F475399
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 689 | 236 | 1378 | 139 |
Family's Representative Sequence
| Representative Sequence | 3300035083|Ga0373926_0198805|Ga0373926_0198805_164_643 |
| Length | 159 |
| Sequence | MRPRIRRADDLEAYSFGMSAWVAWAIVAVLLAVGEIFTPGLFFLGPIAVAAVVAMLVAALHGPLWAQILAFGLGSFAAVGVLRPIARAHLAMPRAIRTGAAALEGARAIVLQRVDGRGGRVKIGGEEWSARSYAPDEAFDVGDEVEVAQIEGATALVYR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 2 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 3 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 32 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 35 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 37 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 38 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 40 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 41 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 42 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 48 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 49 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 50 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 66 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 69 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 70 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 71 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 72 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 73 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 106 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 107 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 108 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 109 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 110 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 111 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 112 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 113 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 114 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 115 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 116 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 117 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 118 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 119 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 120 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 121 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 122 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 123 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 124 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 125 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 126 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 127 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 128 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 129 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 130 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 131 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 132 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 133 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 134 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 135 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 136 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 137 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 138 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 139 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 140 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 141 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 142 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 143 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 144 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 145 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 146 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 147 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 148 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 149 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 211 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 212 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 213 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 214 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 215 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 216 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 217 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 218 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 219 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 220 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 221 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 222 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 223 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 224 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 225 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 226 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 227 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 228 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 230 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 231 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 236 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.84 |
| Metatranscriptomes | 1.16 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 6.97 |
| Rhizosphere | 92.6 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.55 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0373926_0198805 | 3300035083 | Bacteria | 771 |
| 2 | rootH2_10102618 | 3300003320 | Bacteria | 2270 |
| 3 | rootH1_10330892 | 3300003323 | Bacteria | 1103 |
| 4 | Ga0070658_10020812 | 3300005327 | Bacteria | 5256 |
| 5 | Ga0070658_10024238 | 3300005327 | Bacteria | 4868 |
| 6 | Ga0070658_10223413 | 3300005327 | Bacteria | 1593 |
| 7 | Ga0070658_10682198 | 3300005327 | Bacteria | 892 |
| 8 | Ga0070683_100037324 | 3300005329 | Bacteria | 4447 |
| 9 | Ga0070683_100662376 | 3300005329 | Bacteria | 999 |
| 10 | Ga0070683_101064958 | 3300005329 | Unclassified | 776 |
| 11 | Ga0070680_100047746 | 3300005336 | Bacteria | 3486 |
| 12 | Ga0070680_100233850 | 3300005336 | Bacteria | 1552 |
| 13 | Ga0070680_100270899 | 3300005336 | Bacteria | 1437 |
| 14 | Ga0070680_100362957 | 3300005336 | Bacteria | 1232 |
| 15 | Ga0070680_100946550 | 3300005336 | Bacteria | 743 |
| 16 | Ga0070682_100051228 | 3300005337 | Bacteria | 2580 |
| 17 | Ga0068868_101632930 | 3300005338 | Bacteria | 606 |
| 18 | Ga0070660_100013664 | 3300005339 | Bacteria | 5835 |
| 19 | Ga0070660_100022591 | 3300005339 | Bacteria | 4653 |
| 20 | Ga0070660_100163698 | 3300005339 | Bacteria | 1793 |
| 21 | Ga0070660_100380739 | 3300005339 | Bacteria | 1165 |
| 22 | Ga0070687_100769562 | 3300005343 | Unclassified | 679 |
| 23 | Ga0070687_100841643 | 3300005343 | Unclassified | 653 |
| 24 | Ga0070661_100021907 | 3300005344 | Bacteria | 4570 |
| 25 | Ga0070661_100223904 | 3300005344 | Bacteria | 1444 |
| 26 | Ga0070661_100279029 | 3300005344 | Bacteria | 1296 |
| 27 | Ga0070661_100803940 | 3300005344 | Bacteria | 772 |
| 28 | Ga0070675_100796423 | 3300005354 | Bacteria | 864 |
| 29 | Ga0070671_100144776 | 3300005355 | Bacteria | 2006 |
| 30 | Ga0070673_100751640 | 3300005364 | Bacteria | 898 |
| 31 | Ga0070659_100408312 | 3300005366 | Bacteria | 1147 |
| 32 | Ga0070659_100797380 | 3300005366 | Bacteria | 821 |
| 33 | Ga0070659_101083692 | 3300005366 | Bacteria | 706 |
| 34 | Ga0070709_10037851 | 3300005434 | Bacteria | 2949 |
| 35 | Ga0070714_100047431 | 3300005435 | Bacteria | 3649 |
| 36 | Ga0070714_100055003 | 3300005435 | Bacteria | 3401 |
| 37 | Ga0070714_100079377 | 3300005435 | Bacteria | 2853 |
| 38 | Ga0070714_100540249 | 3300005435 | Bacteria | 1115 |
| 39 | Ga0070714_100934397 | 3300005435 | Bacteria | 843 |
| 40 | Ga0070713_100001098 | 3300005436 | Bacteria | 17278 |
| 41 | Ga0070713_100038848 | 3300005436 | Bacteria | 3860 |
| 42 | Ga0070713_100112482 | 3300005436 | Bacteria | 2376 |
| 43 | Ga0070713_100467599 | 3300005436 | Bacteria | 1186 |
| 44 | Ga0070713_101470060 | 3300005436 | Unclassified | 661 |
| 45 | Ga0070710_10005679 | 3300005437 | Bacteria | 5939 |
| 46 | Ga0070711_100114021 | 3300005439 | Bacteria | 1988 |
| 47 | Ga0070711_100494180 | 3300005439 | Bacteria | 1008 |
| 48 | Ga0070705_100432332 | 3300005440 | Unclassified | 983 |
| 49 | Ga0070705_100602689 | 3300005440 | Bacteria | 850 |
| 50 | Ga0070694_100261426 | 3300005444 | Bacteria | 1313 |
| 51 | Ga0070708_100418405 | 3300005445 | Bacteria | 1264 |
| 52 | Ga0070678_100657970 | 3300005456 | Unclassified | 940 |
| 53 | Ga0070678_100807509 | 3300005456 | Bacteria | 852 |
| 54 | Ga0070681_10058674 | 3300005458 | Bacteria | 3828 |
| 55 | Ga0070681_10076414 | 3300005458 | Bacteria | 3308 |
| 56 | Ga0070681_10156343 | 3300005458 | Bacteria | 2205 |
| 57 | Ga0070681_10266504 | 3300005458 | Bacteria | 1624 |
