846410 | 198 |
| 164 | 3300005985 | Ga0081539_10121991 | Ga0081539_101219912 | 198 |
| 165 | 3300009094 | Ga0111539_10023921 | Ga0111539_100239212 | 198 |
| 166 | 3300009147 | Ga0114129_10011940 | Ga0114129_100119404 | 198 |
| 167 | 3300014326 | Ga0157380_10608954 | Ga0157380_106089541 | 198 |
| 168 | 3300014968 | Ga0157379_10024734 | Ga0157379_100247343 | 198 |
| 169 | 3300026075 | Ga0207708_10183033 | Ga0207708_101830332 | 198 |
| 170 | 3300027907 | Ga0207428_10065045 | Ga0207428_100650452 | 198 |
| 171 | 3300048905 | Ga0496102_0870736 | Ga0496102_0870736_165_809 | 198 |
| 172 | 3300048906 | Ga0496103_0452303 | Ga0496103_0452303_95_748 | 198 |
| 173 | 3300048908 | Ga0496105_0406962 | Ga0496105_0406962_54_698 | 198 |
| 174 | 3300050507 | nmdc:mga05p37_2122_c1 | nmdc:mga05p37_2122_c1_969_1580 | 198 |
| 175 | 3300050511 | nmdc:mga08y16_265349_c1 | nmdc:mga08y16_265349_c1_583_1194 | 198 |
| 176 | 3300053083 | Ga0495655_0052423 | Ga0495655_0052423_398_1027 | 198 |
| 177 | 3300005435 | Ga0070714_100232070 | Ga0070714_1002320702 | 201 |
| 178 | 3300021377 | Ga0213874_10036637 | Ga0213874_100366372 | 201 |
| 179 | 3300021377 | Ga0213874_10077722 | Ga0213874_100777223 | 201 |
| 180 | 3300021384 | Ga0213876_10009982 | Ga0213876_100099824 | 201 |
| 181 | 3300021384 | Ga0213876_10023850 | Ga0213876_100238504 | 201 |
| 182 | 3300021384 | Ga0213876_10153820 | Ga0213876_101538201 | 201 |
| 183 | 3300021384 | Ga0213876_10155658 | Ga0213876_101556581 | 201 |
| 184 | 3300021388 | Ga0213875_10019222 | Ga0213875_100192224 | 201 |
| 185 | 3300037853 | Ga0436364_0083893 | Ga0436364_0083893_740_1351 | 201 |
| 186 | 3300037853 | Ga0436364_1001540 | Ga0436364_1001540_172_783 | 201 |
| 187 | 3300037853 | Ga0436364_1077960 | Ga0436364_1077960_284_895 | 201 |
| 188 | 3300037853 | Ga0436364_1299031 | Ga0436364_1299031_106_717 | 201 |
| 189 | 3300037853 | Ga0436364_1543506 | Ga0436364_1543506_1829_2440 | 201 |
| 190 | 3300039437 | Ga0436365_0782639 | Ga0436365_0782639_72_683 | 201 |
| 191 | 3300039437 | Ga0436365_0851257 | Ga0436365_0851257_13199_13810 | 201 |
| 192 | 3300039437 | Ga0436365_0861691 | Ga0436365_0861691_2540_3151 | 201 |
| 193 | 3300039437 | Ga0436365_0990694 | Ga0436365_0990694_1481_2092 | 201 |
| 194 | 3300039437 | Ga0436365_1372237 | Ga0436365_1372237_292_903 | 201 |
| 195 | 3300039438 | Ga0436360_1042459 | Ga0436360_1042459_382_993 | 201 |
| 196 | 3300039447 | Ga0436361_0395337 | Ga0436361_0395337_322_933 | 201 |
| 197 | 3300039450 | Ga0436363_0228724 | Ga0436363_0228724_482_1093 | 201 |
| 198 | 3300039450 | Ga0436363_0684606 | Ga0436363_0684606_236_847 | 201 |
| 199 | 3300039450 | Ga0436363_0713209 | Ga0436363_0713209_443_1054 | 201 |
| 200 | 3300039450 | Ga0436363_0834497 | Ga0436363_0834497_812_1423 | 201 |
| 201 | 3300039450 | Ga0436363_0990710 | Ga0436363_0990710_7946_8557 | 201 |
| 202 | 3300039453 | Ga0436362_0310533 | Ga0436362_0310533_717_1328 | 201 |
| 203 | 3300039453 | Ga0436362_0778145 | Ga0436362_0778145_1744_2355 | 201 |
| 204 | 3300039453 | Ga0436362_1067159 | Ga0436362_1067159_301_912 | 201 |
| 205 | 3300044683 | Ga0466965_0211445 | Ga0466965_0211445_244_855 | 201 |
| 206 | 3300044684 | Ga0466966_0014293 | Ga0466966_0014293_2928_3539 | 201 |
| 207 | 3300044684 | Ga0466966_0144364 | Ga0466966_0144364_423_1034 | 201 |
| 208 | 3300044693 | Ga0466961_0004445 | Ga0466961_0004445_4430_5041 | 201 |
| 209 | 3300044693 | Ga0466961_0055307 | Ga0466961_0055307_1071_1682 | 201 |
| 210 | 3300044694 | Ga0466963_0035718 | Ga0466963_0035718_2025_2636 | 201 |
| 211 | 3300044719 | Ga0466971_0003800 | Ga0466971_0003800_1200_1811 | 201 |
| 212 | 3300044719 | Ga0466971_0417147 | Ga0466971_0417147_28_639 | 201 |
| 213 | 3300044735 | Ga0466968_0082692 | Ga0466968_0082692_705_1316 | 201 |
| 214 | 3300044735 | Ga0466968_0144886 | Ga0466968_0144886_439_1050 | 201 |
| 215 | 3300044765 | Ga0466970_0082756 | Ga0466970_0082756_486_1097 | 201 |
| 216 | 3300044842 | Ga0466957_0233622 | Ga0466957_0233622_24_635 | 201 |
| 217 | 3300045049 | Ga0466959_0016584 | Ga0466959_0016584_235_846 | 201 |
| 218 | 3300045049 | Ga0466959_0036938 | Ga0466959_0036938_2535_3146 | 201 |
| 219 | 3300045049 | Ga0466959_0041915 | Ga0466959_0041915_2196_2807 | 201 |
| 220 | 3300045049 | Ga0466959_0343195 | Ga0466959_0343195_44_655 | 201 |
| 221 | 3300045836 | Ga0466958_0057843 | Ga0466958_0057843_461_1072 | 201 |
| 222 | 3300045836 | Ga0466958_0096134 | Ga0466958_0096134_1111_1722 | 201 |
| 223 | 3300045836 | Ga0466958_0108989 | Ga0466958_0108989_555_1166 | 201 |
| 224 | 3300045836 | Ga0466958_0268093 | Ga0466958_0268093_347_958 | 201 |
| 225 | 3300045836 | Ga0466958_0298594 | Ga0466958_0298594_171_782 | 201 |
| 226 | 3300045976 | Ga0466967_0369082 | Ga0466967_0369082_223_834 | 201 |
| 227 | 3300061719 | Ga0466962_0031827 | Ga0466962_0031827_1345_1956 | 201 |
| 228 | 3300061719 | Ga0466962_0032896 | Ga0466962_0032896_1571_2182 | 201 |
| 229 | 3300025898 | Ga0207692_10490047 | Ga0207692_104900471 | 202 |
| 230 | 3300005329 | Ga0070683_100598027 | Ga0070683_1005980272 | 203 |
| 231 | 3300005329 | Ga0070683_100904746 | Ga0070683_1009047461 | 203 |
| 232 | 3300005347 | Ga0070668_100754621 | Ga0070668_1007546212 | 203 |
| 233 | 3300005434 | Ga0070709_10191253 | Ga0070709_101912532 | 203 |
| 234 | 3300005435 | Ga0070714_100024840 | Ga0070714_1000248406 | 203 |
| 235 | 3300005435 | Ga0070714_100322256 | Ga0070714_1003222562 | 203 |
| 236 | 3300005435 | Ga0070714_100343587 | Ga0070714_1003435872 | 203 |
| 237 | 3300005435 | Ga0070714_100533198 | Ga0070714_1005331982 | 203 |
| 238 | 3300005436 | Ga0070713_100493749 | Ga0070713_1004937492 | 203 |
| 239 | 3300005457 | Ga0070662_100455320 | Ga0070662_1004553202 | 203 |
| 240 | 3300005458 | Ga0070681_10763243 | Ga0070681_107632431 | 203 |
| 241 | 3300005468 | Ga0070707_100312238 | Ga0070707_1003122381 | 203 |
| 242 | 3300005564 | Ga0070664_100151364 | Ga0070664_1001513642 | 203 |
| 243 | 3300005618 | Ga0068864_100200761 | Ga0068864_1002007613 | 203 |
| 244 | 3300005719 | Ga0068861_100057717 | Ga0068861_1000577172 | 203 |
| 245 | 3300005834 | Ga0068851_10267609 | Ga0068851_102676092 | 203 |
| 246 | 3300006028 | Ga0070717_10298290 | Ga0070717_102982902 | 203 |
| 247 | 3300006028 | Ga0070717_10367524 | Ga0070717_103675242 | 203 |
| 248 | 3300006028 | Ga0070717_10501830 | Ga0070717_105018302 | 203 |
| 249 | 3300006173 | Ga0070716_100191200 | Ga0070716_1001912002 | 203 |
| 250 | 3300006175 | Ga0070712_100038759 | Ga0070712_1000387593 | 203 |
| 251 | 3300009011 | Ga0105251_10075114 | Ga0105251_100751143 | 203 |
| 252 | 3300014325 | Ga0163163_10880191 | Ga0163163_108801912 | 203 |
| 253 | 3300020069 | Ga0197907_11203372 | Ga0197907_112033721 | 203 |
| 254 | 3300020070 | Ga0206356_10148965 | Ga0206356_101489652 | 203 |
| 255 | 3300020077 | Ga0206351_10189663 | Ga0206351_101896632 | 203 |
| 256 | 3300020080 | Ga0206350_10224355 | Ga0206350_102243551 | 203 |
| 257 | 3300021377 | Ga0213874_10033464 | Ga0213874_100334642 | 203 |
| 258 | 3300022467 | Ga0224712_10143969 | Ga0224712_101439692 | 203 |
| 259 | 3300025906 | Ga0207699_10528116 | Ga0207699_105281162 | 203 |
| 260 | 3300025912 | Ga0207707_10834497 | Ga0207707_108344971 | 203 |
| 261 | 3300025914 | Ga0207671_10000385 | Ga0207671_1000038537 | 203 |
| 262 | 3300025915 | Ga0207693_10238880 | Ga0207693_102388801 | 203 |
| 263 | 3300025920 | Ga0207649_10256117 | Ga0207649_102561172 | 203 |
| 264 | 3300025922 | Ga0207646_10256070 | Ga0207646_102560701 | 203 |
| 265 | 3300025928 | Ga0207700_10178041 | Ga0207700_101780413 | 203 |
| 266 | 3300025929 | Ga0207664_10019246 | Ga0207664_100192467 | 203 |
| 267 | 3300025929 | Ga0207664_10448732 | Ga0207664_104487322 | 203 |
| 268 | 3300025933 | Ga0207706_10155460 | Ga0207706_101554602 | 203 |
| 269 | 3300025936 | Ga0207670_10864272 | Ga0207670_108642721 | 203 |
| 270 | 3300025939 | Ga0207665_10062783 | Ga0207665_100627833 | 203 |
| 271 | 3300025944 | Ga0207661_10152543 | Ga0207661_101525431 | 203 |
| 272 | 3300025945 | Ga0207679_10088080 | Ga0207679_100880802 | 203 |
| 273 | 3300025945 | Ga0207679_10720309 | Ga0207679_107203092 | 203 |
| 274 | 3300025972 | Ga0207668_10675507 | Ga0207668_106755071 | 203 |
| 275 | 3300026118 | Ga0207675_100063828 | Ga0207675_1000638284 | 203 |
| 276 | 3300032126 | Ga0307415_100605325 | Ga0307415_1006053252 | 203 |
| 277 | 3300035171 | Ga0373946_0147890 | Ga0373946_0147890_155_778 | 203 |
| 278 | 3300035410 | Ga0373924_0054919 | Ga0373924_0054919_957_1580 | 203 |
| 279 | 3300035724 | Ga0373933_0105699 | Ga0373933_0105699_154_777 | 203 |
| 280 | 3300036401 | Ga0373937_0121864 | Ga0373937_0121864_134_757 | 203 |
| 281 | 3300037312 | Ga0395899_0098644 | Ga0395899_0098644_294_947 | 203 |
| 282 | 3300037418 | Ga0395900_0558712 | Ga0395900_0558712_147_800 | 203 |
| 283 | 3300037466 | Ga0395898_0702006 | Ga0395898_0702006_67_720 | 203 |
| 284 | 3300037466 | Ga0395898_0742099 | Ga0395898_0742099_230_883 | 203 |
| 285 | 3300037471 | Ga0395905_0947662 | Ga0395905_0947662_79_732 | 203 |
| 286 | 3300037853 | Ga0436364_0415415 | Ga0436364_0415415_414_1064 | 203 |
| 287 | 3300038443 | Ga0395901_0116963 | Ga0395901_0116963_237_890 | 203 |
| 288 | 3300038443 | Ga0395901_0427832 | Ga0395901_0427832_219_863 | 203 |
| 289 | 3300038443 | Ga0395901_1076783 | Ga0395901_1076783_45_689 | 203 |
| 290 | 3300039447 | Ga0436361_0954279 | Ga0436361_0954279_107_730 | 203 |
| 291 | 3300041456 | Ga0451795_0316391 | Ga0451795_0316391_82_696 | 203 |
| 292 | 3300044694 | Ga0466963_0031101 | Ga0466963_0031101_477_1100 | 203 |
| 293 | 3300044719 | Ga0466971_0055482 | Ga0466971_0055482_596_1219 | 203 |
| 294 | 3300044842 | Ga0466957_0079873 | Ga0466957_0079873_651_1274 | 203 |
| 295 | 3300044901 | Ga0466960_0001210 | Ga0466960_0001210_2030_2683 | 203 |
| 296 | 3300045049 | Ga0466959_0044668 | Ga0466959_0044668_561_1184 | 203 |
| 297 | 3300045836 | Ga0466958_0034508 | Ga0466958_0034508_1369_1992 | 203 |
| 298 | 3300045976 | Ga0466967_0379355 | Ga0466967_0379355_449_1072 | 203 |
| 299 | 3300046454 | Ga0495592_0310431 | Ga0495592_0310431_315_938 | 203 |
| 300 | 3300046463 | Ga0495653_0163869 | Ga0495653_0163869_560_1183 | 203 |