| 58 | Ga0070681_10276490 | 3300005458 | Bacteria | 1590 |
| 59 | Ga0070706_100199745 | 3300005467 | Bacteria | 1868 |
| 60 | Ga0070707_100000749 | 3300005468 | Bacteria | 32054 |
| 61 | Ga0070707_100239540 | 3300005468 | Bacteria | 1766 |
| 62 | Ga0070707_100582826 | 3300005468 | Bacteria | 1081 |
| 63 | Ga0070679_100107286 | 3300005530 | Bacteria | 2778 |
| 64 | Ga0070679_100109591 | 3300005530 | Bacteria | 2747 |
| 65 | Ga0070679_100187939 | 3300005530 | Bacteria | 2035 |
| 66 | Ga0070679_100360736 | 3300005530 | Bacteria | 1400 |
| 67 | Ga0070679_101422074 | 3300005530 | Unclassified | 640 |
| 68 | Ga0070684_100015393 | 3300005535 | Bacteria | 6229 |
| 69 | Ga0070684_101202050 | 3300005535 | Bacteria | 713 |
| 70 | Ga0070697_100262249 | 3300005536 | Bacteria | 1480 |
| 71 | Ga0068853_100761072 | 3300005539 | Bacteria | 926 |
| 72 | Ga0070693_100170367 | 3300005547 | Bacteria | 1394 |
| 73 | Ga0070693_100719065 | 3300005547 | Bacteria | 733 |
| 74 | Ga0070704_100125597 | 3300005549 | Bacteria | 1979 |
| 75 | Ga0068855_100012155 | 3300005563 | Bacteria | 10403 |
| 76 | Ga0068855_100055804 | 3300005563 | Bacteria | 4637 |
| 77 | Ga0068855_100425142 | 3300005563 | Bacteria | 1452 |
| 78 | Ga0068855_100555751 | 3300005563 | Bacteria | 1242 |
| 79 | Ga0068855_100599801 | 3300005563 | Bacteria | 1188 |
| 80 | Ga0070664_100332828 | 3300005564 | Bacteria | 1378 |
| 81 | Ga0068857_101194287 | 3300005577 | Bacteria | 736 |
| 82 | Ga0068856_100028714 | 3300005614 | Bacteria | 5434 |
| 83 | Ga0068856_100386332 | 3300005614 | Bacteria | 1419 |
| 84 | Ga0068856_100486631 | 3300005614 | Bacteria | 1255 |
| 85 | Ga0070702_100193304 | 3300005615 | Bacteria | 1341 |
| 86 | Ga0068852_100802259 | 3300005616 | Bacteria | 955 |
| 87 | Ga0068864_100240319 | 3300005618 | Bacteria | 1678 |
| 88 | Ga0068863_100820392 | 3300005841 | Bacteria | 928 |
| 89 | Ga0070717_10002024 | 3300006028 | Bacteria | 14193 |
| 90 | Ga0070717_10015901 | 3300006028 | Bacteria | 5822 |
| 91 | Ga0070717_10023413 | 3300006028 | Bacteria | 4893 |
| 92 | Ga0070717_10069595 | 3300006028 | Bacteria | 2931 |
| 93 | Ga0070717_10605362 | 3300006028 | Bacteria | 994 |
| 94 | Ga0070717_10720582 | 3300006028 | Bacteria | 906 |
| 95 | Ga0070717_11878480 | 3300006028 | Bacteria | 541 |
| 96 | Ga0070715_10025257 | 3300006163 | Bacteria | 2350 |
| 97 | Ga0070716_100000887 | 3300006173 | Bacteria | 12921 |
| 98 | Ga0070712_100182992 | 3300006175 | Bacteria | 1634 |
| 99 | Ga0070712_100341499 | 3300006175 | Bacteria | 1223 |
| 100 | Ga0070712_100596172 | 3300006175 | Bacteria | 935 |
| 101 | Ga0070712_100812502 | 3300006175 | Bacteria | 803 |
| 102 | Ga0097621_100967047 | 3300006237 | Bacteria | 795 |
| 103 | Ga0097621_101355244 | 3300006237 | Archaea | 673 |
| 104 | Ga0068871_100311003 | 3300006358 | Bacteria | 1385 |
| 105 | Ga0075436_100140323 | 3300006914 | Bacteria | 1698 |
| 106 | Ga0075435_100340065 | 3300007076 | Bacteria | 1286 |
| 107 | Ga0105240_10046296 | 3300009093 | Bacteria | 5512 |
| 108 | Ga0105240_10073083 | 3300009093 | Bacteria | 4236 |
| 109 | Ga0105245_11385877 | 3300009098 | Bacteria | 753 |
| 110 | Ga0105245_11454522 | 3300009098 | Bacteria | 736 |
| 111 | Ga0105247_10402230 | 3300009101 | Bacteria | 976 |
| 112 | Ga0114129_11740911 | 3300009147 | Unclassified | 759 |
| 113 | Ga0105248_10191422 | 3300009177 | Bacteria | 2305 |
| 114 | Ga0105248_10570969 | 3300009177 | Bacteria | 1276 |
| 115 | Ga0105248_10607134 | 3300009177 | Bacteria | 1234 |
| 116 | Ga0105237_10016749 | 3300009545 | Bacteria | 7610 |
| 117 | Ga0105237_11234745 | 3300009545 | Bacteria | 754 |
| 118 | Ga0105238_10078122 | 3300009551 | Bacteria | 3301 |
| 119 | Ga0105238_10140285 | 3300009551 | Bacteria | 2394 |
| 120 | Ga0105239_10552019 | 3300010375 | Bacteria | 1312 |
| 121 | Ga0157373_10074032 | 3300013100 | Bacteria | 2403 |
| 122 | Ga0157370_10063700 | 3300013104 | Bacteria | 3492 |
| 123 | Ga0157370_10299113 | 3300013104 | Bacteria | 1486 |
| 124 | Ga0157370_10703470 | 3300013104 | Bacteria | 922 |
| 125 | Ga0157370_11074114 | 3300013104 | Bacteria | 728 |
| 126 | Ga0157369_10031799 | 3300013105 | Bacteria | 5806 |
| 127 | Ga0157369_10086429 | 3300013105 | Bacteria | 3349 |
| 128 | Ga0157369_10233111 | 3300013105 | Bacteria | 1924 |
| 129 | Ga0157369_10318112 | 3300013105 | Bacteria | 1618 |
| 130 | Ga0157369_10406081 | 3300013105 | Bacteria | 1413 |
| 131 | Ga0157369_10765860 | 3300013105 | Bacteria | 992 |
| 132 | Ga0157369_10784107 | 3300013105 | Bacteria | 980 |
| 133 | Ga0157369_10925726 | 3300013105 | Bacteria | 893 |
| 134 | Ga0157374_10106257 | 3300013296 | Bacteria | 2697 |
| 135 | Ga0157374_12037755 | 3300013296 | Bacteria | 600 |
| 136 | Ga0157378_10647150 | 3300013297 | Bacteria | 1072 |
| 137 | Ga0157372_10014906 | 3300013307 | Bacteria | 8322 |
| 138 | Ga0157372_10144009 | 3300013307 | Bacteria | 2748 |
| 139 | Ga0157372_10598250 | 3300013307 | Bacteria | 1285 |
| 140 | Ga0157372_10684283 | 3300013307 | Bacteria | 1194 |
| 141 | Ga0157372_10812673 | 3300013307 | Bacteria | 1086 |
| 142 | Ga0157372_13247081 | 3300013307 | Bacteria | 518 |
| 143 | Ga0157375_11357620 | 3300013308 | Bacteria | 837 |
| 144 | Ga0182008_10001510 | 3300014497 | Bacteria | 15543 |
| 145 | Ga0182008_10036432 | 3300014497 | Bacteria | 2462 |
| 146 | Ga0182008_10112895 | 3300014497 | Bacteria | 1347 |
| 147 | Ga0182008_10465054 | 3300014497 | Bacteria | 690 |
| 148 | Ga0157379_10538716 | 3300014968 | Bacteria | 1085 |
| 149 | Ga0157376_10060998 | 3300014969 | Bacteria | 3169 |
| 150 | Ga0182005_1038805 | 3300015265 | Bacteria | 1295 |
| 151 | Ga0206356_10918821 | 3300020070 | Bacteria | 2312 |
| 152 | Ga0206356_11321873 | 3300020070 | Bacteria | 1437 |
| 153 | Ga0206356_11629688 | 3300020070 | Bacteria | 3706 |
| 154 | Ga0206354_10032689 | 3300020081 | Bacteria | 3434 |
| 155 | Ga0206354_10394166 | 3300020081 | Bacteria | 1374 |
| 156 | Ga0206354_11186537 | 3300020081 | Bacteria | 1709 |
| 157 | Ga0206353_10139008 | 3300020082 | Bacteria | 3987 |
| 158 | Ga0224712_10168144 | 3300022467 | Bacteria | 982 |
| 159 | Ga0207692_10065766 | 3300025898 | Bacteria | 1893 |
| 160 | Ga0207685_10010023 | 3300025905 | Bacteria | 2778 |
| 161 | Ga0207699_10061518 | 3300025906 | Bacteria | 2259 |
| 162 | Ga0207705_10032090 | 3300025909 | Bacteria | 3752 |
| 163 | Ga0207705_10796822 | 3300025909 | Bacteria | 733 |
| 164 | Ga0207705_11008113 | 3300025909 | Unclassified | 643 |
| 165 | Ga0207707_10076816 | 3300025912 | Bacteria | 2914 |
| 166 | Ga0207707_10082498 | 3300025912 | Bacteria | 2807 |
| 167 | Ga0207707_10225850 | 3300025912 | Bacteria | 1629 |
| 168 | Ga0207695_10046896 | 3300025913 | Bacteria | 4577 |
| 169 | Ga0207695_11095767 | 3300025913 | Bacteria | 676 |
| 170 | Ga0207671_11084997 | 3300025914 | Bacteria | 629 |
| 171 | Ga0207693_10019641 | 3300025915 | Bacteria | 5373 |
| 172 | Ga0207693_10349822 | 3300025915 | Bacteria | 1156 |
| 173 | Ga0207693_10375202 | 3300025915 | Bacteria | 1113 |
| 174 | Ga0207663_10016113 | 3300025916 | Bacteria | 4136 |
| 175 | Ga0207663_10732047 | 3300025916 | Bacteria | 785 |
| 176 | Ga0207660_10273698 | 3300025917 | Unclassified | 1338 |
| 177 | Ga0207660_10351902 | 3300025917 | Bacteria | 1181 |
| 178 | Ga0207660_10452986 | 3300025917 | Bacteria | 1038 |
| 179 | Ga0207657_10004929 | 3300025919 | Bacteria | 14033 |
| 180 | Ga0207657_10097708 | 3300025919 | Bacteria | 2441 |
| 181 | Ga0207657_10123158 | 3300025919 | Bacteria | 2132 |
| 182 | Ga0207649_10024250 | 3300025920 | Bacteria | 3524 |
| 183 | Ga0207652_10146954 | 3300025921 | Bacteria | 2110 |
| 184 | Ga0207652_10245244 | 3300025921 | Bacteria | 1615 |
| 185 | Ga0207652_11160340 | 3300025921 | Unclassified | 674 |
| 186 | Ga0207646_10051191 | 3300025922 | Bacteria | 3695 |
| 187 | Ga0207646_10294778 | 3300025922 | Bacteria | 1465 |
| 188 | Ga0207646_10311073 | 3300025922 | Bacteria | 1423 |
| 189 | Ga0207646_10658625 | 3300025922 | Bacteria | 938 |
| 190 | Ga0207694_10106390 | 3300025924 | Bacteria | 2228 |
| 191 | Ga0207694_10232157 | 3300025924 | Bacteria | 1507 |
| 192 | Ga0207659_10412947 | 3300025926 | Bacteria | 1131 |
| 193 | Ga0207687_10163212 | 3300025927 | Bacteria | 1712 |
| 194 | Ga0207687_10828095 | 3300025927 | Bacteria | 790 |
| 195 | Ga0207700_10015618 | 3300025928 | Bacteria | 5015 |
| 196 | Ga0207700_10069427 | 3300025928 | Bacteria | 2704 |
| 197 | Ga0207700_10087780 | 3300025928 | Bacteria | 2447 |
| 198 | Ga0207700_10355418 | 3300025928 | Bacteria | 1276 |
| 199 | Ga0207664_10206388 | 3300025929 | Bacteria | 1698 |
| 200 | Ga0207664_10295180 | 3300025929 | Bacteria | 1425 |
| 201 | Ga0207664_10413131 | 3300025929 | Bacteria | 1201 |
| 202 | Ga0207664_10469536 | 3300025929 | Bacteria | 1125 |
| 203 | Ga0207644_10211967 | 3300025931 | Bacteria | 1532 |
| 204 | Ga0207690_10470339 | 3300025932 | Bacteria | 1013 |
| 205 | Ga0207690_11036244 | 3300025932 | Bacteria | 683 |
| 206 | Ga0207665_10003486 | 3300025939 | Bacteria | 10506 |