| 301 | 3300046477 | Ga0495664_0052389 | Ga0495664_0052389_104_727 | 203 |
| 302 | 3300046511 | Ga0495608_0004342 | Ga0495608_0004342_1075_1698 | 203 |
| 303 | 3300046516 | Ga0495628_0043511 | Ga0495628_0043511_858_1481 | 203 |
| 304 | 3300046516 | Ga0495628_0593318 | Ga0495628_0593318_57_680 | 203 |
| 305 | 3300046517 | Ga0495630_0312758 | Ga0495630_0312758_480_1103 | 203 |
| 306 | 3300046529 | Ga0495652_0029989 | Ga0495652_0029989_776_1399 | 203 |
| 307 | 3300046533 | Ga0495640_0062807 | Ga0495640_0062807_1643_2266 | 203 |
| 308 | 3300046536 | Ga0495587_0105726 | Ga0495587_0105726_427_1050 | 203 |
| 309 | 3300046543 | Ga0495645_0374762 | Ga0495645_0374762_101_724 | 203 |
| 310 | 3300046559 | Ga0495667_0069168 | Ga0495667_0069168_1373_1996 | 203 |
| 311 | 3300046642 | Ga0495634_0080838 | Ga0495634_0080838_114_737 | 203 |
| 312 | 3300046663 | Ga0495635_0013027 | Ga0495635_0013027_1295_1918 | 203 |
| 313 | 3300046675 | Ga0495657_0003521 | Ga0495657_0003521_10984_11607 | 203 |
| 314 | 3300046678 | Ga0495599_0265388 | Ga0495599_0265388_328_951 | 203 |
| 315 | 3300046679 | Ga0495623_0117857 | Ga0495623_0117857_167_790 | 203 |
| 316 | 3300046680 | Ga0495646_0010567 | Ga0495646_0010567_1701_2324 | 203 |
| 317 | 3300046689 | Ga0495613_0156707 | Ga0495613_0156707_505_1128 | 203 |
| 318 | 3300046809 | Ga0495600_0093268 | Ga0495600_0093268_1126_1749 | 203 |
| 319 | 3300047317 | Ga0495604_0018888 | Ga0495604_0018888_2823_3446 | 203 |
| 320 | 3300047319 | Ga0495674_0022060 | Ga0495674_0022060_184_807 | 203 |
| 321 | 3300047319 | Ga0495674_0514455 | Ga0495674_0514455_275_898 | 203 |
| 322 | 3300047322 | Ga0495680_0104558 | Ga0495680_0104558_870_1493 | 203 |
| 323 | 3300047444 | Ga0495675_0206064 | Ga0495675_0206064_362_985 | 203 |
| 324 | 3300047471 | Ga0495684_0156919 | Ga0495684_0156919_530_1153 | 203 |
| 325 | 3300048088 | Ga0495602_0025131 | Ga0495602_0025131_279_902 | 203 |
| 326 | 3300048088 | Ga0495602_0396024 | Ga0495602_0396024_335_958 | 203 |
| 327 | 3300048910 | Ga0496107_0492247 | Ga0496107_0492247_88_711 | 203 |
| 328 | 3300048915 | Ga0496112_0051576 | Ga0496112_0051576_1029_1682 | 203 |
| 329 | 3300048924 | Ga0496121_0084402 | Ga0496121_0084402_600_1253 | 203 |
| 330 | 3300049571 | Ga0501034_0061149 | Ga0501034_0061149_1751_2404 | 203 |
| 331 | 3300050512 | nmdc:mga0n895_651350_c1 | nmdc:mga0n895_651350_c1_369_1013 | 203 |
| 332 | 3300053077 | Ga0495601_0000876 | Ga0495601_0000876_7120_7743 | 203 |
| 333 | 3300053078 | Ga0495612_0000025 | Ga0495612_0000025_113412_114035 | 203 |
| 334 | 3300053085 | Ga0495619_0023700 | Ga0495619_0023700_354_977 | 203 |
| 335 | 3300053153 | Ga0500616_0013570 | Ga0500616_0013570_366_1019 | 203 |
| 336 | 3300061719 | Ga0466962_0072093 | Ga0466962_0072093_467_1090 | 203 |
| 337 | 3300005329 | Ga0070683_100397197 | Ga0070683_1003971972 | 204 |
| 338 | 3300005334 | Ga0068869_100074910 | Ga0068869_1000749103 | 204 |
| 339 | 3300005337 | Ga0070682_100047507 | Ga0070682_1000475072 | 204 |
| 340 | 3300005338 | Ga0068868_100005963 | Ga0068868_1000059632 | 204 |
| 341 | 3300005339 | Ga0070660_100260834 | Ga0070660_1002608342 | 204 |
| 342 | 3300005340 | Ga0070689_100341169 | Ga0070689_1003411692 | 204 |
| 343 | 3300005341 | Ga0070691_10106174 | Ga0070691_101061743 | 204 |
| 344 | 3300005344 | Ga0070661_100434999 | Ga0070661_1004349992 | 204 |
| 345 | 3300005354 | Ga0070675_100346975 | Ga0070675_1003469751 | 204 |
| 346 | 3300005355 | Ga0070671_100134398 | Ga0070671_1001343985 | 204 |
| 347 | 3300005434 | Ga0070709_10428276 | Ga0070709_104282762 | 204 |
| 348 | 3300005441 | Ga0070700_100240866 | Ga0070700_1002408663 | 204 |
| 349 | 3300005456 | Ga0070678_100096897 | Ga0070678_1000968973 | 204 |
| 350 | 3300005457 | Ga0070662_100172380 | Ga0070662_1001723803 | 204 |
| 351 | 3300005466 | Ga0070685_10157935 | Ga0070685_101579352 | 204 |
| 352 | 3300005535 | Ga0070684_100036531 | Ga0070684_1000365314 | 204 |
| 353 | 3300005546 | Ga0070696_100601262 | Ga0070696_1006012621 | 204 |
| 354 | 3300005549 | Ga0070704_100380602 | Ga0070704_1003806023 | 204 |
| 355 | 3300005564 | Ga0070664_100313727 | Ga0070664_1003137272 | 204 |
| 356 | 3300005577 | Ga0068857_100310862 | Ga0068857_1003108622 | 204 |
| 357 | 3300005578 | Ga0068854_100310961 | Ga0068854_1003109612 | 204 |
| 358 | 3300005614 | Ga0068856_100093313 | Ga0068856_1000933132 | 204 |
| 359 | 3300005616 | Ga0068852_100178790 | Ga0068852_1001787903 | 204 |
| 360 | 3300005618 | Ga0068864_100116436 | Ga0068864_1001164365 | 204 |
| 361 | 3300005718 | Ga0068866_10250230 | Ga0068866_102502302 | 204 |
| 362 | 3300005834 | Ga0068851_10052622 | Ga0068851_100526223 | 204 |
| 363 | 3300006175 | Ga0070712_100060757 | Ga0070712_1000607572 | 204 |
| 364 | 3300006844 | Ga0075428_100838295 | Ga0075428_1008382952 | 204 |
| 365 | 3300006847 | Ga0075431_100118799 | Ga0075431_1001187992 | 204 |
| 366 | 3300006852 | Ga0075433_10044931 | Ga0075433_100449316 | 204 |
| 367 | 3300006871 | Ga0075434_100222264 | Ga0075434_1002222643 | 204 |
| 368 | 3300006881 | Ga0068865_100063291 | Ga0068865_1000632914 | 204 |