| 207 | Ga0207665_10342029 | 3300025939 | Bacteria | 1128 |
| 208 | Ga0207665_10350411 | 3300025939 | Bacteria | 1114 |
| 209 | Ga0207665_10352007 | 3300025939 | Bacteria | 1112 |
| 210 | Ga0207665_11228422 | 3300025939 | Bacteria | 598 |
| 211 | Ga0207711_10355258 | 3300025941 | Bacteria | 1357 |
| 212 | Ga0207661_10005935 | 3300025944 | Bacteria | 8623 |
| 213 | Ga0207661_10786492 | 3300025944 | Bacteria | 876 |
| 214 | Ga0207661_10850403 | 3300025944 | Bacteria | 840 |
| 215 | Ga0207661_10896229 | 3300025944 | Unclassified | 817 |
| 216 | Ga0207679_10176440 | 3300025945 | Bacteria | 1764 |
| 217 | Ga0207667_10070333 | 3300025949 | Bacteria | 3642 |
| 218 | Ga0207667_10194909 | 3300025949 | Bacteria | 2079 |
| 219 | Ga0207667_10348441 | 3300025949 | Bacteria | 1510 |
| 220 | Ga0207667_10608581 | 3300025949 | Bacteria | 1101 |
| 221 | Ga0207667_11041758 | 3300025949 | Bacteria | 804 |
| 222 | Ga0207677_10565016 | 3300026023 | Unclassified | 993 |
| 223 | Ga0207677_10971237 | 3300026023 | Bacteria | 769 |
| 224 | Ga0207702_10281724 | 3300026078 | Bacteria | 1572 |
| 225 | Ga0207702_10468645 | 3300026078 | Bacteria | 1224 |
| 226 | Ga0207641_10691278 | 3300026088 | Bacteria | 1004 |
| 227 | Ga0207674_10240358 | 3300026116 | Bacteria | 1758 |
| 228 | Ga0207683_10480576 | 3300026121 | Unclassified | 1146 |
| 229 | Ga0207683_11660333 | 3300026121 | Bacteria | 588 |
| 230 | Ga0207698_10610562 | 3300026142 | Bacteria | 1076 |
| 231 | Ga0207698_11459740 | 3300026142 | Bacteria | 699 |
| 232 | Ga0265319_1144792 | 3300028563 | Bacteria | 736 |
| 233 | Ga0265336_10017265 | 3300028666 | Bacteria | 2351 |
| 234 | Ga0265338_10008570 | 3300028800 | Bacteria | 12374 |
| 235 | Ga0265338_10019203 | 3300028800 | Bacteria | 7272 |
| 236 | Ga0265338_10051027 | 3300028800 | Bacteria | 3731 |
| 237 | Ga0265338_10302319 | 3300028800 | Bacteria | 1163 |
| 238 | Ga0265324_10193044 | 3300029957 | Unclassified | 691 |
| 239 | Ga0265332_10275023 | 3300031238 | Bacteria | 696 |
| 240 | Ga0265327_10011835 | 3300031251 | Bacteria | 5960 |
| 241 | Ga0316583_10044800 | 3300032133 | Bacteria | 1563 |
| 242 | Ga0373928_0129067 | 3300035084 | Bacteria | 684 |
| 243 | Ga0373939_0066060 | 3300035114 | Bacteria | 1165 |
| 244 | Ga0373939_0087041 | 3300035114 | Bacteria | 1049 |
| 245 | Ga0373945_0286878 | 3300035116 | Bacteria | 702 |
| 246 | Ga0373953_0486922 | 3300035117 | Archaea | 546 |
| 247 | Ga0373943_0012474 | 3300035170 | Bacteria | 3828 |
| 248 | Ga0373946_0720894 | 3300035171 | Unclassified | 522 |
| 249 | Ga0373955_0027859 | 3300035172 | Bacteria | 2925 |
| 250 | Ga0373955_0299981 | 3300035172 | Bacteria | 969 |
| 251 | Ga0373942_0159874 | 3300035207 | Bacteria | 728 |
| 252 | Ga0373931_0278433 | 3300035691 | Bacteria | 1026 |
| 253 | Ga0373931_0450488 | 3300035691 | Unclassified | 823 |
| 254 | Ga0373935_0014166 | 3300035692 | Bacteria | 4814 |
| 255 | Ga0373933_0475595 | 3300035724 | Bacteria | 818 |
| 256 | Ga0373933_0802548 | 3300035724 | Archaea | 619 |
| 257 | Ga0373947_0001659 | 3300035725 | Bacteria | 13619 |
| 258 | Ga0373947_0076234 | 3300035725 | Bacteria | 2066 |
| 259 | Ga0373947_0094937 | 3300035725 | Bacteria | 1866 |
| 260 | Ga0373937_0001461 | 3300036401 | Bacteria | 19779 |
| 261 | Ga0373937_0071898 | 3300036401 | Bacteria | 3190 |
| 262 | Ga0373937_0400011 | 3300036401 | Bacteria | 1303 |
| 263 | Ga0373937_0546746 | 3300036401 | Bacteria | 1100 |
| 264 | Ga0373925_0004134 | 3300037068 | Bacteria | 11013 |
| 265 | Ga0373925_0105362 | 3300037068 | Bacteria | 2173 |
| 266 | Ga0395899_0143795 | 3300037312 | Bacteria | 1695 |
| 267 | Ga0395899_0313430 | 3300037312 | Bacteria | 1059 |
| 268 | Ga0395900_0199836 | 3300037418 | Bacteria | 2023 |
| 269 | Ga0395900_0382662 | 3300037418 | Bacteria | 1375 |
| 270 | Ga0395900_0403616 | 3300037418 | Bacteria | 1330 |
| 271 | Ga0395900_1095733 | 3300037418 | Bacteria | 714 |
| 272 | Ga0395898_0077447 | 3300037466 | Bacteria | 3210 |
| 273 | Ga0395898_0125750 | 3300037466 | Bacteria | 2456 |
| 274 | Ga0395898_0140579 | 3300037466 | Bacteria | 2311 |
| 275 | Ga0395898_0164778 | 3300037466 | Bacteria | 2120 |
| 276 | Ga0395898_0208498 | 3300037466 | Bacteria | 1864 |
| 277 | Ga0395898_0667160 | 3300037466 | Bacteria | 982 |
| 278 | Ga0395898_1689027 | 3300037466 | Bacteria | 556 |
| 279 | Ga0395905_0210081 | 3300037471 | Bacteria | 1823 |
| 280 | Ga0395905_0376465 | 3300037471 | Bacteria | 1313 |
| 281 | Ga0395901_0398329 | 3300038443 | Bacteria | 1414 |
| 282 | Ga0395901_0649009 | 3300038443 | Unclassified | 1059 |
| 283 | Ga0395901_0923621 | 3300038443 | Bacteria | 853 |
| 284 | Ga0436365_1121542 | 3300039437 | Unclassified | 1014 |
| 285 | Ga0451798_0692941 | 3300041458 | Unclassified | 564 |
| 286 | Ga0466969_0000890 | 3300044656 | Bacteria | 16138 |
| 287 | Ga0466972_0063719 | 3300044658 | Bacteria | 1765 |
| 288 | Ga0466965_0034628 | 3300044683 | Bacteria | 2471 |
| 289 | Ga0466965_0040965 | 3300044683 | Bacteria | 2281 |
| 290 | Ga0466965_0142194 | 3300044683 | Bacteria | 1250 |
| 291 | Ga0466965_0169611 | 3300044683 | Bacteria | 1148 |
| 292 | Ga0466965_0227519 | 3300044683 | Bacteria | 995 |
| 293 | Ga0466965_0829355 | 3300044683 | Unclassified | 536 |
| 294 | Ga0466966_0017793 | 3300044684 | Bacteria | 4693 |
| 295 | Ga0466966_0030451 | 3300044684 | Bacteria | 3505 |
| 296 | Ga0466966_0040571 | 3300044684 | Bacteria | 2995 |
| 297 | Ga0466966_0426944 | 3300044684 | Bacteria | 797 |
| 298 | Ga0466961_0010552 | 3300044693 | Bacteria | 5893 |
| 299 | Ga0466961_0011827 | 3300044693 | Bacteria | 5579 |
| 300 | Ga0466961_0017835 | 3300044693 | Bacteria | 4562 |
| 301 | Ga0466961_0095692 | 3300044693 | Bacteria | 1872 |
| 302 | Ga0466961_0465083 | 3300044693 | Bacteria | 765 |
| 303 | Ga0466963_0000400 | 3300044694 | Bacteria | 19783 |
| 304 | Ga0466963_0000752 | 3300044694 | Bacteria | 16002 |
| 305 | Ga0466963_0001579 | 3300044694 | Bacteria | 12367 |
| 306 | Ga0466963_0001838 | 3300044694 | Bacteria | 11561 |
| 307 | Ga0466963_0009192 | 3300044694 | Bacteria | 5945 |
| 308 | Ga0466963_0025676 | 3300044694 | Bacteria | 3759 |
| 309 | Ga0466963_0036619 | 3300044694 | Bacteria | 3200 |
| 310 | Ga0466963_0055517 | 3300044694 | Bacteria | 2634 |
| 311 | Ga0466963_0073328 | 3300044694 | Bacteria | 2307 |
| 312 | Ga0466963_0092002 | 3300044694 | Bacteria | 2066 |
| 313 | Ga0466963_0098668 | 3300044694 | Bacteria | 1997 |
| 314 | Ga0466963_0220782 | 3300044694 | Bacteria | 1327 |
| 315 | Ga0466963_0224373 | 3300044694 | Unclassified | 1316 |
| 316 | Ga0466963_0387948 | 3300044694 | Unclassified | 984 |
| 317 | Ga0466963_0708225 | 3300044694 | Bacteria | 710 |
| 318 | Ga0466963_1009848 | 3300044694 | Unclassified | 586 |
| 319 | Ga0466964_0007546 | 3300044706 | Bacteria | 4070 |
| 320 | Ga0466964_0014477 | 3300044706 | Bacteria | 3001 |
| 321 | Ga0466964_0022215 | 3300044706 | Bacteria | 2459 |
| 322 | Ga0466964_0022665 | 3300044706 | Bacteria | 2438 |
| 323 | Ga0466964_0023928 | 3300044706 | Bacteria | 2377 |
| 324 | Ga0466964_0029757 | 3300044706 | Bacteria | 2158 |
| 325 | Ga0466964_0035173 | 3300044706 | Bacteria | 2002 |
| 326 | Ga0466964_0036973 | 3300044706 | Bacteria | 1959 |
| 327 | Ga0466964_0188535 | 3300044706 | Bacteria | 982 |
| 328 | Ga0466964_0691638 | 3300044706 | Unclassified | 568 |
| 329 | Ga0466971_0000403 | 3300044719 | Bacteria | 16785 |
| 330 | Ga0466971_0011932 | 3300044719 | Bacteria | 3806 |
| 331 | Ga0466971_0038001 | 3300044719 | Bacteria | 2159 |
| 332 | Ga0466971_0138253 | 3300044719 | Unclassified | 1134 |
| 333 | Ga0466971_0139296 | 3300044719 | Bacteria | 1129 |
| 334 | Ga0466971_0201572 | 3300044719 | Bacteria | 939 |
| 335 | Ga0466968_0005768 | 3300044735 | Bacteria | 4645 |
| 336 | Ga0466968_0050114 | 3300044735 | Unclassified | 1780 |
| 337 | Ga0466968_0100610 | 3300044735 | Bacteria | 1290 |
| 338 | Ga0466968_0573941 | 3300044735 | Unclassified | 567 |
| 339 | Ga0466970_0008974 | 3300044765 | Bacteria | 5042 |
| 340 | Ga0466957_0002539 | 3300044842 | Bacteria | 9820 |
| 341 | Ga0466957_0003504 | 3300044842 | Bacteria | 8625 |
| 342 | Ga0466957_0005656 | 3300044842 | Bacteria | 7031 |
| 343 | Ga0466957_0005906 | 3300044842 | Bacteria | 6904 |
| 344 | Ga0466957_0159900 | 3300044842 | Bacteria | 1462 |
| 345 | Ga0466957_0178698 | 3300044842 | Bacteria | 1385 |
| 346 | Ga0466957_0280054 | 3300044842 | Bacteria | 1116 |
| 347 | Ga0466957_0421861 | 3300044842 | Bacteria | 915 |
| 348 | Ga0466957_0732671 | 3300044842 | Unclassified | 699 |
| 349 | Ga0466957_0858179 | 3300044842 | Bacteria | 647 |
| 350 | Ga0466960_0003437 | 3300044901 | Bacteria | 6090 |
| 351 | Ga0466960_0057963 | 3300044901 | Bacteria | 1890 |
| 352 | Ga0466960_0083460 | 3300044901 | Bacteria | 1615 |
| 353 | Ga0466960_0264975 | 3300044901 | Unclassified | 958 |
| 354 | Ga0466960_0675716 | 3300044901 | Unclassified | 618 |
| 355 | Ga0466960_0743505 | 3300044901 | Bacteria | 591 |