| 369 | 3300006914 | Ga0075436_100070877 | Ga0075436_1000708773 | 204 |
| 370 | 3300009094 | Ga0111539_10201007 | Ga0111539_102010073 | 204 |
| 371 | 3300009094 | Ga0111539_11216598 | Ga0111539_112165981 | 204 |
| 372 | 3300009098 | Ga0105245_10017686 | Ga0105245_100176866 | 204 |
| 373 | 3300009177 | Ga0105248_10420304 | Ga0105248_104203043 | 204 |
| 374 | 3300009553 | Ga0105249_10147889 | Ga0105249_101478893 | 204 |
| 375 | 3300010375 | Ga0105239_10555043 | Ga0105239_105550433 | 204 |
| 376 | 3300010375 | Ga0105239_11227692 | Ga0105239_112276921 | 204 |
| 377 | 3300013296 | Ga0157374_10185275 | Ga0157374_101852753 | 204 |
| 378 | 3300013296 | Ga0157374_11359438 | Ga0157374_113594381 | 204 |
| 379 | 3300013307 | Ga0157372_10275582 | Ga0157372_102755823 | 204 |
| 380 | 3300013308 | Ga0157375_10618923 | Ga0157375_106189233 | 204 |
| 381 | 3300014325 | Ga0163163_10013456 | Ga0163163_100134568 | 204 |
| 382 | 3300014325 | Ga0163163_10271078 | Ga0163163_102710781 | 204 |
| 383 | 3300014326 | Ga0157380_10239076 | Ga0157380_102390762 | 204 |
| 384 | 3300014745 | Ga0157377_10094942 | Ga0157377_100949422 | 204 |
| 385 | 3300025899 | Ga0207642_10174263 | Ga0207642_101742631 | 204 |
| 386 | 3300025901 | Ga0207688_10091947 | Ga0207688_100919472 | 204 |
| 387 | 3300025901 | Ga0207688_10619431 | Ga0207688_106194311 | 204 |
| 388 | 3300025906 | Ga0207699_10201205 | Ga0207699_102012051 | 204 |
| 389 | 3300025915 | Ga0207693_10099802 | Ga0207693_100998022 | 204 |
| 390 | 3300025919 | Ga0207657_10155631 | Ga0207657_101556313 | 204 |
| 391 | 3300025920 | Ga0207649_10336188 | Ga0207649_103361882 | 204 |
| 392 | 3300025926 | Ga0207659_10287719 | Ga0207659_102877192 | 204 |
| 393 | 3300025927 | Ga0207687_10091814 | Ga0207687_100918143 | 204 |
| 394 | 3300025931 | Ga0207644_10140584 | Ga0207644_101405844 | 204 |
| 395 | 3300025933 | Ga0207706_10146702 | Ga0207706_101467023 | 204 |
| 396 | 3300025934 | Ga0207686_10433608 | Ga0207686_104336082 | 204 |
| 397 | 3300025935 | Ga0207709_10361781 | Ga0207709_103617812 | 204 |
| 398 | 3300025936 | Ga0207670_10167181 | Ga0207670_101671813 | 204 |
| 399 | 3300025938 | Ga0207704_10110809 | Ga0207704_101108093 | 204 |
| 400 | 3300025941 | Ga0207711_10676904 | Ga0207711_106769042 | 204 |
| 401 | 3300025942 | Ga0207689_10196188 | Ga0207689_101961883 | 204 |
| 402 | 3300025944 | Ga0207661_10249534 | Ga0207661_102495343 | 204 |
| 403 | 3300025944 | Ga0207661_10577953 | Ga0207661_105779532 | 204 |
| 404 | 3300025945 | Ga0207679_10040852 | Ga0207679_100408523 | 204 |
| 405 | 3300025949 | Ga0207667_10332275 | Ga0207667_103322753 | 204 |
| 406 | 3300025960 | Ga0207651_10530754 | Ga0207651_105307542 | 204 |
| 407 | 3300025981 | Ga0207640_10378063 | Ga0207640_103780631 | 204 |
| 408 | 3300026023 | Ga0207677_10507148 | Ga0207677_105071482 | 204 |
| 409 | 3300026067 | Ga0207678_10425884 | Ga0207678_104258842 | 204 |
| 410 | 3300026075 | Ga0207708_10002314 | Ga0207708_100023147 | 204 |
| 411 | 3300026078 | Ga0207702_10309272 | Ga0207702_103092723 | 204 |
| 412 | 3300026095 | Ga0207676_10488303 | Ga0207676_104883032 | 204 |
| 413 | 3300026116 | Ga0207674_10571305 | Ga0207674_105713051 | 204 |
| 414 | 3300026121 | Ga0207683_10085067 | Ga0207683_100850674 | 204 |
| 415 | 3300026142 | Ga0207698_10647717 | Ga0207698_106477172 | 204 |
| 416 | 3300027907 | Ga0207428_10029616 | Ga0207428_100296165 | 204 |
| 417 | 3300028381 | Ga0268264_10713473 | Ga0268264_107134732 | 204 |
| 418 | 3300028563 | Ga0265319_1000088 | Ga0265319_100008848 | 204 |
| 419 | 3300035172 | Ga0373955_0558887 | Ga0373955_0558887_44_679 | 204 |
| 420 | 3300037466 | Ga0395898_0229394 | Ga0395898_0229394_587_1222 | 204 |
| 421 | 3300038443 | Ga0395901_0405540 | Ga0395901_0405540_685_1320 | 204 |
| 422 | 3300044693 | Ga0466961_0067770 | Ga0466961_0067770_1279_1905 | 204 |
| 423 | 3300044693 | Ga0466961_0114071 | Ga0466961_0114071_233_847 | 204 |
| 424 | 3300044694 | Ga0466963_0258328 | Ga0466963_0258328_349_963 | 204 |
| 425 | 3300044765 | Ga0466970_0010466 | Ga0466970_0010466_2344_2958 | 204 |
| 426 | 3300044765 | Ga0466970_0413084 | Ga0466970_0413084_52_678 | 204 |
| 427 | 3300044842 | Ga0466957_0392467 | Ga0466957_0392467_118_732 | 204 |
| 428 | 3300044901 | Ga0466960_0116032 | Ga0466960_0116032_623_1237 | 204 |
| 429 | 3300045049 | Ga0466959_0442240 | Ga0466959_0442240_166_780 | 204 |
| 430 | 3300045836 | Ga0466958_0389045 | Ga0466958_0389045_232_846 | 204 |
| 431 | 3300046642 | Ga0495634_0040347 | Ga0495634_0040347_1029_1664 | 204 |
| 432 | 3300047319 | Ga0495674_0168441 | Ga0495674_0168441_518_1153 | 204 |
| 433 | 3300047320 | Ga0495672_0126642 | Ga0495672_0126642_266_880 | 204 |
| 434 | 3300047322 | Ga0495680_0121769 | Ga0495680_0121769_1049_1684 | 204 |
| 435 | 3300048903 | Ga0496100_0000222 | Ga0496100_0000222_20353_20967 | 204 |
| 436 | 3300048903 | Ga0496100_0050106 | Ga0496100_0050106_252_866 | 204 |
| 437 | 3300048904 | Ga0496101_0032554 | Ga0496101_0032554_2366_2980 | 204 |
| 438 | 3300048904 | Ga0496101_0198984 | Ga0496101_0198984_477_1091 | 204 |
| 439 | 3300048905 | Ga0496102_0063644 | Ga0496102_0063644_2185_2799 | 204 |