| 356 | Ga0466960_0855043 | 3300044901 | Bacteria | 553 |
| 357 | Ga0466959_0005205 | 3300045049 | Bacteria | 8873 |
| 358 | Ga0466959_0016473 | 3300045049 | Bacteria | 5401 |
| 359 | Ga0466959_0016759 | 3300045049 | Bacteria | 5361 |
| 360 | Ga0466959_0159827 | 3300045049 | Bacteria | 1584 |
| 361 | Ga0466959_0407165 | 3300045049 | Bacteria | 924 |
| 362 | Ga0451576_0161694 | 3300045051 | Bacteria | 2337 |
| 363 | Ga0466958_0006781 | 3300045836 | Bacteria | 6257 |
| 364 | Ga0466958_0017282 | 3300045836 | Bacteria | 4166 |
| 365 | Ga0466958_0019839 | 3300045836 | Bacteria | 3915 |
| 366 | Ga0466958_0022539 | 3300045836 | Bacteria | 3690 |
| 367 | Ga0466958_0026013 | 3300045836 | Bacteria | 3456 |
| 368 | Ga0466958_0036519 | 3300045836 | Bacteria | 2941 |
| 369 | Ga0466958_0283849 | 3300045836 | Bacteria | 1061 |
| 370 | Ga0466958_0294616 | 3300045836 | Bacteria | 1041 |
| 371 | Ga0466958_0610146 | 3300045836 | Bacteria | 710 |
| 372 | Ga0466958_0922081 | 3300045836 | Unclassified | 570 |
| 373 | Ga0466967_0002083 | 3300045976 | Bacteria | 12245 |
| 374 | Ga0466967_0002624 | 3300045976 | Bacteria | 11319 |
| 375 | Ga0466967_0006488 | 3300045976 | Bacteria | 8287 |
| 376 | Ga0466967_0013645 | 3300045976 | Bacteria | 6289 |
| 377 | Ga0466967_0020338 | 3300045976 | Bacteria | 5362 |
| 378 | Ga0466967_0028937 | 3300045976 | Bacteria | 4631 |
| 379 | Ga0466967_0046838 | 3300045976 | Bacteria | 3767 |
| 380 | Ga0466967_0049447 | 3300045976 | Bacteria | 3677 |
| 381 | Ga0466967_0093129 | 3300045976 | Bacteria | 2741 |
| 382 | Ga0466967_0138925 | 3300045976 | Bacteria | 2261 |
| 383 | Ga0466967_0184132 | 3300045976 | Bacteria | 1971 |
| 384 | Ga0466967_0286914 | 3300045976 | Bacteria | 1580 |
| 385 | Ga0466967_0295619 | 3300045976 | Bacteria | 1557 |
| 386 | Ga0466967_0305849 | 3300045976 | Bacteria | 1530 |
| 387 | Ga0466967_0318083 | 3300045976 | Bacteria | 1500 |
| 388 | Ga0466967_0649161 | 3300045976 | Bacteria | 1043 |
| 389 | Ga0466967_0666385 | 3300045976 | Bacteria | 1029 |
| 390 | Ga0466967_0775616 | 3300045976 | Bacteria | 951 |
| 391 | Ga0466967_1126003 | 3300045976 | Bacteria | 782 |
| 392 | Ga0466967_1911019 | 3300045976 | Unclassified | 590 |
| 393 | Ga0466967_1942291 | 3300045976 | Bacteria | 585 |
| 394 | Ga0495592_0000048 | 3300046454 | Bacteria | 114599 |
| 395 | Ga0495592_0022031 | 3300046454 | Bacteria | 4847 |
| 396 | Ga0495592_0467230 | 3300046454 | Bacteria | 788 |
| 397 | Ga0495592_0525542 | 3300046454 | Archaea | 731 |
| 398 | Ga0495603_0043954 | 3300046455 | Bacteria | 2666 |
| 399 | Ga0495603_0152654 | 3300046455 | Bacteria | 1341 |
| 400 | Ga0495629_0008464 | 3300046459 | Bacteria | 7574 |
| 401 | Ga0495629_0065317 | 3300046459 | Bacteria | 2540 |
| 402 | Ga0495629_0197220 | 3300046459 | Bacteria | 1392 |
| 403 | Ga0495629_0216850 | 3300046459 | Bacteria | 1321 |
| 404 | Ga0495629_0798218 | 3300046459 | Bacteria | 623 |
| 405 | Ga0495641_0013346 | 3300046461 | Bacteria | 4523 |
| 406 | Ga0495641_0062555 | 3300046461 | Bacteria | 1678 |
| 407 | Ga0495641_0188704 | 3300046461 | Bacteria | 923 |
| 408 | Ga0495641_0287075 | 3300046461 | Bacteria | 741 |
| 409 | Ga0495651_0000049 | 3300046462 | Bacteria | 88249 |
| 410 | Ga0495651_0021615 | 3300046462 | Bacteria | 5001 |
| 411 | Ga0495651_0023850 | 3300046462 | Bacteria | 4758 |
| 412 | Ga0495653_0000489 | 3300046463 | Bacteria | 30700 |
| 413 | Ga0495653_0018511 | 3300046463 | Bacteria | 5654 |
| 414 | Ga0495653_0078959 | 3300046463 | Bacteria | 2439 |
| 415 | Ga0495653_0090042 | 3300046463 | Bacteria | 2246 |
| 416 | Ga0495653_0415643 | 3300046463 | Bacteria | 852 |
| 417 | Ga0495653_0422280 | 3300046463 | Bacteria | 843 |
| 418 | Ga0495580_0188926 | 3300046472 | Bacteria | 1421 |
| 419 | Ga0495580_0464624 | 3300046472 | Bacteria | 848 |
| 420 | Ga0495582_0022067 | 3300046473 | Bacteria | 3482 |
| 421 | Ga0495582_0037398 | 3300046473 | Bacteria | 2669 |
| 422 | Ga0495582_0089540 | 3300046473 | Bacteria | 1715 |
| 423 | Ga0495582_0103753 | 3300046473 | Bacteria | 1593 |
| 424 | Ga0495582_0248766 | 3300046473 | Bacteria | 1019 |
| 425 | Ga0495605_0216848 | 3300046474 | Bacteria | 828 |
| 426 | Ga0495639_0011148 | 3300046475 | Bacteria | 3871 |
| 427 | Ga0495639_0045851 | 3300046475 | Bacteria | 1978 |
| 428 | Ga0495639_0534581 | 3300046475 | Bacteria | 600 |
| 429 | Ga0495662_0003087 | 3300046476 | Bacteria | 8397 |
| 430 | Ga0495662_0006321 | 3300046476 | Bacteria | 5923 |
| 431 | Ga0495662_0032908 | 3300046476 | Bacteria | 2505 |
| 432 | Ga0495664_0013872 | 3300046477 | Bacteria | 4568 |
| 433 | Ga0495664_0149190 | 3300046477 | Bacteria | 1418 |
| 434 | Ga0495664_0238385 | 3300046477 | Bacteria | 1100 |
| 435 | Ga0495664_0241563 | 3300046477 | Bacteria | 1092 |
| 436 | Ga0495664_0503077 | 3300046477 | Unclassified | 724 |
| 437 | Ga0495584_0271365 | 3300046491 | Bacteria | 862 |
| 438 | Ga0495594_0526736 | 3300046499 | Bacteria | 671 |
| 439 | Ga0495607_0094724 | 3300046501 | Bacteria | 1610 |
| 440 | Ga0495608_0003026 | 3300046511 | Bacteria | 11997 |
| 441 | Ga0495608_0018549 | 3300046511 | Bacteria | 4797 |
| 442 | Ga0495608_0028876 | 3300046511 | Bacteria | 3768 |
| 443 | Ga0495608_0067278 | 3300046511 | Bacteria | 2343 |
| 444 | Ga0495608_0140336 | 3300046511 | Bacteria | 1543 |
| 445 | Ga0495618_0007049 | 3300046514 | Bacteria | 6808 |
| 446 | Ga0495618_0031726 | 3300046514 | Bacteria | 3307 |
| 447 | Ga0495618_0174566 | 3300046514 | Bacteria | 1367 |
| 448 | Ga0495618_0213409 | 3300046514 | Bacteria | 1219 |
| 449 | Ga0495618_0257360 | 3300046514 | Bacteria | 1093 |
| 450 | Ga0495628_0000026 | 3300046516 | Bacteria | 127398 |
| 451 | Ga0495628_0170895 | 3300046516 | Bacteria | 1648 |
| 452 | Ga0495628_0204925 | 3300046516 | Bacteria | 1485 |
| 453 | Ga0495628_0397827 | 3300046516 | Bacteria | 1007 |
| 454 | Ga0495630_0003344 | 3300046517 | Bacteria | 11166 |
| 455 | Ga0495630_0053483 | 3300046517 | Bacteria | 3023 |
| 456 | Ga0495630_0060861 | 3300046517 | Bacteria | 2835 |
| 457 | Ga0495630_0088951 | 3300046517 | Bacteria | 2332 |
| 458 | Ga0495637_0181337 | 3300046520 | Bacteria | 780 |
| 459 | Ga0495644_0011930 | 3300046523 | Bacteria | 3341 |
| 460 | Ga0495666_0000479 | 3300046526 | Bacteria | 17815 |
| 461 | Ga0495652_0000172 | 3300046529 | Bacteria | 74042 |
| 462 | Ga0495652_0042823 | 3300046529 | Bacteria | 3903 |
| 463 | Ga0495652_0104502 | 3300046529 | Bacteria | 2290 |
| 464 | Ga0495652_0194871 | 3300046529 | Bacteria | 1543 |
| 465 | Ga0495652_0339803 | 3300046529 | Bacteria | 1079 |
| 466 | Ga0495652_0390307 | 3300046529 | Bacteria | 988 |
| 467 | Ga0495652_0422174 | 3300046529 | Bacteria | 939 |
| 468 | Ga0495665_0000302 | 3300046531 | Bacteria | 24900 |
| 469 | Ga0495665_0074727 | 3300046531 | Bacteria | 1784 |
| 470 | Ga0495665_0088269 | 3300046531 | Bacteria | 1630 |
| 471 | Ga0495640_0004584 | 3300046533 | Bacteria | 11021 |
| 472 | Ga0495640_0022308 | 3300046533 | Bacteria | 4628 |
| 473 | Ga0495640_0075204 | 3300046533 | Bacteria | 2256 |
| 474 | Ga0495640_0152034 | 3300046533 | Bacteria | 1487 |
| 475 | Ga0495640_0292932 | 3300046533 | Bacteria | 1012 |
| 476 | Ga0495640_0473456 | 3300046533 | Bacteria | 763 |
| 477 | Ga0495640_0612942 | 3300046533 | Bacteria | 657 |
| 478 | Ga0495586_0006885 | 3300046535 | Bacteria | 6058 |
| 479 | Ga0495586_0073500 | 3300046535 | Bacteria | 1870 |
| 480 | Ga0495586_0318002 | 3300046535 | Bacteria | 892 |
| 481 | Ga0495586_0681518 | 3300046535 | Bacteria | 594 |
| 482 | Ga0495587_0000362 | 3300046536 | Bacteria | 32677 |
| 483 | Ga0495587_0055105 | 3300046536 | Bacteria | 2342 |
| 484 | Ga0495587_0253660 | 3300046536 | Unclassified | 989 |
| 485 | Ga0495587_0386352 | 3300046536 | Bacteria | 778 |
| 486 | Ga0495598_0199767 | 3300046537 | Unclassified | 721 |
| 487 | Ga0495609_0042234 | 3300046538 | Bacteria | 2048 |
| 488 | Ga0495645_0000016 | 3300046543 | Bacteria | 158415 |
| 489 | Ga0495645_0070810 | 3300046543 | Bacteria | 2516 |
| 490 | Ga0495645_0129414 | 3300046543 | Bacteria | 1770 |
| 491 | Ga0495645_0193348 | 3300046543 | Bacteria | 1385 |
| 492 | Ga0495645_0202667 | 3300046543 | Bacteria | 1344 |
| 493 | Ga0495622_0481006 | 3300046557 | Bacteria | 531 |
| 494 | Ga0495633_0349187 | 3300046558 | Bacteria | 670 |
| 495 | Ga0495667_0004608 | 3300046559 | Bacteria | 9324 |
| 496 | Ga0495667_0077714 | 3300046559 | Bacteria | 2158 |
| 497 | Ga0495667_0605370 | 3300046559 | Bacteria | 682 |
| 498 | Ga0495656_0003724 | 3300046615 | Bacteria | 5175 |
| 499 | Ga0495668_0102074 | 3300046616 | Bacteria | 1569 |
| 500 | Ga0495634_0028217 | 3300046642 | Bacteria | 3897 |
| 501 | Ga0495634_0075911 | 3300046642 | Bacteria | 2206 |
| 502 | Ga0495634_0115068 | 3300046642 | Unclassified | 1726 |
| 503 | Ga0495634_0154586 | 3300046642 | Bacteria | 1449 |
| 504 | Ga0495634_0198049 | 3300046642 | Bacteria | 1249 |
| 505 | Ga0495635_0014544 | 3300046663 | Bacteria | 5505 |
| 506 | Ga0495635_0025715 | 3300046663 | Bacteria | 4100 |
| 507 | Ga0495635_0040109 | 3300046663 | Bacteria | 3236 |
| 508 | Ga0495635_0355867 | 3300046663 | Bacteria | 976 |
| 509 | Ga0495661_0360597 | 3300046665 | Bacteria | 714 |
| 510 | Ga0495657_0002580 | 3300046675 | Bacteria | 15174 |
| 511 | Ga0495657_0015919 | 3300046675 | Bacteria | 5489 |
| 512 | Ga0495657_0021164 | 3300046675 | Bacteria | 4668 |
| 513 | Ga0495657_0052819 | 3300046675 | Bacteria | 2722 |
| 514 | Ga0495657_0183879 | 3300046675 | Bacteria | 1281 |
| 515 | Ga0495657_0214703 | 3300046675 | Bacteria | 1168 |
| 516 | Ga0495599_0000016 | 3300046678 | Bacteria | 169605 |
| 517 | Ga0495599_0004510 | 3300046678 | Bacteria | 8256 |
| 518 | Ga0495599_0248521 | 3300046678 | Bacteria | 1083 |
| 519 | Ga0495599_0251768 | 3300046678 | Unclassified | 1075 |
| 520 | Ga0495623_0000046 | 3300046679 | Bacteria | 74571 |
| 521 | Ga0495623_0077473 | 3300046679 | Bacteria | 2061 |
| 522 | Ga0495623_0211278 | 3300046679 | Bacteria | 1111 |
| 523 | Ga0495623_0553716 | 3300046679 | Unclassified | 602 |
| 524 | Ga0495646_0025915 | 3300046680 | Bacteria | 3683 |
| 525 | Ga0495646_0033586 | 3300046680 | Bacteria | 3189 |
| 526 | Ga0495646_0060609 | 3300046680 | Bacteria | 2256 |
| 527 | Ga0495646_0183664 | 3300046680 | Bacteria | 1146 |
| 528 | Ga0495647_0072394 | 3300046681 | Bacteria | 1382 |
| 529 | Ga0495647_0125616 | 3300046681 | Bacteria | 1083 |
| 530 | Ga0495647_0407283 | 3300046681 | Bacteria | 625 |
| 531 | Ga0495658_0033037 | 3300046683 | Bacteria | 2830 |
| 532 | Ga0495658_0041190 | 3300046683 | Bacteria | 2571 |
| 533 | Ga0495658_0381581 | 3300046683 | Bacteria | 897 |
| 534 | Ga0495658_0488155 | 3300046683 | Bacteria | 787 |
| 535 | Ga0495613_0011442 | 3300046689 | Bacteria | 6596 |
| 536 | Ga0495613_0041670 | 3300046689 | Bacteria | 3399 |
| 537 | Ga0495613_0043878 | 3300046689 | Bacteria | 3309 |
| 538 | Ga0495613_0072674 | 3300046689 | Bacteria | 2507 |
| 539 | Ga0495613_0535218 | 3300046689 | Bacteria | 785 |
| 540 | Ga0495624_0002088 | 3300046690 | Bacteria | 15229 |
| 541 | Ga0495624_0026779 | 3300046690 | Bacteria | 3778 |
| 542 | Ga0495624_0053690 | 3300046690 | Bacteria | 2543 |
| 543 | Ga0495624_0527201 | 3300046690 | Bacteria | 706 |
| 544 | Ga0495624_0591334 | 3300046690 | Bacteria | 662 |
| 545 | Ga0495670_0099433 | 3300046691 | Unclassified | 1497 |
| 546 | Ga0495589_0008255 | 3300046794 | Bacteria | 5440 |
| 547 | Ga0495600_0007328 | 3300046809 | Bacteria | 6741 |
| 548 | Ga0495600_0056591 | 3300046809 | Bacteria | 2562 |
| 549 | Ga0495600_0441938 | 3300046809 | Unclassified | 805 |
| 550 | Ga0495581_0003449 | 3300047315 | Bacteria | 9081 |
| 551 | Ga0495581_0011316 | 3300047315 | Bacteria | 5161 |
| 552 | Ga0495581_0409028 | 3300047315 | Bacteria | 791 |
| 553 | Ga0495604_0000004 | 3300047317 | Bacteria | 456385 |
| 554 | Ga0495604_0172719 | 3300047317 | Bacteria | 1518 |
| 555 | Ga0495604_0249625 | 3300047317 | Bacteria | 1210 |
| 556 | Ga0495604_0478053 | 3300047317 | Bacteria | 811 |
| 557 | Ga0495636_0007524 | 3300047318 | Bacteria | 4287 |
| 558 | Ga0495674_0044630 | 3300047319 | Bacteria | 3939 |
| 559 | Ga0495674_0063639 | 3300047319 | Bacteria | 3208 |
| 560 | Ga0495674_0267128 | 3300047319 | Bacteria | 1405 |
| 561 | Ga0495674_0295200 | 3300047319 | Bacteria | 1325 |
| 562 | Ga0495674_0551340 | 3300047319 | Bacteria | 917 |
| 563 | Ga0495674_1011012 | 3300047319 | Unclassified | 637 |
| 564 | Ga0495676_0002477 | 3300047321 | Bacteria | 16420 |
| 565 | Ga0495676_0058336 | 3300047321 | Bacteria | 3037 |
| 566 | Ga0495676_0065571 | 3300047321 | Bacteria | 2818 |
| 567 | Ga0495676_0219198 | 3300047321 | Bacteria | 1312 |
| 568 | Ga0495676_0332703 | 3300047321 | Bacteria | 1018 |
| 569 | Ga0495680_0005384 | 3300047322 | Bacteria | 12065 |
| 570 | Ga0495680_0009560 | 3300047322 | Bacteria | 8711 |
| 571 | Ga0495680_0038117 | 3300047322 | Bacteria | 3845 |
| 572 | Ga0495680_0047161 | 3300047322 | Bacteria | 3391 |
| 573 | Ga0495680_0088959 | 3300047322 | Bacteria | 2319 |
| 574 | Ga0495680_0313298 | 3300047322 | Bacteria | 1099 |
| 575 | Ga0495680_0532180 | 3300047322 | Unclassified | 794 |
| 576 | Ga0495680_0817197 | 3300047322 | Bacteria | 608 |
| 577 | Ga0495675_0000079 | 3300047444 | Bacteria | 68947 |
| 578 | Ga0495675_0195848 | 3300047444 | Bacteria | 1232 |
| 579 | Ga0495675_0535803 | 3300047444 | Bacteria | 669 |
| 580 | Ga0495675_0609177 | 3300047444 | Bacteria | 618 |
| 581 | Ga0495677_0017805 | 3300047445 | Bacteria | 2575 |
| 582 | Ga0495684_0000645 | 3300047471 | Bacteria | 28045 |
| 583 | Ga0495684_0017796 | 3300047471 | Bacteria | 5474 |
| 584 | Ga0495684_0031240 | 3300047471 | Bacteria | 4088 |
| 585 | Ga0495684_0046578 | 3300047471 | Bacteria | 3316 |
| 586 | Ga0495684_0052536 | 3300047471 | Bacteria | 3110 |
| 587 | Ga0495684_0252050 | 3300047471 | Bacteria | 1284 |
| 588 | Ga0495593_0000866 | 3300047673 | Bacteria | 17530 |
| 589 | Ga0495593_0128411 | 3300047673 | Unclassified | 1288 |
| 590 | Ga0495593_0317927 | 3300047673 | Bacteria | 778 |
| 591 | Ga0495602_0000351 | 3300048088 | Bacteria | 42756 |
| 592 | Ga0495602_0028726 | 3300048088 | Bacteria | 5315 |
| 593 | Ga0495602_0800576 | 3300048088 | Unclassified | 633 |
| 594 | Ga0495614_0000905 | 3300048089 | Bacteria | 12610 |
| 595 | Ga0495614_0047467 | 3300048089 | Bacteria | 1842 |
| 596 | Ga0496100_0118754 | 3300048903 | Bacteria | 1847 |
| 597 | Ga0496100_0770734 | 3300048903 | Unclassified | 753 |
| 598 | Ga0496101_0008498 | 3300048904 | Bacteria | 6709 |
| 599 | Ga0496101_0372243 | 3300048904 | Bacteria | 1123 |
| 600 | Ga0496101_0553812 | 3300048904 | Bacteria | 909 |
| 601 | Ga0496102_0026078 | 3300048905 | Bacteria | 5209 |
| 602 | Ga0496102_1861532 | 3300048905 | Unclassified | 519 |
| 603 | Ga0496103_0066187 | 3300048906 | Bacteria | 2255 |
| 604 | Ga0496104_0006660 | 3300048907 | Bacteria | 10166 |
| 605 | Ga0496104_0356150 | 3300048907 | Bacteria | 1376 |
| 606 | Ga0496104_0744001 | 3300048907 | Bacteria | 887 |
| 607 | Ga0496105_0021247 | 3300048908 | Bacteria | 5252 |
| 608 | Ga0496105_0163088 | 3300048908 | Bacteria | 1829 |
| 609 | Ga0496105_0530932 | 3300048908 | Bacteria | 921 |
| 610 | Ga0496105_0606896 | 3300048908 | Bacteria | 849 |
| 611 | Ga0496106_0007968 | 3300048909 | Bacteria | 7826 |
| 612 | Ga0496106_0487676 | 3300048909 | Bacteria | 990 |
| 613 | Ga0496107_0002716 | 3300048910 | Bacteria | 11605 |
| 614 | Ga0496107_0378328 | 3300048910 | Bacteria | 1053 |
| 615 | Ga0496108_0083404 | 3300048911 | Bacteria | 2711 |
| 616 | Ga0496108_0174097 | 3300048911 | Bacteria | 1862 |
| 617 | Ga0496109_0004583 | 3300048912 | Bacteria | 11537 |
| 618 | Ga0496109_0023841 | 3300048912 | Bacteria | 5432 |
| 619 | Ga0496109_0253724 | 3300048912 | Bacteria | 1656 |
| 620 | Ga0496109_0413991 | 3300048912 | Bacteria | 1273 |
| 621 | Ga0496109_1519540 | 3300048912 | Unclassified | 604 |
| 622 | Ga0496110_0044469 | 3300048913 | Bacteria | 3878 |
| 623 | Ga0496110_0075716 | 3300048913 | Bacteria | 2991 |
| 624 | Ga0496111_0011638 | 3300048914 | Bacteria | 5936 |
| 625 | Ga0496111_0026782 | 3300048914 | Bacteria | 4073 |
| 626 | Ga0496111_0194033 | 3300048914 | Bacteria | 1510 |
| 627 | Ga0496112_0064490 | 3300048915 | Bacteria | 3615 |
| 628 | Ga0496112_0075929 | 3300048915 | Bacteria | 3323 |
| 629 | Ga0496112_0169430 | 3300048915 | Bacteria | 2149 |
| 630 | Ga0496112_0586061 | 3300048915 | Bacteria | 1048 |
| 631 | Ga0496113_0165870 | 3300048916 | Bacteria | 1747 |
| 632 | Ga0496113_0389624 | 3300048916 | Bacteria | 1118 |
| 633 | Ga0496114_0033121 | 3300048917 | Bacteria | 4256 |
| 634 | Ga0496114_0113958 | 3300048917 | Bacteria | 2318 |
| 635 | Ga0496114_0741324 | 3300048917 | Bacteria | 859 |
| 636 | Ga0496114_1090376 | 3300048917 | Bacteria | 683 |
| 637 | Ga0496115_0020232 | 3300048918 | Bacteria | 5132 |
| 638 | Ga0496115_0021438 | 3300048918 | Bacteria | 4992 |
| 639 | Ga0496115_0023462 | 3300048918 | Bacteria | 4788 |
| 640 | Ga0496115_0557473 | 3300048918 | Bacteria | 915 |
| 641 | Ga0496115_0597037 | 3300048918 | Bacteria | 878 |
| 642 | Ga0496115_1096939 | 3300048918 | Unclassified | 603 |
| 643 | Ga0501067_0147360 | 3300049583 | Bacteria | 1311 |
| 644 | Ga0501067_0661916 | 3300049583 | Bacteria | 586 |
| 645 | Ga0501069_0050525 | 3300049585 | Bacteria | 2312 |
| 646 | Ga0501069_0083442 | 3300049585 | Bacteria | 1801 |
| 647 | Ga0501069_0727667 | 3300049585 | Bacteria | 599 |
| 648 | Ga0501070_0164884 | 3300049586 | Bacteria | 1826 |
| 649 | Ga0501070_0742066 | 3300049586 | Bacteria | 774 |
| 650 | nmdc:mga0n895_1076039_c1 | 3300050512 | Bacteria | 782 |
| 651 | nmdc:mga0n895_297973_c1 | 3300050512 | Bacteria | 1635 |
| 652 | nmdc:mga0n895_7131_c1 | 3300050512 | Bacteria | 9554 |
| 653 | nmdc:mga08x19_135638_c1 | 3300050514 | Bacteria | 1659 |
| 654 | Ga0495601_0000896 | 3300053077 | Bacteria | 16243 |
| 655 | Ga0495601_0006440 | 3300053077 | Bacteria | 6868 |