| 440 | 3300048906 | Ga0496103_0147796 | Ga0496103_0147796_82_696 | 204 |
| 441 | 3300048907 | Ga0496104_0126097 | Ga0496104_0126097_985_1620 | 204 |
| 442 | 3300048907 | Ga0496104_0288779 | Ga0496104_0288779_510_1124 | 204 |
| 443 | 3300048908 | Ga0496105_0052944 | Ga0496105_0052944_28_642 | 204 |
| 444 | 3300048908 | Ga0496105_0711072 | Ga0496105_0711072_50_685 | 204 |
| 445 | 3300048909 | Ga0496106_0081387 | Ga0496106_0081387_138_752 | 204 |
| 446 | 3300048911 | Ga0496108_0074040 | Ga0496108_0074040_77_700 | 204 |
| 447 | 3300048911 | Ga0496108_0480712 | Ga0496108_0480712_18_653 | 204 |
| 448 | 3300048912 | Ga0496109_0056451 | Ga0496109_0056451_16_639 | 204 |
| 449 | 3300048912 | Ga0496109_0532473 | Ga0496109_0532473_289_903 | 204 |
| 450 | 3300048913 | Ga0496110_0065377 | Ga0496110_0065377_635_1249 | 204 |
| 451 | 3300048914 | Ga0496111_0135301 | Ga0496111_0135301_802_1416 | 204 |
| 452 | 3300048914 | Ga0496111_0486882 | Ga0496111_0486882_271_885 | 204 |
| 453 | 3300048915 | Ga0496112_0052232 | Ga0496112_0052232_258_872 | 204 |
| 454 | 3300048915 | Ga0496112_0211474 | Ga0496112_0211474_1234_1869 | 204 |
| 455 | 3300048916 | Ga0496113_0103215 | Ga0496113_0103215_264_878 | 204 |
| 456 | 3300048917 | Ga0496114_0528915 | Ga0496114_0528915_76_690 | 204 |
| 457 | 3300050510 | nmdc:mga06r32_91754_c1 | nmdc:mga06r32_91754_c1_997_1611 | 204 |
| 458 | 3300050511 | nmdc:mga08y16_47566_c1 | nmdc:mga08y16_47566_c1_958_1572 | 204 |
| 459 | 3300050514 | nmdc:mga08x19_74609_c1 | nmdc:mga08x19_74609_c1_756_1370 | 204 |
| 460 | 3300050515 | nmdc:mga0a205_26378_c1 | nmdc:mga0a205_26378_c1_636_1250 | 204 |
| 461 | 3300050515 | nmdc:mga0a205_591231_c1 | nmdc:mga0a205_591231_c1_333_947 | 204 |
| 462 | 3300053077 | Ga0495601_0409120 | Ga0495601_0409120_148_783 | 204 |
| 463 | 3300009545 | Ga0105237_10000030 | Ga0105237_1000003022 | 205 |
| 464 | 3300009551 | Ga0105238_10690523 | Ga0105238_106905232 | 205 |
| 465 | 3300025927 | Ga0207687_10794488 | Ga0207687_107944881 | 205 |
| 466 | 3300044694 | Ga0466963_0200425 | Ga0466963_0200425_394_1089 | 205 |
| 467 | 3300005937 | Ga0081455_10166913 | Ga0081455_101669132 | 206 |
| 468 | 3300005985 | Ga0081539_10024918 | Ga0081539_100249183 | 206 |
| 469 | 3300031548 | Ga0307408_100841182 | Ga0307408_1008411821 | 206 |
| 470 | 3300046491 | Ga0495584_0297364 | Ga0495584_0297364_111_737 | 206 |
| 471 | 3300005719 | Ga0068861_100374746 | Ga0068861_1003747462 | 207 |
| 472 | 3300013105 | Ga0157369_10365251 | Ga0157369_103652512 | 207 |
| 473 | 3300013307 | Ga0157372_11039099 | Ga0157372_110390992 | 207 |
| 474 | 3300025986 | Ga0207658_10335912 | Ga0207658_103359123 | 207 |
| 475 | 3300041491 | Ga0451833_0507176 | Ga0451833_0507176_367_1011 | 207 |
| 476 | 3300005329 | Ga0070683_100435519 | Ga0070683_1004355193 | 208 |
| 477 | 3300005329 | Ga0070683_100709436 | Ga0070683_1007094362 | 208 |
| 478 | 3300005329 | Ga0070683_100925172 | Ga0070683_1009251721 | 208 |
| 479 | 3300005334 | Ga0068869_100188753 | Ga0068869_1001887533 | 208 |
| 480 | 3300005341 | Ga0070691_10089774 | Ga0070691_100897742 | 208 |
| 481 | 3300005343 | Ga0070687_100349607 | Ga0070687_1003496072 | 208 |
| 482 | 3300005347 | Ga0070668_100623194 | Ga0070668_1006231941 | 208 |
| 483 | 3300005354 | Ga0070675_100397607 | Ga0070675_1003976072 | 208 |
| 484 | 3300005356 | Ga0070674_100616750 | Ga0070674_1006167501 | 208 |
| 485 | 3300005438 | Ga0070701_10156982 | Ga0070701_101569821 | 208 |
| 486 | 3300005441 | Ga0070700_100086754 | Ga0070700_1000867543 | 208 |
| 487 | 3300005441 | Ga0070700_100398899 | Ga0070700_1003988991 | 208 |
| 488 | 3300005441 | Ga0070700_100524341 | Ga0070700_1005243411 | 208 |
| 489 | 3300005455 | Ga0070663_100155717 | Ga0070663_1001557172 | 208 |
| 490 | 3300005455 | Ga0070663_100454233 | Ga0070663_1004542332 | 208 |
| 491 | 3300005455 | Ga0070663_100727416 | Ga0070663_1007274161 | 208 |
| 492 | 3300005456 | Ga0070678_100851399 | Ga0070678_1008513991 | 208 |
| 493 | 3300005466 | Ga0070685_10659685 | Ga0070685_106596851 | 208 |
| 494 | 3300005543 | Ga0070672_100296111 | Ga0070672_1002961112 | 208 |
| 495 | 3300005564 | Ga0070664_100887580 | Ga0070664_1008875802 | 208 |
| 496 | 3300005618 | Ga0068864_100578992 | Ga0068864_1005789921 | 208 |
| 497 | 3300005840 | Ga0068870_10148656 | Ga0068870_101486562 | 208 |
| 498 | 3300005844 | Ga0068862_100751223 | Ga0068862_1007512232 | 208 |
| 499 | 3300006844 | Ga0075428_100270149 | Ga0075428_1002701494 | 208 |
| 500 | 3300006846 | Ga0075430_100643311 | Ga0075430_1006433111 | 208 |
| 501 | 3300006881 | Ga0068865_100176344 | Ga0068865_1001763442 | 208 |
| 502 | 3300006881 | Ga0068865_100451848 | Ga0068865_1004518482 | 208 |
| 503 | 3300009094 | Ga0111539_10452347 | Ga0111539_104523471 | 208 |
| 504 | 3300009098 | Ga0105245_10428424 | Ga0105245_104284242 | 208 |
| 505 | 3300009098 | Ga0105245_10971753 | Ga0105245_109717532 | 208 |
| 506 | 3300009148 | Ga0105243_10176386 | Ga0105243_101763862 | 208 |
| 507 | 3300009148 | Ga0105243_10332514 | Ga0105243_103325143 | 208 |
| 508 | 3300009176 | Ga0105242_10147952 | Ga0105242_101479522 | 208 |