| 656 | Ga0495601_0022478 | 3300053077 | Bacteria | 3871 |
| 657 | Ga0495601_0022650 | 3300053077 | Bacteria | 3859 |
| 658 | Ga0495601_0033732 | 3300053077 | Bacteria | 3190 |
| 659 | Ga0495601_0050099 | 3300053077 | Bacteria | 2633 |
| 660 | Ga0495601_0163170 | 3300053077 | Bacteria | 1456 |
| 661 | Ga0495601_0335830 | 3300053077 | Bacteria | 983 |
| 662 | Ga0495601_0511871 | 3300053077 | Bacteria | 774 |
| 663 | Ga0495601_0571726 | 3300053077 | Bacteria | 726 |
| 664 | Ga0495612_0021572 | 3300053078 | Bacteria | 2583 |
| 665 | Ga0495612_0055570 | 3300053078 | Bacteria | 1632 |
| 666 | Ga0495612_0069883 | 3300053078 | Bacteria | 1463 |
| 667 | Ga0495612_0203202 | 3300053078 | Unclassified | 874 |
| 668 | Ga0495612_0290056 | 3300053078 | Bacteria | 732 |
| 669 | Ga0495612_0306851 | 3300053078 | Bacteria | 712 |
| 670 | Ga0495595_0001772 | 3300053084 | Bacteria | 8431 |
| 671 | Ga0495595_0018601 | 3300053084 | Bacteria | 3004 |
| 672 | Ga0495595_0024266 | 3300053084 | Bacteria | 2678 |
| 673 | Ga0495595_0102645 | 3300053084 | Bacteria | 1381 |
| 674 | Ga0495595_0340496 | 3300053084 | Unclassified | 756 |
| 675 | Ga0495619_0000199 | 3300053085 | Bacteria | 43846 |
| 676 | Ga0495619_0007740 | 3300053085 | Bacteria | 6799 |
| 677 | Ga0495619_0023268 | 3300053085 | Bacteria | 3971 |
| 678 | Ga0495619_0052727 | 3300053085 | Bacteria | 2689 |
| 679 | Ga0495619_0093167 | 3300053085 | Bacteria | 2042 |
| 680 | Ga0495619_0123837 | 3300053085 | Bacteria | 1773 |
| 681 | Ga0495619_0171462 | 3300053085 | Bacteria | 1500 |
| 682 | Ga0466962_0018121 | 3300061719 | Bacteria | 3386 |
| 683 | Ga0466962_0027520 | 3300061719 | Bacteria | 2728 |
| 684 | Ga0466962_0077606 | 3300061719 | Bacteria | 1588 |
| 685 | Ga0466962_0097051 | 3300061719 | Bacteria | 1414 |
| 686 | Ga0466962_0098321 | 3300061719 | Bacteria | 1405 |
| 687 | Ga0466962_0213967 | 3300061719 | Bacteria | 943 |
| 688 | Ga0466962_0223526 | 3300061719 | Bacteria | 922 |
| 689 | Ga0530510_0398775 | 3300061734 | Unclassified | 1037 |
| 690 | Ga0373926_0198805 | |||
| 691 | rootH2_10102618 | |||
| 692 | rootH1_10330892 | |||
| 693 | Ga0070658_10020812 | |||
| 694 | Ga0070658_10024238 | |||
| 695 | Ga0070658_10223413 | |||
| 696 | Ga0070658_10682198 | |||
| 697 | Ga0070683_100037324 | |||
| 698 | Ga0070683_100662376 | |||
| 699 | Ga0070683_101064958 | |||
| 700 | Ga0070680_100047746 | |||
| 701 | Ga0070680_100233850 | |||
| 702 | Ga0070680_100270899 | |||
| 703 | Ga0070680_100362957 | |||
| 704 | Ga0070680_100946550 | |||
| 705 | Ga0070682_100051228 | |||
| 706 | Ga0068868_101632930 | |||
| 707 | Ga0070660_100013664 | |||
| 708 | Ga0070660_100022591 | |||
| 709 | Ga0070660_100163698 | |||
| 710 | Ga0070660_100380739 | |||
| 711 | Ga0070687_100769562 | |||
| 712 | Ga0070687_100841643 | |||
| 713 | Ga0070661_100021907 | |||
| 714 | Ga0070661_100223904 | |||
| 715 | Ga0070661_100279029 | |||
| 716 | Ga0070661_100803940 | |||
| 717 | Ga0070675_100796423 | |||
| 718 | Ga0070671_100144776 | |||
| 719 | Ga0070673_100751640 | |||
| 720 | Ga0070659_100408312 | |||
| 721 | Ga0070659_100797380 | |||
| 722 | Ga0070659_101083692 | |||
| 723 | Ga0070709_10037851 | |||
| 724 | Ga0070714_100047431 | |||
| 725 | Ga0070714_100055003 | |||
| 726 | Ga0070714_100079377 | |||
| 727 | Ga0070714_100540249 | |||
| 728 | Ga0070714_100934397 | |||
| 729 | Ga0070713_100001098 | |||
| 730 | Ga0070713_100038848 | |||
| 731 | Ga0070713_100112482 | |||
| 732 | Ga0070713_100467599 | |||
| 733 | Ga0070713_101470060 | |||
| 734 | Ga0070710_10005679 | |||
| 735 | Ga0070711_100114021 | |||
| 736 | Ga0070711_100494180 | |||
| 737 | Ga0070705_100432332 | |||
| 738 | Ga0070705_100602689 | |||
| 739 | Ga0070694_100261426 | |||
| 740 | Ga0070708_100418405 | |||
| 741 | Ga0070678_100657970 | |||
| 742 | Ga0070678_100807509 | |||
| 743 | Ga0070681_10058674 | |||
| 744 | Ga0070681_10076414 | |||
| 745 | Ga0070681_10156343 | |||
| 746 | Ga0070681_10266504 | |||
| 747 | Ga0070681_10276490 | |||
| 748 | Ga0070706_100199745 | |||
| 749 | Ga0070707_100000749 | |||
| 750 | Ga0070707_100239540 | |||
| 751 | Ga0070707_100582826 | |||
| 752 | Ga0070679_100107286 | |||
| 753 | Ga0070679_100109591 | |||
| 754 | Ga0070679_100187939 | |||
| 755 | Ga0070679_100360736 | |||
| 756 | Ga0070679_101422074 | |||
| 757 | Ga0070684_100015393 | |||
| 758 | Ga0070684_101202050 | |||
| 759 | Ga0070697_100262249 | |||
| 760 | Ga0068853_100761072 | |||
| 761 | Ga0070693_100170367 | |||
| 762 | Ga0070693_100719065 | |||
| 763 | Ga0070704_100125597 | |||
| 764 | Ga0068855_100012155 | |||
| 765 | Ga0068855_100055804 | |||
| 766 | Ga0068855_100425142 | |||
| 767 | Ga0068855_100555751 | |||
| 768 | Ga0068855_100599801 | |||
| 769 | Ga0070664_100332828 | |||
| 770 | Ga0068857_101194287 | |||
| 771 | Ga0068856_100028714 | |||
| 772 | Ga0068856_100386332 | |||
| 773 | Ga0068856_100486631 | |||
| 774 | Ga0070702_100193304 | |||
| 775 | Ga0068852_100802259 | |||
| 776 | Ga0068864_100240319 | |||
| 777 | Ga0068863_100820392 | |||
| 778 | Ga0070717_10002024 | |||
| 779 | Ga0070717_10015901 | |||
| 780 | Ga0070717_10023413 | |||
| 781 | Ga0070717_10069595 | |||
| 782 | Ga0070717_10605362 | |||
| 783 | Ga0070717_10720582 | |||
| 784 | Ga0070717_11878480 | |||
| 785 | Ga0070715_10025257 | |||
| 786 | Ga0070716_100000887 | |||
| 787 | Ga0070712_100182992 | |||
| 788 | Ga0070712_100341499 | |||
| 789 | Ga0070712_100596172 | |||
| 790 | Ga0070712_100812502 | |||
| 791 | Ga0097621_100967047 | |||
| 792 | Ga0097621_101355244 | |||
| 793 | Ga0068871_100311003 | |||
| 794 | Ga0075436_100140323 | |||
| 795 | Ga0075435_100340065 | |||
| 796 | Ga0105240_10046296 | |||
| 797 | Ga0105240_10073083 | |||
| 798 | Ga0105245_11385877 | |||
| 799 | Ga0105245_11454522 | |||
| 800 | Ga0105247_10402230 | |||
| 801 | Ga0114129_11740911 | |||
| 802 | Ga0105248_10191422 | |||
| 803 | Ga0105248_10570969 | |||
| 804 | Ga0105248_10607134 | |||
| 805 | Ga0105237_10016749 | |||
| 806 | Ga0105237_11234745 | |||
| 807 | Ga0105238_10078122 | |||
| 808 | Ga0105238_10140285 | |||
| 809 | Ga0105239_10552019 | |||
| 810 | Ga0157373_10074032 | |||
| 811 | Ga0157370_10063700 | |||
| 812 | Ga0157370_10299113 | |||
| 813 | Ga0157370_10703470 | |||
| 814 | Ga0157370_11074114 | |||
| 815 | Ga0157369_10031799 | |||
| 816 | Ga0157369_10086429 | |||
| 817 | Ga0157369_10233111 | |||
| 818 | Ga0157369_10318112 | |||
| 819 | Ga0157369_10406081 | |||
| 820 | Ga0157369_10765860 | |||
| 821 | Ga0157369_10784107 | |||
| 822 | Ga0157369_10925726 | |||
| 823 | Ga0157374_10106257 | |||
| 824 | Ga0157374_12037755 | |||
| 825 | Ga0157378_10647150 | |||
| 826 | Ga0157372_10014906 | |||
| 827 | Ga0157372_10144009 | |||
| 828 | Ga0157372_10598250 | |||
| 829 | Ga0157372_10684283 | |||
| 830 | Ga0157372_10812673 | |||
| 831 | Ga0157372_13247081 | |||
| 832 | Ga0157375_11357620 | |||
| 833 | Ga0182008_10001510 | |||
| 834 | Ga0182008_10036432 | |||
| 835 | Ga0182008_10112895 | |||
| 836 | Ga0182008_10465054 | |||
| 837 | Ga0157379_10538716 | |||
| 838 | Ga0157376_10060998 | |||
| 839 | Ga0182005_1038805 | |||
| 840 | Ga0206356_10918821 | |||
| 841 | Ga0206356_11321873 | |||
| 842 | Ga0206356_11629688 | |||
| 843 | Ga0206354_10032689 | |||
| 844 | Ga0206354_10394166 | |||
| 845 | Ga0206354_11186537 | |||
| 846 | Ga0206353_10139008 | |||
| 847 | Ga0224712_10168144 | |||
| 848 | Ga0207692_10065766 | |||
| 849 | Ga0207685_10010023 | |||
| 850 | Ga0207699_10061518 | |||
| 851 | Ga0207705_10032090 | |||
| 852 | Ga0207705_10796822 | |||
| 853 | Ga0207705_11008113 | |||
| 854 | Ga0207707_10076816 | |||
| 855 | Ga0207707_10082498 | |||
| 856 | Ga0207707_10225850 | |||
| 857 | Ga0207695_10046896 | |||
| 858 | Ga0207695_11095767 | |||
| 859 | Ga0207671_11084997 | |||
| 860 | Ga0207693_10019641 | |||
| 861 | Ga0207693_10349822 | |||
| 862 | Ga0207693_10375202 | |||
| 863 | Ga0207663_10016113 | |||
| 864 | Ga0207663_10732047 | |||
| 865 | Ga0207660_10273698 | |||
| 866 | Ga0207660_10351902 | |||
| 867 | Ga0207660_10452986 | |||
| 868 | Ga0207657_10004929 | |||
| 869 | Ga0207657_10097708 | |||
| 870 | Ga0207657_10123158 | |||
| 871 | Ga0207649_10024250 | |||
| 872 | Ga0207652_10146954 | |||
| 873 | Ga0207652_10245244 | |||
| 874 | Ga0207652_11160340 | |||
| 875 | Ga0207646_10051191 | |||
| 876 | Ga0207646_10294778 | |||
| 877 | Ga0207646_10311073 | |||
| 878 | Ga0207646_10658625 | |||
| 879 | Ga0207694_10106390 | |||
| 880 | Ga0207694_10232157 | |||
| 881 | Ga0207659_10412947 | |||
| 882 | Ga0207687_10163212 | |||
| 883 | Ga0207687_10828095 | |||
| 884 | Ga0207700_10015618 | |||
| 885 | Ga0207700_10069427 | |||
| 886 | Ga0207700_10087780 | |||
| 887 | Ga0207700_10355418 | |||
| 888 | Ga0207664_10206388 | |||
| 889 | Ga0207664_10295180 | |||
| 890 | Ga0207664_10413131 | |||
| 891 | Ga0207664_10469536 | |||
| 892 | Ga0207644_10211967 | |||
| 893 | Ga0207690_10470339 | |||
| 894 | Ga0207690_11036244 | |||
| 895 | Ga0207665_10003486 | |||
| 896 | Ga0207665_10342029 | |||
| 897 | Ga0207665_10350411 | |||
| 898 | Ga0207665_10352007 | |||
| 899 | Ga0207665_11228422 | |||
| 900 | Ga0207711_10355258 | |||
| 901 | Ga0207661_10005935 | |||
| 902 | Ga0207661_10786492 | |||
| 903 | Ga0207661_10850403 | |||
| 904 | Ga0207661_10896229 | |||
| 905 | Ga0207679_10176440 | |||
| 906 | Ga0207667_10070333 | |||
| 907 | Ga0207667_10194909 | |||
| 908 | Ga0207667_10348441 | |||
| 909 | Ga0207667_10608581 | |||
| 910 | Ga0207667_11041758 | |||
| 911 | Ga0207677_10565016 | |||
| 912 | Ga0207677_10971237 | |||
| 913 | Ga0207702_10281724 | |||
| 914 | Ga0207702_10468645 | |||
| 915 | Ga0207641_10691278 | |||
| 916 | Ga0207674_10240358 | |||
| 917 | Ga0207683_10480576 | |||
| 918 | Ga0207683_11660333 | |||
| 919 | Ga0207698_10610562 | |||
| 920 | Ga0207698_11459740 | |||
| 921 | Ga0265319_1144792 | |||
| 922 | Ga0265336_10017265 | |||
| 923 | Ga0265338_10008570 | |||
| 924 | Ga0265338_10019203 | |||
| 925 | Ga0265338_10051027 | |||
| 926 | Ga0265338_10302319 | |||
| 927 | Ga0265324_10193044 | |||
| 928 | Ga0265332_10275023 | |||
| 929 | Ga0265327_10011835 | |||
| 930 | Ga0316583_10044800 | |||
| 931 | Ga0373928_0129067 | |||
| 932 | Ga0373939_0066060 | |||
| 933 | Ga0373939_0087041 | |||
| 934 | Ga0373945_0286878 | |||
| 935 | Ga0373953_0486922 | |||
| 936 | Ga0373943_0012474 | |||
| 937 | Ga0373946_0720894 | |||
| 938 | Ga0373955_0027859 | |||
| 939 | Ga0373955_0299981 | |||
| 940 | Ga0373942_0159874 | |||
| 941 | Ga0373931_0278433 | |||
| 942 | Ga0373931_0450488 | |||
| 943 | Ga0373935_0014166 | |||
| 944 | Ga0373933_0475595 | |||
| 945 | Ga0373933_0802548 | |||
| 946 | Ga0373947_0001659 | |||
| 947 | Ga0373947_0076234 | |||
| 948 | Ga0373947_0094937 | |||
| 949 | Ga0373937_0001461 | |||
| 950 | Ga0373937_0071898 | |||
| 951 | Ga0373937_0400011 | |||
| 952 | Ga0373937_0546746 | |||
| 953 | Ga0373925_0004134 | |||
| 954 | Ga0373925_0105362 | |||
| 955 | Ga0395899_0143795 | |||
| 956 | Ga0395899_0313430 | |||
| 957 | Ga0395900_0199836 | |||
| 958 | Ga0395900_0382662 | |||
| 959 | Ga0395900_0403616 | |||
| 960 | Ga0395900_1095733 | |||
| 961 | Ga0395898_0077447 | |||
| 962 | Ga0395898_0125750 | |||
| 963 | Ga0395898_0140579 | |||
| 964 | Ga0395898_0164778 | |||
| 965 | Ga0395898_0208498 | |||
| 966 | Ga0395898_0667160 | |||
| 967 | Ga0395898_1689027 | |||
| 968 | Ga0395905_0210081 | |||
| 969 | Ga0395905_0376465 | |||
| 970 | Ga0395901_0398329 | |||
| 971 | Ga0395901_0649009 | |||
| 972 | Ga0395901_0923621 | |||
| 973 | Ga0436365_1121542 | |||
| 974 | Ga0451798_0692941 | |||
| 975 | Ga0466969_0000890 | |||
| 976 | Ga0466972_0063719 | |||
| 977 | Ga0466965_0034628 | |||
| 978 | Ga0466965_0040965 | |||
| 979 | Ga0466965_0142194 | |||
| 980 | Ga0466965_0169611 | |||
| 981 | Ga0466965_0227519 | |||
| 982 | Ga0466965_0829355 | |||
| 983 | Ga0466966_0017793 | |||
| 984 | Ga0466966_0030451 | |||
| 985 | Ga0466966_0040571 | |||
| 986 | Ga0466966_0426944 | |||
| 987 | Ga0466961_0010552 | |||
| 988 | Ga0466961_0011827 | |||
| 989 | Ga0466961_0017835 | |||
| 990 | Ga0466961_0095692 | |||
| 991 | Ga0466961_0465083 | |||
| 992 | Ga0466963_0000400 | |||
| 993 | Ga0466963_0000752 | |||
| 994 | Ga0466963_0001579 | |||
| 995 | Ga0466963_0001838 | |||
| 996 | Ga0466963_0009192 | |||
| 997 | Ga0466963_0025676 | |||
| 998 | Ga0466963_0036619 | |||
| 999 | Ga0466963_0055517 | |||
| 1000 | Ga0466963_0073328 | |||
| 1001 | Ga0466963_0092002 | |||
| 1002 | Ga0466963_0098668 | |||
| 1003 | Ga0466963_0220782 | |||
| 1004 | Ga0466963_0224373 | |||
| 1005 | Ga0466963_0387948 | |||
| 1006 | Ga0466963_0708225 | |||
| 1007 | Ga0466963_1009848 | |||
| 1008 | Ga0466964_0007546 | |||
| 1009 | Ga0466964_0014477 | |||
| 1010 | Ga0466964_0022215 | |||
| 1011 | Ga0466964_0022665 | |||
| 1012 | Ga0466964_0023928 | |||
| 1013 | Ga0466964_0029757 | |||
| 1014 | Ga0466964_0035173 | |||
| 1015 | Ga0466964_0036973 | |||
| 1016 | Ga0466964_0188535 | |||
| 1017 | Ga0466964_0691638 | |||
| 1018 | Ga0466971_0000403 | |||
| 1019 | Ga0466971_0011932 | |||
| 1020 | Ga0466971_0038001 | |||
| 1021 | Ga0466971_0138253 | |||
| 1022 | Ga0466971_0139296 | |||
| 1023 | Ga0466971_0201572 | |||
| 1024 | Ga0466968_0005768 | |||
| 1025 | Ga0466968_0050114 | |||
| 1026 | Ga0466968_0100610 | |||
| 1027 | Ga0466968_0573941 | |||
| 1028 | Ga0466970_0008974 | |||
| 1029 | Ga0466957_0002539 | |||
| 1030 | Ga0466957_0003504 | |||
| 1031 | Ga0466957_0005656 | |||
| 1032 | Ga0466957_0005906 | |||
| 1033 | Ga0466957_0159900 | |||
| 1034 | Ga0466957_0178698 | |||
| 1035 | Ga0466957_0280054 | |||
| 1036 | Ga0466957_0421861 | |||
| 1037 | Ga0466957_0732671 | |||
| 1038 | Ga0466957_0858179 | |||
| 1039 | Ga0466960_0003437 | |||
| 1040 | Ga0466960_0057963 | |||
| 1041 | Ga0466960_0083460 | |||
| 1042 | Ga0466960_0264975 | |||
| 1043 | Ga0466960_0675716 | |||
| 1044 | Ga0466960_0743505 | |||
| 1045 | Ga0466960_0855043 | |||
| 1046 | Ga0466959_0005205 | |||
| 1047 | Ga0466959_0016473 | |||
| 1048 | Ga0466959_0016759 | |||
| 1049 | Ga0466959_0159827 | |||
| 1050 | Ga0466959_0407165 | |||
| 1051 | Ga0451576_0161694 | |||
| 1052 | Ga0466958_0006781 | |||
| 1053 | Ga0466958_0017282 | |||
| 1054 | Ga0466958_0019839 | |||
| 1055 | Ga0466958_0022539 | |||
| 1056 | Ga0466958_0026013 | |||
| 1057 | Ga0466958_0036519 | |||
| 1058 | Ga0466958_0283849 | |||
| 1059 | Ga0466958_0294616 | |||
| 1060 | Ga0466958_0610146 | |||
| 1061 | Ga0466958_0922081 | |||
| 1062 | Ga0466967_0002083 | |||
| 1063 | Ga0466967_0002624 | |||
| 1064 | Ga0466967_0006488 | |||
| 1065 | Ga0466967_0013645 | |||
| 1066 | Ga0466967_0020338 | |||
| 1067 | Ga0466967_0028937 | |||
| 1068 | Ga0466967_0046838 | |||
| 1069 | Ga0466967_0049447 | |||
| 1070 | Ga0466967_0093129 | |||
| 1071 | Ga0466967_0138925 | |||
| 1072 | Ga0466967_0184132 | |||
| 1073 | Ga0466967_0286914 | |||
| 1074 | Ga0466967_0295619 | |||
| 1075 | Ga0466967_0305849 | |||
| 1076 | Ga0466967_0318083 | |||
| 1077 | Ga0466967_0649161 | |||
| 1078 | Ga0466967_0666385 | |||
| 1079 | Ga0466967_0775616 | |||
| 1080 | Ga0466967_1126003 | |||
| 1081 | Ga0466967_1911019 | |||
| 1082 | Ga0466967_1942291 | |||
| 1083 | Ga0495592_0000048 | |||
| 1084 | Ga0495592_0022031 | |||
| 1085 | Ga0495592_0467230 | |||
| 1086 | Ga0495592_0525542 | |||
| 1087 | Ga0495603_0043954 | |||
| 1088 | Ga0495603_0152654 | |||
| 1089 | Ga0495629_0008464 | |||
| 1090 | Ga0495629_0065317 | |||
| 1091 | Ga0495629_0197220 | |||
| 1092 | Ga0495629_0216850 | |||
| 1093 | Ga0495629_0798218 | |||
| 1094 | Ga0495641_0013346 | |||
| 1095 | Ga0495641_0062555 | |||
| 1096 | Ga0495641_0188704 | |||
| 1097 | Ga0495641_0287075 | |||
| 1098 | Ga0495651_0000049 | |||
| 1099 | Ga0495651_0021615 | |||
| 1100 | Ga0495651_0023850 | |||
| 1101 | Ga0495653_0000489 | |||
| 1102 | Ga0495653_0018511 | |||
| 1103 | Ga0495653_0078959 | |||
| 1104 | Ga0495653_0090042 | |||
| 1105 | Ga0495653_0415643 | |||
| 1106 | Ga0495653_0422280 | |||
| 1107 | Ga0495580_0188926 | |||
| 1108 | Ga0495580_0464624 | |||
| 1109 | Ga0495582_0022067 | |||
| 1110 | Ga0495582_0037398 | |||
| 1111 | Ga0495582_0089540 | |||
| 1112 | Ga0495582_0103753 | |||
| 1113 | Ga0495582_0248766 | |||
| 1114 | Ga0495605_0216848 | |||
| 1115 | Ga0495639_0011148 | |||
| 1116 | Ga0495639_0045851 | |||
| 1117 | Ga0495639_0534581 | |||
| 1118 | Ga0495662_0003087 | |||
| 1119 | Ga0495662_0006321 | |||
| 1120 | Ga0495662_0032908 | |||
| 1121 | Ga0495664_0013872 | |||
| 1122 | Ga0495664_0149190 | |||
| 1123 | Ga0495664_0238385 | |||
| 1124 | Ga0495664_0241563 | |||
| 1125 | Ga0495664_0503077 | |||
| 1126 | Ga0495584_0271365 | |||
| 1127 | Ga0495594_0526736 | |||
| 1128 | Ga0495607_0094724 | |||
| 1129 | Ga0495608_0003026 | |||
| 1130 | Ga0495608_0018549 | |||
| 1131 | Ga0495608_0028876 | |||
| 1132 | Ga0495608_0067278 | |||
| 1133 | Ga0495608_0140336 | |||
| 1134 | Ga0495618_0007049 | |||
| 1135 | Ga0495618_0031726 | |||
| 1136 | Ga0495618_0174566 | |||
| 1137 | Ga0495618_0213409 | |||
| 1138 | Ga0495618_0257360 | |||
| 1139 | Ga0495628_0000026 | |||
| 1140 | Ga0495628_0170895 | |||
| 1141 | Ga0495628_0204925 | |||
| 1142 | Ga0495628_0397827 | |||
| 1143 | Ga0495630_0003344 | |||
| 1144 | Ga0495630_0053483 | |||
| 1145 | Ga0495630_0060861 | |||
| 1146 | Ga0495630_0088951 | |||
| 1147 | Ga0495637_0181337 | |||
| 1148 | Ga0495644_0011930 | |||
| 1149 | Ga0495666_0000479 | |||
| 1150 | Ga0495652_0000172 | |||
| 1151 | Ga0495652_0042823 | |||
| 1152 | Ga0495652_0104502 | |||
| 1153 | Ga0495652_0194871 | |||
| 1154 | Ga0495652_0339803 | |||
| 1155 | Ga0495652_0390307 | |||
| 1156 | Ga0495652_0422174 | |||
| 1157 | Ga0495665_0000302 | |||
| 1158 | Ga0495665_0074727 | |||
| 1159 | Ga0495665_0088269 | |||
| 1160 | Ga0495640_0004584 | |||
| 1161 | Ga0495640_0022308 | |||
| 1162 | Ga0495640_0075204 | |||
| 1163 | Ga0495640_0152034 | |||
| 1164 | Ga0495640_0292932 | |||
| 1165 | Ga0495640_0473456 | |||
| 1166 | Ga0495640_0612942 | |||