| 509 | 3300009177 | Ga0105248_11196681 | Ga0105248_111966812 | 208 |
| 510 | 3300011119 | Ga0105246_10014422 | Ga0105246_100144226 | 208 |
| 511 | 3300013102 | Ga0157371_10380500 | Ga0157371_103805002 | 208 |
| 512 | 3300013307 | Ga0157372_10956285 | Ga0157372_109562851 | 208 |
| 513 | 3300013307 | Ga0157372_11108375 | Ga0157372_111083751 | 208 |
| 514 | 3300014326 | Ga0157380_10085337 | Ga0157380_100853373 | 208 |
| 515 | 3300014326 | Ga0157380_10670096 | Ga0157380_106700962 | 208 |
| 516 | 3300014745 | Ga0157377_10248350 | Ga0157377_102483502 | 208 |
| 517 | 3300020082 | Ga0206353_10040438 | Ga0206353_100404381 | 208 |
| 518 | 3300025302 | Ga0207426_1063918 | Ga0207426_10639181 | 208 |
| 519 | 3300025901 | Ga0207688_10064990 | Ga0207688_100649901 | 208 |
| 520 | 3300025901 | Ga0207688_10136134 | Ga0207688_101361341 | 208 |
| 521 | 3300025908 | Ga0207643_10155517 | Ga0207643_101555172 | 208 |
| 522 | 3300025909 | Ga0207705_10703566 | Ga0207705_107035662 | 208 |
| 523 | 3300025926 | Ga0207659_10387774 | Ga0207659_103877742 | 208 |
| 524 | 3300025932 | Ga0207690_10180030 | Ga0207690_101800301 | 208 |
| 525 | 3300025932 | Ga0207690_10357747 | Ga0207690_103577472 | 208 |
| 526 | 3300025935 | Ga0207709_10222135 | Ga0207709_102221352 | 208 |
| 527 | 3300025938 | Ga0207704_10056371 | Ga0207704_100563711 | 208 |
| 528 | 3300025940 | Ga0207691_10055577 | Ga0207691_100555775 | 208 |
| 529 | 3300025942 | Ga0207689_10544157 | Ga0207689_105441571 | 208 |
| 530 | 3300025944 | Ga0207661_10280979 | Ga0207661_102809793 | 208 |
| 531 | 3300025961 | Ga0207712_10541226 | Ga0207712_105412262 | 208 |
| 532 | 3300025981 | Ga0207640_10664420 | Ga0207640_106644201 | 208 |
| 533 | 3300026067 | Ga0207678_10629110 | Ga0207678_106291101 | 208 |
| 534 | 3300026075 | Ga0207708_10005162 | Ga0207708_100051625 | 208 |
| 535 | 3300026075 | Ga0207708_10727776 | Ga0207708_107277761 | 208 |
| 536 | 3300026088 | Ga0207641_10553856 | Ga0207641_105538563 | 208 |
| 537 | 3300026095 | Ga0207676_10877763 | Ga0207676_108777631 | 208 |
| 538 | 3300026116 | Ga0207674_10202355 | Ga0207674_102023553 | 208 |
| 539 | 3300026118 | Ga0207675_100015696 | Ga0207675_1000156966 | 208 |
| 540 | 3300026121 | Ga0207683_10262839 | Ga0207683_102628392 | 208 |
| 541 | 3300027907 | Ga0207428_10702290 | Ga0207428_107022901 | 208 |
| 542 | 3300031824 | Ga0307413_10710076 | Ga0307413_107100761 | 208 |
| 543 | 3300031901 | Ga0307406_10405643 | Ga0307406_104056432 | 208 |
| 544 | 3300031995 | Ga0307409_100819990 | Ga0307409_1008199901 | 208 |
| 545 | 3300031995 | Ga0307409_100990799 | Ga0307409_1009907991 | 208 |
| 546 | 3300037312 | Ga0395899_0327697 | Ga0395899_0327697_12_638 | 208 |
| 547 | 3300037418 | Ga0395900_0302661 | Ga0395900_0302661_223_849 | 208 |
| 548 | 3300037466 | Ga0395898_0186602 | Ga0395898_0186602_938_1564 | 208 |
| 549 | 3300038443 | Ga0395901_0616775 | Ga0395901_0616775_291_917 | 208 |
| 550 | 3300041413 | Ga0439465_0109927 | Ga0439465_0109927_75_722 | 208 |
| 551 | 3300041451 | Ga0451791_0826655 | Ga0451791_0826655_455_1102 | 208 |
| 552 | 3300042012 | Ga0439455_0061488 | Ga0439455_0061488_264_890 | 208 |
| 553 | 3300044694 | Ga0466963_0011045 | Ga0466963_0011045_1460_2107 | 208 |
| 554 | 3300044694 | Ga0466963_0039090 | Ga0466963_0039090_2232_2879 | 208 |
| 555 | 3300044694 | Ga0466963_0421809 | Ga0466963_0421809_253_891 | 208 |
| 556 | 3300044706 | Ga0466964_0370946 | Ga0466964_0370946_15_653 | 208 |
| 557 | 3300044719 | Ga0466971_0245140 | Ga0466971_0245140_156_782 | 208 |
| 558 | 3300045836 | Ga0466958_0281187 | Ga0466958_0281187_285_923 | 208 |
| 559 | 3300045836 | Ga0466958_0444356 | Ga0466958_0444356_71_709 | 208 |
| 560 | 3300045976 | Ga0466967_0068655 | Ga0466967_0068655_2466_3137 | 208 |
| 561 | 3300045976 | Ga0466967_0078873 | Ga0466967_0078873_529_1155 | 208 |
| 562 | 3300048911 | Ga0496108_0322553 | Ga0496108_0322553_499_1137 | 208 |
| 563 | 3300048912 | Ga0496109_0157028 | Ga0496109_0157028_398_1036 | 208 |
| 564 | 3300048912 | Ga0496109_0665515 | Ga0496109_0665515_229_876 | 208 |
| 565 | 3300048913 | Ga0496110_0207829 | Ga0496110_0207829_316_954 | 208 |
| 566 | 3300048913 | Ga0496110_0277247 | Ga0496110_0277247_784_1470 | 208 |
| 567 | 3300048914 | Ga0496111_0416724 | Ga0496111_0416724_249_887 | 208 |
| 568 | 3300049568 | Ga0501031_0092557 | Ga0501031_0092557_1163_1810 | 208 |
| 569 | 3300049569 | Ga0501032_0380301 | Ga0501032_0380301_123_770 | 208 |
| 570 | 3300049572 | Ga0501036_0235418 | Ga0501036_0235418_646_1293 | 208 |
| 571 | 3300049575 | Ga0501039_0275594 | Ga0501039_0275594_218_865 | 208 |
| 572 | 3300049582 | Ga0501048_0199816 | Ga0501048_0199816_241_888 | 208 |
| 573 | 3300049591 | Ga0501075_0612353 | Ga0501075_0612353_122_769 | 208 |
| 574 | 3300049741 | Ga0501079_0571068 | Ga0501079_0571068_53_700 | 208 |
| 575 | 3300050490 | nmdc:mga03n38_320066_c1 | nmdc:mga03n38_320066_c1_13_660 | 208 |
| 576 | 3300050509 | nmdc:mga0qj67_535484_c1 | nmdc:mga0qj67_535484_c1_295_921 | 208 |
| 577 | 3300050511 | nmdc:mga08y16_522702_c1 | nmdc:mga08y16_522702_c1_281_928 | 208 |