| 1167 | Ga0495586_0006885 | |||
| 1168 | Ga0495586_0073500 | |||
| 1169 | Ga0495586_0318002 | |||
| 1170 | Ga0495586_0681518 | |||
| 1171 | Ga0495587_0000362 | |||
| 1172 | Ga0495587_0055105 | |||
| 1173 | Ga0495587_0253660 | |||
| 1174 | Ga0495587_0386352 | |||
| 1175 | Ga0495598_0199767 | |||
| 1176 | Ga0495609_0042234 | |||
| 1177 | Ga0495645_0000016 | |||
| 1178 | Ga0495645_0070810 | |||
| 1179 | Ga0495645_0129414 | |||
| 1180 | Ga0495645_0193348 | |||
| 1181 | Ga0495645_0202667 | |||
| 1182 | Ga0495622_0481006 | |||
| 1183 | Ga0495633_0349187 | |||
| 1184 | Ga0495667_0004608 | |||
| 1185 | Ga0495667_0077714 | |||
| 1186 | Ga0495667_0605370 | |||
| 1187 | Ga0495656_0003724 | |||
| 1188 | Ga0495668_0102074 | |||
| 1189 | Ga0495634_0028217 | |||
| 1190 | Ga0495634_0075911 | |||
| 1191 | Ga0495634_0115068 | |||
| 1192 | Ga0495634_0154586 | |||
| 1193 | Ga0495634_0198049 | |||
| 1194 | Ga0495635_0014544 | |||
| 1195 | Ga0495635_0025715 | |||
| 1196 | Ga0495635_0040109 | |||
| 1197 | Ga0495635_0355867 | |||
| 1198 | Ga0495661_0360597 | |||
| 1199 | Ga0495657_0002580 | |||
| 1200 | Ga0495657_0015919 | |||
| 1201 | Ga0495657_0021164 | |||
| 1202 | Ga0495657_0052819 | |||
| 1203 | Ga0495657_0183879 | |||
| 1204 | Ga0495657_0214703 | |||
| 1205 | Ga0495599_0000016 | |||
| 1206 | Ga0495599_0004510 | |||
| 1207 | Ga0495599_0248521 | |||
| 1208 | Ga0495599_0251768 | |||
| 1209 | Ga0495623_0000046 | |||
| 1210 | Ga0495623_0077473 | |||
| 1211 | Ga0495623_0211278 | |||
| 1212 | Ga0495623_0553716 | |||
| 1213 | Ga0495646_0025915 | |||
| 1214 | Ga0495646_0033586 | |||
| 1215 | Ga0495646_0060609 | |||
| 1216 | Ga0495646_0183664 | |||
| 1217 | Ga0495647_0072394 | |||
| 1218 | Ga0495647_0125616 | |||
| 1219 | Ga0495647_0407283 | |||
| 1220 | Ga0495658_0033037 | |||
| 1221 | Ga0495658_0041190 | |||
| 1222 | Ga0495658_0381581 | |||
| 1223 | Ga0495658_0488155 | |||
| 1224 | Ga0495613_0011442 | |||
| 1225 | Ga0495613_0041670 | |||
| 1226 | Ga0495613_0043878 | |||
| 1227 | Ga0495613_0072674 | |||
| 1228 | Ga0495613_0535218 | |||
| 1229 | Ga0495624_0002088 | |||
| 1230 | Ga0495624_0026779 | |||
| 1231 | Ga0495624_0053690 | |||
| 1232 | Ga0495624_0527201 | |||
| 1233 | Ga0495624_0591334 | |||
| 1234 | Ga0495670_0099433 | |||
| 1235 | Ga0495589_0008255 | |||
| 1236 | Ga0495600_0007328 | |||
| 1237 | Ga0495600_0056591 | |||
| 1238 | Ga0495600_0441938 | |||
| 1239 | Ga0495581_0003449 | |||
| 1240 | Ga0495581_0011316 | |||
| 1241 | Ga0495581_0409028 | |||
| 1242 | Ga0495604_0000004 | |||
| 1243 | Ga0495604_0172719 | |||
| 1244 | Ga0495604_0249625 | |||
| 1245 | Ga0495604_0478053 | |||
| 1246 | Ga0495636_0007524 | |||
| 1247 | Ga0495674_0044630 | |||
| 1248 | Ga0495674_0063639 | |||
| 1249 | Ga0495674_0267128 | |||
| 1250 | Ga0495674_0295200 | |||
| 1251 | Ga0495674_0551340 | |||
| 1252 | Ga0495674_1011012 | |||
| 1253 | Ga0495676_0002477 | |||
| 1254 | Ga0495676_0058336 | |||
| 1255 | Ga0495676_0065571 | |||
| 1256 | Ga0495676_0219198 | |||
| 1257 | Ga0495676_0332703 | |||
| 1258 | Ga0495680_0005384 | |||
| 1259 | Ga0495680_0009560 | |||
| 1260 | Ga0495680_0038117 | |||
| 1261 | Ga0495680_0047161 | |||
| 1262 | Ga0495680_0088959 | |||
| 1263 | Ga0495680_0313298 | |||
| 1264 | Ga0495680_0532180 | |||
| 1265 | Ga0495680_0817197 | |||
| 1266 | Ga0495675_0000079 | |||
| 1267 | Ga0495675_0195848 | |||
| 1268 | Ga0495675_0535803 | |||
| 1269 | Ga0495675_0609177 | |||
| 1270 | Ga0495677_0017805 | |||
| 1271 | Ga0495684_0000645 | |||
| 1272 | Ga0495684_0017796 | |||
| 1273 | Ga0495684_0031240 | |||
| 1274 | Ga0495684_0046578 | |||
| 1275 | Ga0495684_0052536 | |||
| 1276 | Ga0495684_0252050 | |||
| 1277 | Ga0495593_0000866 | |||
| 1278 | Ga0495593_0128411 | |||
| 1279 | Ga0495593_0317927 | |||
| 1280 | Ga0495602_0000351 | |||
| 1281 | Ga0495602_0028726 | |||
| 1282 | Ga0495602_0800576 | |||
| 1283 | Ga0495614_0000905 | |||
| 1284 | Ga0495614_0047467 | |||
| 1285 | Ga0496100_0118754 | |||
| 1286 | Ga0496100_0770734 | |||
| 1287 | Ga0496101_0008498 | |||
| 1288 | Ga0496101_0372243 | |||
| 1289 | Ga0496101_0553812 | |||
| 1290 | Ga0496102_0026078 | |||
| 1291 | Ga0496102_1861532 | |||
| 1292 | Ga0496103_0066187 | |||
| 1293 | Ga0496104_0006660 | |||
| 1294 | Ga0496104_0356150 | |||
| 1295 | Ga0496104_0744001 | |||
| 1296 | Ga0496105_0021247 | |||
| 1297 | Ga0496105_0163088 | |||
| 1298 | Ga0496105_0530932 | |||
| 1299 | Ga0496105_0606896 | |||
| 1300 | Ga0496106_0007968 | |||
| 1301 | Ga0496106_0487676 | |||
| 1302 | Ga0496107_0002716 | |||
| 1303 | Ga0496107_0378328 | |||
| 1304 | Ga0496108_0083404 | |||
| 1305 | Ga0496108_0174097 | |||
| 1306 | Ga0496109_0004583 | |||
| 1307 | Ga0496109_0023841 | |||
| 1308 | Ga0496109_0253724 | |||
| 1309 | Ga0496109_0413991 | |||
| 1310 | Ga0496109_1519540 | |||
| 1311 | Ga0496110_0044469 | |||
| 1312 | Ga0496110_0075716 | |||
| 1313 | Ga0496111_0011638 | |||
| 1314 | Ga0496111_0026782 | |||
| 1315 | Ga0496111_0194033 | |||
| 1316 | Ga0496112_0064490 | |||
| 1317 | Ga0496112_0075929 | |||
| 1318 | Ga0496112_0169430 | |||
| 1319 | Ga0496112_0586061 | |||
| 1320 | Ga0496113_0165870 | |||
| 1321 | Ga0496113_0389624 | |||
| 1322 | Ga0496114_0033121 | |||
| 1323 | Ga0496114_0113958 | |||
| 1324 | Ga0496114_0741324 | |||
| 1325 | Ga0496114_1090376 | |||
| 1326 | Ga0496115_0020232 | |||
| 1327 | Ga0496115_0021438 | |||
| 1328 | Ga0496115_0023462 | |||
| 1329 | Ga0496115_0557473 | |||
| 1330 | Ga0496115_0597037 | |||
| 1331 | Ga0496115_1096939 | |||
| 1332 | Ga0501067_0147360 | |||
| 1333 | Ga0501067_0661916 | |||
| 1334 | Ga0501069_0050525 | |||
| 1335 | Ga0501069_0083442 | |||
| 1336 | Ga0501069_0727667 | |||
| 1337 | Ga0501070_0164884 | |||
| 1338 | Ga0501070_0742066 | |||
| 1339 | nmdc:mga0n895_1076039_c1 | |||
| 1340 | nmdc:mga0n895_297973_c1 | |||
| 1341 | nmdc:mga0n895_7131_c1 | |||
| 1342 | nmdc:mga08x19_135638_c1 | |||
| 1343 | Ga0495601_0000896 | |||
| 1344 | Ga0495601_0006440 | |||
| 1345 | Ga0495601_0022478 | |||
| 1346 | Ga0495601_0022650 | |||
| 1347 | Ga0495601_0033732 | |||
| 1348 | Ga0495601_0050099 | |||
| 1349 | Ga0495601_0163170 | |||
| 1350 | Ga0495601_0335830 | |||
| 1351 | Ga0495601_0511871 | |||
| 1352 | Ga0495601_0571726 | |||
| 1353 | Ga0495612_0021572 | |||
| 1354 | Ga0495612_0055570 | |||
| 1355 | Ga0495612_0069883 | |||
| 1356 | Ga0495612_0203202 | |||
| 1357 | Ga0495612_0290056 | |||
| 1358 | Ga0495612_0306851 | |||
| 1359 | Ga0495595_0001772 | |||
| 1360 | Ga0495595_0018601 | |||
| 1361 | Ga0495595_0024266 | |||
| 1362 | Ga0495595_0102645 | |||
| 1363 | Ga0495595_0340496 | |||
| 1364 | Ga0495619_0000199 | |||
| 1365 | Ga0495619_0007740 | |||
| 1366 | Ga0495619_0023268 | |||
| 1367 | Ga0495619_0052727 | |||
| 1368 | Ga0495619_0093167 | |||
| 1369 | Ga0495619_0123837 | |||
| 1370 | Ga0495619_0171462 | |||
| 1371 | Ga0466962_0018121 | |||
| 1372 | Ga0466962_0027520 | |||
| 1373 | Ga0466962_0077606 | |||
| 1374 | Ga0466962_0097051 | |||
| 1375 | Ga0466962_0098321 | |||
| 1376 | Ga0466962_0213967 | |||
| 1377 | Ga0466962_0223526 | |||
| 1378 | Ga0530510_0398775 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3cp0-assembly1.cif.gz_A | crystal structure of the soluble domain of membrane protein implicated in regulation of membrane protease activity from corynebacterium glutamicum | 0.9819 | 83 | 142 |
| 3cp0-assembly1.cif.gz_A | crystal structure of the soluble domain of membrane protein implicated in regulation of membrane protease activity from corynebacterium glutamicum | 0.9217 | 83 | 142 |
| 3wwv-assembly1.cif.gz_A-2 | c-terminal domain of stomatin operon partner protein 1510-c from pyrococcus horikoshii | 0.8795 | 80 | 140 |
| 2exd-assembly1.cif.gz_A | the solution structure of the c-terminal domain of a nfed homolog from pyrococcus horikoshii | 0.8437 | 86 | 142 |
| 3wwv-assembly1.cif.gz_A-2 | c-terminal domain of stomatin operon partner protein 1510-c from pyrococcus horikoshii | 0.803 | 80 | 140 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P71767_83_144_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9977 | 85 | 142 | 2.40.50.140 |
| 3cp0A00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9718 | 83 | 142 | 2.40.50.140 |
| af_Q2FXZ8_166_227_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9368 | 81 | 141 | 2.40.50.140 |
| af_P71767_83_144_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9188 | 85 | 142 | 2.40.50.140 |
| 3cp0A00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9116 | 83 | 142 | 2.40.50.140 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7R7DQG5-F1-model_v4 | NfeD-like C-terminal domain-containing protein | 1 | 85 | 142 |
|
| AF-A0A6I5F7R2-F1-model_v4 | deleted | 0.9814 | 81 | 141 |
|
| AF-A0A7G1IET6-F1-model_v4 | NfeD-like C-terminal domain-containing protein | 0.9746 | 81 | 142 |
|
| AF-U1FFM5-F1-model_v4 | NfeD-like C-terminal domain-containing protein | 0.9579 | 89 | 141 |
|
| AF-A0A6P0YDT6-F1-model_v4 | NfeD family protein | 0.95 | 87 | 141 |
|