| 578 | 3300053153 | Ga0500616_0092395 | Ga0500616_0092395_555_1202 | 208 |
| 579 | 3300054114 | Ga0501084_0313060 | Ga0501084_0313060_221_868 | 208 |
| 580 | 3300061719 | Ga0466962_0114853 | Ga0466962_0114853_180_818 | 208 |
| 581 | 3300003203 | JGI25406J46586_10022910 | JGI25406J46586_100229102 | 209 |
| 582 | 3300005334 | Ga0068869_100552244 | Ga0068869_1005522441 | 209 |
| 583 | 3300005343 | Ga0070687_100102398 | Ga0070687_1001023981 | 209 |
| 584 | 3300005345 | Ga0070692_10170693 | Ga0070692_101706931 | 209 |
| 585 | 3300005354 | Ga0070675_100547907 | Ga0070675_1005479071 | 209 |
| 586 | 3300005457 | Ga0070662_100783515 | Ga0070662_1007835151 | 209 |
| 587 | 3300005459 | Ga0068867_100162593 | Ga0068867_1001625934 | 209 |
| 588 | 3300005535 | Ga0070684_100365237 | Ga0070684_1003652373 | 209 |
| 589 | 3300005544 | Ga0070686_100383467 | Ga0070686_1003834672 | 209 |
| 590 | 3300005547 | Ga0070693_100693577 | Ga0070693_1006935771 | 209 |
| 591 | 3300005564 | Ga0070664_100406439 | Ga0070664_1004064392 | 209 |
| 592 | 3300005578 | Ga0068854_100538525 | Ga0068854_1005385252 | 209 |
| 593 | 3300005615 | Ga0070702_100014714 | Ga0070702_1000147146 | 209 |
| 594 | 3300005842 | Ga0068858_100124880 | Ga0068858_1001248803 | 209 |
| 595 | 3300005843 | Ga0068860_100404654 | Ga0068860_1004046541 | 209 |
| 596 | 3300005937 | Ga0081455_10260596 | Ga0081455_102605963 | 209 |
| 597 | 3300005937 | Ga0081455_10399826 | Ga0081455_103998262 | 209 |
| 598 | 3300005937 | Ga0081455_10504441 | Ga0081455_105044411 | 209 |
| 599 | 3300005981 | Ga0081538_10009204 | Ga0081538_1000920410 | 209 |
| 600 | 3300005981 | Ga0081538_10026242 | Ga0081538_100262422 | 209 |
| 601 | 3300005981 | Ga0081538_10038336 | Ga0081538_100383364 | 209 |
| 602 | 3300005981 | Ga0081538_10046914 | Ga0081538_100469144 | 209 |
| 603 | 3300005981 | Ga0081538_10118593 | Ga0081538_101185933 | 209 |
| 604 | 3300005985 | Ga0081539_10001687 | Ga0081539_1000168714 | 209 |
| 605 | 3300006237 | Ga0097621_100428292 | Ga0097621_1004282922 | 209 |
| 606 | 3300006844 | Ga0075428_100177887 | Ga0075428_1001778873 | 209 |
| 607 | 3300006847 | Ga0075431_100264317 | Ga0075431_1002643173 | 209 |
| 608 | 3300006880 | Ga0075429_100161931 | Ga0075429_1001619312 | 209 |
| 609 | 3300006881 | Ga0068865_100638369 | Ga0068865_1006383692 | 209 |
| 610 | 3300009094 | Ga0111539_10012696 | Ga0111539_100126968 | 209 |
| 611 | 3300009094 | Ga0111539_10259862 | Ga0111539_102598622 | 209 |
| 612 | 3300009098 | Ga0105245_10021731 | Ga0105245_100217313 | 209 |
| 613 | 3300009101 | Ga0105247_10402854 | Ga0105247_104028541 | 209 |
| 614 | 3300009147 | Ga0114129_10407242 | Ga0114129_104072424 | 209 |
| 615 | 3300009148 | Ga0105243_10005399 | Ga0105243_1000539910 | 209 |
| 616 | 3300009551 | Ga0105238_10376870 | Ga0105238_103768703 | 209 |
| 617 | 3300010375 | Ga0105239_10067690 | Ga0105239_100676902 | 209 |
| 618 | 3300014326 | Ga0157380_10371372 | Ga0157380_103713722 | 209 |
| 619 | 3300014326 | Ga0157380_10661150 | Ga0157380_106611502 | 209 |
| 620 | 3300025899 | Ga0207642_10182666 | Ga0207642_101826662 | 209 |
| 621 | 3300025918 | Ga0207662_10080553 | Ga0207662_100805534 | 209 |
| 622 | 3300025926 | Ga0207659_10836321 | Ga0207659_108363211 | 209 |
| 623 | 3300025935 | Ga0207709_10551444 | Ga0207709_105514441 | 209 |
| 624 | 3300025937 | Ga0207669_10454335 | Ga0207669_104543352 | 209 |
| 625 | 3300025941 | Ga0207711_11178525 | Ga0207711_111785251 | 209 |
| 626 | 3300026035 | Ga0207703_10041174 | Ga0207703_100411746 | 209 |
| 627 | 3300026041 | Ga0207639_10221163 | Ga0207639_102211631 | 209 |
| 628 | 3300026075 | Ga0207708_10142585 | Ga0207708_101425852 | 209 |
| 629 | 3300026075 | Ga0207708_10241103 | Ga0207708_102411031 | 209 |
| 630 | 3300026089 | Ga0207648_10038255 | Ga0207648_100382554 | 209 |
| 631 | 3300026089 | Ga0207648_10350984 | Ga0207648_103509841 | 209 |
| 632 | 3300026089 | Ga0207648_10385060 | Ga0207648_103850603 | 209 |
| 633 | 3300026118 | Ga0207675_100477876 | Ga0207675_1004778761 | 209 |
| 634 | 3300027907 | Ga0207428_10052037 | Ga0207428_100520375 | 209 |
| 635 | 3300028381 | Ga0268264_10241393 | Ga0268264_102413933 | 209 |
| 636 | 3300031548 | Ga0307408_100495597 | Ga0307408_1004955972 | 209 |
| 637 | 3300031731 | Ga0307405_10153382 | Ga0307405_101533821 | 209 |
| 638 | 3300031824 | Ga0307413_10013249 | Ga0307413_100132492 | 209 |
| 639 | 3300031852 | Ga0307410_10174821 | Ga0307410_101748214 | 209 |
| 640 | 3300031901 | Ga0307406_10282829 | Ga0307406_102828293 | 209 |
| 641 | 3300031901 | Ga0307406_10503654 | Ga0307406_105036542 | 209 |
| 642 | 3300031903 | Ga0307407_10544173 | Ga0307407_105441731 | 209 |
| 643 | 3300031911 | Ga0307412_10179783 | Ga0307412_101797834 | 209 |
| 644 | 3300031995 | Ga0307409_100094495 | Ga0307409_1000944952 | 209 |
| 645 | 3300031995 | Ga0307409_100259353 | Ga0307409_1002593533 | 209 |
| 646 | 3300031995 | Ga0307409_100419598 | Ga0307409_1004195983 | 209 |
| 647 | 3300031995 | Ga0307409_100457229 | Ga0307409_1004572292 | 209 |
| 648 | 3300032002 | Ga0307416_100017740 | Ga0307416_1000177404 | 209 |
| 649 | 3300032002 | Ga0307416_100680469 | Ga0307416_1006804692 | 209 |
| 650 | 3300032002 | Ga0307416_100926476 | Ga0307416_1009264761 | 209 |
| 651 | 3300032002 | Ga0307416_100984077 | Ga0307416_1009840771 | 209 |
| 652 | 3300032004 | Ga0307414_10257881 | Ga0307414_102578812 | 209 |
| 653 | 3300032005 | Ga0307411_10147661 | Ga0307411_101476613 | 209 |
| 654 | 3300032005 | Ga0307411_10244975 | Ga0307411_102449753 | 209 |
| 655 | 3300032005 | Ga0307411_10298342 | Ga0307411_102983421 | 209 |
| 656 | 3300032126 | Ga0307415_100351567 | Ga0307415_1003515671 | 209 |
| 657 | 3300032126 | Ga0307415_100472513 | Ga0307415_1004725133 | 209 |
| 658 | 3300032126 | Ga0307415_101159718 | Ga0307415_1011597181 | 209 |
| 659 | 3300037466 | Ga0395898_1031209 | Ga0395898_1031209_82_711 | 209 |
| 660 | 3300038443 | Ga0395901_0355299 | Ga0395901_0355299_311_940 | 209 |
| 661 | 3300048905 | Ga0496102_0216516 | Ga0496102_0216516_955_1617 | 209 |
| 662 | 3300048906 | Ga0496103_0540549 | Ga0496103_0540549_55_684 | 209 |
| 663 | 3300048909 | Ga0496106_0155065 | Ga0496106_0155065_874_1503 | 209 |
| 664 | 3300048909 | Ga0496106_0327433 | Ga0496106_0327433_261_890 | 209 |
| 665 | 3300048911 | Ga0496108_0455763 | Ga0496108_0455763_233_862 | 209 |
| 666 | 3300048913 | Ga0496110_0168239 | Ga0496110_0168239_1309_1938 | 209 |
| 667 | 3300049569 | Ga0501032_0287849 | Ga0501032_0287849_196_825 | 209 |
| 668 | 3300049570 | Ga0501033_0040646 | Ga0501033_0040646_61_690 | 209 |
| 669 | 3300049575 | Ga0501039_0281060 | Ga0501039_0281060_619_1248 | 209 |
| 670 | 3300049576 | Ga0501040_0385638 | Ga0501040_0385638_118_747 | 209 |
| 671 | 3300049576 | Ga0501040_0604206 | Ga0501040_0604206_85_714 | 209 |
| 672 | 3300049577 | Ga0501041_0199415 | Ga0501041_0199415_64_693 | 209 |
| 673 | 3300049578 | Ga0501042_0220039 | Ga0501042_0220039_719_1348 | 209 |
| 674 | 3300049587 | Ga0501071_0073591 | Ga0501071_0073591_1692_2321 | 209 |
| 675 | 3300049588 | Ga0501072_0097212 | Ga0501072_0097212_1688_2317 | 209 |
| 676 | 3300049589 | Ga0501073_0179394 | Ga0501073_0179394_359_988 | 209 |
| 677 | 3300049590 | Ga0501074_0073661 | Ga0501074_0073661_1587_2216 | 209 |
| 678 | 3300049591 | Ga0501075_0124843 | Ga0501075_0124843_734_1363 | 209 |
| 679 | 3300049591 | Ga0501075_0379667 | Ga0501075_0379667_206_835 | 209 |
| 680 | 3300049741 | Ga0501079_0457370 | Ga0501079_0457370_315_944 | 209 |
| 681 | 3300049743 | Ga0501081_0491075 | Ga0501081_0491075_145_774 | 209 |
| 682 | 3300049743 | Ga0501081_0648556 | Ga0501081_0648556_74_703 | 209 |
| 683 | 3300049823 | Ga0501044_0757052 | Ga0501044_0757052_132_761 | 209 |
| 684 | 3300049824 | Ga0501045_0176475 | Ga0501045_0176475_214_843 | 209 |
| 685 | 3300050507 | nmdc:mga05p37_236328_c1 | nmdc:mga05p37_236328_c1_520_1149 | 209 |
| 686 | 3300050511 | nmdc:mga08y16_227452_c1 | nmdc:mga08y16_227452_c1_152_823 | 209 |
| 687 | 3300054114 | Ga0501084_0041736 | Ga0501084_0041736_2947_3576 | 209 |
| 688 | 3300054114 | Ga0501084_0080679 | Ga0501084_0080679_2053_2682 | 209 |
| 689 | 3300059424 | Ga0590075_073568 | Ga0590075_073568_241_870 | 209 |
| 690 | 3300061734 | Ga0530510_0409042 | Ga0530510_0409042_153_782 | 209 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3or2-assembly1.cif.gz_F | crystal structure of dissimilatory sulfite reductase ii (dsrii) | 0.9478 | 7 | 40 |
| 2v4j-assembly1.cif.gz_F | the crystal structure of desulfovibrio vulgaris dissimilatory sulfite reductase bound to dsrc provides novel insights into the mechanism of sulfate respiration | 0.934 | 6 | 39 |
| 3or1-assembly1.cif.gz_F | crystal structure of dissimilatory sulfite reductase i (dsri) | 0.93 | 8 | 41 |
| 1lea-assembly1.cif.gz_A | solution structure of the lexa repressor dna binding determined by 1h nmr spectroscopy | 0.9269 | 5 | 73 |
| 6a2s-assembly1.cif.gz_C | mycobacterium tuberculosis lexa c-domain s160a | 0.9208 | 125 | 208 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1jhhA02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9657 | 5 | 73 | 1.10.10.10 |
| 3k2zA01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9646 | 6 | 71 | 1.10.10.10 |
| 1jhhA02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9524 | 5 | 73 | 1.10.10.10 |
| 2v4jF02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;DsrC protein, C-terminal domain | 0.952 | 7 | 39 | 1.10.10.370 |
| 3k2zA01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9499 | 6 | 71 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A645J882-F1-model_v4 | LexA repressor (EC 3.4.21.88) | 0.9953 | 126 | 208 |
GO:0003677
GO:0004252 |
| AF-A0A1F9WZS5-F1-model_v4 | Peptidase S24/S26A/S26B/S26C domain-containing protein | 0.9938 | 124 | 209 |
GO:0003677
GO:0006281 GO:0006355 GO:0009432 GO:0016787 |
| AF-A0A355NLK5-F1-model_v4 | deleted | 0.9904 | 124 | 209 |
|
| AF-A0A1Q7AEQ7-F1-model_v4 | Peptidase S24/S26A/S26B/S26C domain-containing protein | 0.9853 | 124 | 209 |
GO:0003677
GO:0006281 GO:0006355 GO:0009432 GO:0016787 |
| AF-A0A4Q5VSI2-F1-model_v4 | deleted | 0.982 | 124 | 208 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar