F475359

General Info

Members Datasets Scaffolds Average Seq Length
688 317 665 213

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2855386786|2855387000
Length 238
Sequence SPTSPKASPDASPEASPDASGMPADLLAHARAAKGFMPEDEGLLLHRAARERLSHGPVLEVGTYCGKSAIYLGAAARAVGGPQAVVFTVDHHRGSEENQAGWEHHDATLVDDEFGLMDTLPVFRKTLARAGLEDQVVAVVGRSTTVAAHWRTPLSMLFIDGGHAEEHAQNDYTGWAHWLMRDGLLVIHDVFPDPADGGQPPYHVFLRALQSGAFTEVEAVGSMRVLRRTAGDVGERVG

Samples

Sample ID Description Type Environment
1 2643221576 Nocardioides sp. Root614 Isolate Unclassified
2 2643221590 Nocardioides sp. Root682 Isolate Unclassified
3 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
4 2643221615 Nocardioides sp. Root224 Isolate Unclassified
5 2643221617 Nocardioides sp. Root79 Isolate Unclassified
6 2643221620 Nocardioides sp. Root240 Isolate Unclassified
7 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
8 2643221641 Nocardioides sp. Root122 Isolate Unclassified
9 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
10 2643221697 Aeromicrobium sp. Root495 Isolate Unclassified
11 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
12 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
13 2738541305 Nocardioides sp. CF167 Isolate Unclassified
14 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
15 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
16 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
17 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
18 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
19 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
20 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
21 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
22 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
23 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
24 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
25 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
26 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
27 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
28 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
29 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
30 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
31 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
32 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
33 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
34 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
35 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
36 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
37 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
38 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
39 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
40 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
41 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
42 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
43 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
44 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
45 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
46 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
50 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
51 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
52 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
53 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
71 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
72 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
73 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
74 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
75 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
76 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
77 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
78 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
79 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
83 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
84 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
110 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
151 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
152 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
153 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
154 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
155 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
156 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
157 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
158 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
159 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
160 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
161 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
162 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
163 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
164 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
165 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
166 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
167 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
168 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
169 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
170 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
172 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
173 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
174 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
175 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
176 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
177 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
178 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
179 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
180 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
181 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
182 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
183 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
184 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
185 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
186 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
187 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
188 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
189 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
190 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
191 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
192 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
193 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
194 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
195 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
196 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
197 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
198 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
199 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
200 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
201 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
202 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
203 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
204 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
205 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
206 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
207 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
208 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
209 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
210 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
211 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
212 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
213 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
214 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
215 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
216 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
217 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
218 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
219 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
220 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
221 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
222 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
223 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
224 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
225 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
226 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
227 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
228 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
229 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
230 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
231 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
232 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
233 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
234 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
235 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
236 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
237 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
238 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
239 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
240 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
241 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
242 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
243 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
244 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
245 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
246 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
247 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
248 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
249 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
250 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
251 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
252 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
253 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
254 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
255 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
256 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
257 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
273 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
274 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
275 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
276 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
277 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
278 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
279 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
280 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
281 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
282 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
283 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
284 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
285 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
286 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
287 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
290 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
291 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
292 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
293 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
294 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
295 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
296 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
297 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
298 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
299 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
300 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
301 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
302 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
303 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
304 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
305 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
306 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
307 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
308 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
309 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
310 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
311 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
312 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
313 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
314 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
315 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
316 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
317 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.08
Metatranscriptomes 0.58
Isolates 3.34

Biome Distribution

Category Percentage (%)
Aerial Root 0.29
Bulb 0
Endosphere 11.05
Nodule 0
Rhizoplane 7.12
Rhizosphere 77.47
Stem 0
Stem Tuber 0
Unclassified 4.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24743J22301_10027988 3300001991 Bacteria 1102
2 JGI24738J21930_10006398 3300002075 Bacteria 2766
3 JGI24749J21850_1008884 3300002076 Bacteria 1402
4 JGI24744J21845_10013945 3300002077 Bacteria 1619
5 Ga0070658_10234953 3300005327 Bacteria 1553
6 Ga0070658_10447247 3300005327 Bacteria 1113
7 Ga0070683_100054908 3300005329 Bacteria 3695
8 Ga0070683_100243511 3300005329 Bacteria 1710
9 Ga0070683_100309553 3300005329 Bacteria 1503
10 Ga0070683_100329228 3300005329 Bacteria 1454
11 Ga0070690_100126953 3300005330 Bacteria 1718
12 Ga0070670_100723733 3300005331 Bacteria 896
13 Ga0068869_100192843 3300005334 Bacteria 1603
14 Ga0068869_100344200 3300005334 Bacteria 1214
15 Ga0070680_100695111 3300005336 Bacteria 875
16 Ga0070682_100006463 3300005337 Bacteria 6591
17 Ga0070660_100054582 3300005339 Bacteria 3086
18 Ga0070691_10128702 3300005341 Bacteria 1281
19 Ga0070687_100030755 3300005343 Bacteria 2627
20 Ga0070687_100078245 3300005343 Bacteria 1797
21 Ga0070692_10007019 3300005345 Bacteria 4936
22 Ga0070675_100213314 3300005354 Bacteria 1679
23 Ga0070675_100593667 3300005354 Bacteria 1004
24 Ga0070674_100721707 3300005356 Bacteria 854
25 Ga0070673_100789988 3300005364 Bacteria 876
26 Ga0070688_100080592 3300005365 Bacteria 2106
27 Ga0070659_100018976 3300005366 Bacteria 5199
28 Ga0070659_100138654 3300005366 Bacteria 1979
29 Ga0070659_100268611 3300005366 Bacteria 1417
30 Ga0070667_100050973 3300005367 Bacteria 3489
31 Ga0070667_100518333 3300005367 Bacteria 1094
32 Ga0070667_100560210 3300005367 Bacteria 1051
33 Ga0070701_10010297 3300005438 Bacteria 4129
34 Ga0070700_100016157 3300005441 Bacteria 4247
35 Ga0070700_100439711 3300005441 Bacteria 990
36 Ga0070663_100192987 3300005455 Bacteria 1586
37 Ga0070678_100502337 3300005456 Bacteria 1070
38 Ga0070681_10543037 3300005458 Bacteria 1076
39 Ga0070681_10834885 3300005458 Bacteria 839
40 Ga0068867_100012515 3300005459 Bacteria 6004
41 Ga0070685_10065114 3300005466 Bacteria 2145
42 Ga0070698_100005155 3300005471 Bacteria 14294
43 Ga0070684_100003260 3300005535 Bacteria 12158
44 Ga0070684_100100174 3300005535 Bacteria 2587
45 Ga0070684_100183675 3300005535 Bacteria 1902
46 Ga0070684_100948955 3300005535 Bacteria 806
47 Ga0068853_100232183 3300005539 Bacteria 1688
48 Ga0068853_100795626 3300005539 Bacteria 905
49 Ga0070672_100043380 3300005543 Bacteria 3468
50 Ga0070686_100024818 3300005544 Bacteria 3597
51 Ga0070693_100050725 3300005547 Bacteria 2373
52 Ga0070665_100002233 3300005548 Bacteria 21582
53 Ga0070665_100135805 3300005548 Bacteria 2462
54 Ga0070665_100642029 3300005548 Bacteria 1074
55 Ga0070665_100783054 3300005548 Bacteria 967
56 Ga0068855_100137711 3300005563 Bacteria 2784
57 Ga0068855_100289286 3300005563 Bacteria 1817
58 Ga0068857_100035657 3300005577 Bacteria 4406
59 Ga0068857_100395131 3300005577 Bacteria 1286
60 Ga0068857_100855109 3300005577 Bacteria 871
61 Ga0068856_100013871 3300005614 Bacteria 7794
62 Ga0070702_100003103 3300005615 Bacteria 7356
63 Ga0070702_100200321 3300005615 Bacteria 1321
64 Ga0068852_100029857 3300005616 Bacteria 4481
65 Ga0068852_100776866 3300005616 Bacteria 971
66 Ga0068859_100000803 3300005617 Bacteria 31879
67 Ga0068864_100531625 3300005618 Bacteria 1135
68 Ga0068861_100025002 3300005719 Bacteria 4324
69 Ga0068861_100343025 3300005719 Bacteria 1308
70 Ga0068870_10059388 3300005840 Bacteria 2050
71 Ga0068858_100231778 3300005842 Bacteria 1751
72 Ga0068862_100000737 3300005844 Bacteria 32919
73 Ga0081455_10000174 3300005937 Bacteria 80174
74 Ga0081455_10000653 3300005937 Bacteria 44988
75 Ga0081455_10040344 3300005937 Bacteria 4118
76 Ga0081538_10045441 3300005981 Bacteria 2723
77 Ga0081539_10014044 3300005985 Bacteria 5961
78 Ga0075365_10003301 3300006038 Bacteria 8279
79 Ga0075365_10003456 3300006038 Bacteria 8141
80 Ga0075365_10007349 3300006038 Bacteria 6162
81 Ga0075365_10039837 3300006038 Bacteria 3062
82 Ga0075365_10131074 3300006038 Bacteria 1735
83 Ga0075365_10139299 3300006038 Bacteria 1683
84 Ga0075365_10266368 3300006038 Bacteria 1205
85 Ga0075365_10289082 3300006038 Bacteria 1153
86 Ga0075365_10433261 3300006038 Bacteria 928
87 Ga0075368_10091502 3300006042 Bacteria 1244
88 Ga0075363_100022337 3300006048 Bacteria 3197
89 Ga0075363_100035613 3300006048 Bacteria 2606
90 Ga0075363_100056219 3300006048 Bacteria 2109
91 Ga0075363_100064460 3300006048 Bacteria 1979
92 Ga0075363_100163817 3300006048 Bacteria 1260
93 Ga0075364_10003049 3300006051 Bacteria 9462
94 Ga0075364_10044940 3300006051 Bacteria 2874
95 Ga0075364_10119465 3300006051 Bacteria 1764
96 Ga0075364_10154173 3300006051 Bacteria 1549
97 Ga0075364_10272466 3300006051 Bacteria 1151
98 Ga0075364_10371409 3300006051 Bacteria 975
99 Ga0075362_10071379 3300006177 Bacteria 1586
100 Ga0075367_10000369 3300006178 Bacteria 16254
101 Ga0075367_10008834 3300006178 Bacteria 5241
102 Ga0075367_10218629 3300006178 Bacteria 1192
103 Ga0075367_10581789 3300006178 Bacteria 711
104 Ga0075370_10017918 3300006353 Bacteria 3833
105 Ga0075370_10021899 3300006353 Bacteria 3504
106 Ga0075370_10046364 3300006353 Bacteria 2460
107 Ga0075370_10216092 3300006353 Bacteria 1132
108 Ga0068871_100436141 3300006358 Bacteria 1172
109 Ga0075428_100374177 3300006844 Bacteria 1527
110 Ga0075430_100164179 3300006846 Bacteria 1848
111 Ga0075431_100072677 3300006847 Bacteria 3549
112 Ga0075434_100310964 3300006871 Bacteria 1596
113 Ga0068865_100062735 3300006881 Bacteria 2609
114 Ga0068865_100096430 3300006881 Bacteria 2156
115 Ga0097620_100000803 3300006931 Bacteria 31879
116 Ga0111539_11122315 3300009094 Bacteria 914
117 Ga0105245_10005813 3300009098 Bacteria 10826
118 Ga0105245_10049450 3300009098 Bacteria 3765
119 Ga0105245_10118657 3300009098 Bacteria 2469
120 Ga0114129_10430248 3300009147 Bacteria 1734
121 Ga0114129_10506070 3300009147 Bacteria 1577
122 Ga0114129_12074325 3300009147 Bacteria 686
123 Ga0105243_10034754 3300009148 Bacteria 3906
124 Ga0105243_10363985 3300009148 Bacteria 1332
125 Ga0105242_10142209 3300009176 Bacteria 2083
126 Ga0105242_10333462 3300009176 Bacteria 1395
127 Ga0105248_10024173 3300009177 Bacteria 6753
128 Ga0105248_10662485 3300009177 Bacteria 1178
129 Ga0105237_10024005 3300009545 Bacteria 6239
130 Ga0105238_10845125 3300009551 Bacteria 932
131 Ga0105249_10247605 3300009553 Bacteria 1765
132 Ga0105249_11103153 3300009553 Bacteria 864
133 Ga0105239_10005059 3300010375 Bacteria 15578
134 Ga0105239_10057126 3300010375 Bacteria 4281
135 Ga0105239_10375404 3300010375 Bacteria 1607
136 Ga0105239_10570938 3300010375 Bacteria 1289
137 Ga0157371_10318746 3300013102 Bacteria 1128
138 Ga0157369_10244425 3300013105 Bacteria 1874
139 Ga0157369_10704736 3300013105 Bacteria 1039
140 Ga0157369_10868025 3300013105 Bacteria 926
141 Ga0157378_10653417 3300013297 Bacteria 1067
142 Ga0157372_10336115 3300013307 Bacteria 1759
143 Ga0157372_10453037 3300013307 Bacteria 1495
144 Ga0157375_10007170 3300013308 Bacteria 9744
145 Ga0157375_10170764 3300013308 Bacteria 2322
146 Ga0157375_10187919 3300013308 Bacteria 2220
147 Ga0157375_10310984 3300013308 Bacteria 1740
148 Ga0157375_11637636 3300013308 Bacteria 761
149 Ga0157375_11738631 3300013308 Bacteria 739
150 Ga0163163_10036031 3300014325 Bacteria 4803
151 Ga0163163_10179740 3300014325 Bacteria 2163
152 Ga0163163_10418852 3300014325 Bacteria 1398
153 Ga0163163_10802272 3300014325 Bacteria 1005
154 Ga0157380_10042357 3300014326 Bacteria 3559
155 Ga0157380_10192436 3300014326 Bacteria 1802
156 Ga0157380_10876349 3300014326 Bacteria 922
157 Ga0157377_10030982 3300014745 Bacteria 2903
158 Ga0157379_11065282 3300014968 Bacteria 773
159 Ga0157379_11091617 3300014968 Bacteria 764
160 Ga0157376_10115402 3300014969 Bacteria 2371
161 Ga0163161_10439361 3300017792 Bacteria 1053
162 Ga0163161_10515782 3300017792 Bacteria 975
163 Ga0206353_10819393 3300020082 Bacteria 1971
164 Ga0206353_10844963 3300020082 Bacteria 3688
165 Ga0213875_10082824 3300021388 Bacteria 1497
166 Ga0207688_10006221 3300025901 Bacteria 6493
167 Ga0207688_10365722 3300025901 Bacteria 891
168 Ga0207647_10055544 3300025904 Bacteria 2433
169 Ga0207647_10071719 3300025904 Bacteria 2089
170 Ga0207643_10005923 3300025908 Bacteria 6528
171 Ga0207643_10241858 3300025908 Bacteria 1110
172 Ga0207705_10024073 3300025909 Bacteria 4345
173 Ga0207705_10351347 3300025909 Bacteria 1136
174 Ga0207707_10660624 3300025912 Bacteria 880
175 Ga0207663_10041402 3300025916 Bacteria 2808
176 Ga0207660_10307178 3300025917 Bacteria 1264
177 Ga0207662_10044104 3300025918 Bacteria 2632
178 Ga0207657_10061364 3300025919 Bacteria 3224
179 Ga0207652_10114067 3300025921 Bacteria 2399
180 Ga0207652_10160546 3300025921 Bacteria 2015
181 Ga0207687_10032584 3300025927 Bacteria 3530
182 Ga0207687_10050619 3300025927 Bacteria 2892
183 Ga0207687_10622700 3300025927 Bacteria 911
184 Ga0207690_10010917 3300025932 Bacteria 5415
185 Ga0207690_10182349 3300025932 Bacteria 1582
186 Ga0207686_10242325 3300025934 Bacteria 1313
187 Ga0207686_10366478 3300025934 Bacteria 1089
188 Ga0207709_10011145 3300025935 Bacteria 4958
189 Ga0207670_10133163 3300025936 Bacteria 1824
190 Ga0207669_10481336 3300025937 Bacteria 989
191 Ga0207704_10103639 3300025938 Bacteria 1903
192 Ga0207704_10433438 3300025938 Bacteria 1045
193 Ga0207665_10474220 3300025939 Bacteria 963
194 Ga0207691_10019859 3300025940 Bacteria 6355
195 Ga0207711_10316935 3300025941 Bacteria 1440
196 Ga0207711_10513266 3300025941 Bacteria 1117
197 Ga0207711_10654927 3300025941 Bacteria 980
198 Ga0207689_10052657 3300025942 Bacteria 3353
199 Ga0207661_10078143 3300025944 Bacteria 2723
200 Ga0207661_10416773 3300025944 Bacteria 1219
201 Ga0207661_10540064 3300025944 Bacteria 1067
202 Ga0207679_10064055 3300025945 Bacteria 2746
203 Ga0207679_10447519 3300025945 Bacteria 1145
204 Ga0207667_10143257 3300025949 Bacteria 2460
205 Ga0207667_10257811 3300025949 Bacteria 1783
206 Ga0207668_10490810 3300025972 Bacteria 1055
207 Ga0207658_10117652 3300025986 Bacteria 2113
208 Ga0207658_10274665 3300025986 Bacteria 1442
209 Ga0207677_10525243 3300026023 Bacteria 1027
210 Ga0207639_10276562 3300026041 Bacteria 1475
211 Ga0207678_10258548 3300026067 Bacteria 1492
212 Ga0207708_10002108 3300026075 Bacteria 14651
213 Ga0207708_10183758 3300026075 Bacteria 1661
214 Ga0207648_10028837 3300026089 Bacteria 4920
215 Ga0207676_10091364 3300026095 Bacteria 2501
216 Ga0207674_10006182 3300026116 Bacteria 14128
217 Ga0207674_10741718 3300026116 Bacteria 948
218 Ga0207675_100008177 3300026118 Bacteria 9860
219 Ga0207675_100120472 3300026118 Bacteria 2482
220 Ga0207675_100506869 3300026118 Bacteria 1202
221 Ga0207683_10091161 3300026121 Bacteria 2715
222 Ga0207683_10161648 3300026121 Bacteria 2025
223 Ga0207698_10154448 3300026142 Bacteria 1997
224 Ga0207698_10387871 3300026142 Bacteria 1331
225 Ga0209813_10007573 3300027866 Bacteria 2708
226 Ga0268266_10032400 3300028379 Bacteria 4440
227 Ga0268266_10362948 3300028379 Bacteria 1363
228 Ga0268265_10000124 3300028380 Bacteria 96763
229 Ga0268265_10849848 3300028380 Bacteria 893
230 Ga0268264_10000896 3300028381 Bacteria 31371
231 Ga0265327_10000566 3300031251 Bacteria 62909
232 Ga0265327_10001801 3300031251 Bacteria 25152
233 Ga0265327_10042533 3300031251 Bacteria 2438
234 Ga0265327_10113768 3300031251 Bacteria 1290
235 Ga0316576_10014866 3300031727 Bacteria 5208
236 Ga0316576_10088499 3300031727 Bacteria 2305
237 Ga0316576_10108804 3300031727 Bacteria 2077
238 Ga0316578_10056478 3300031728 Bacteria 2306
239 Ga0316578_10076503 3300031728 Bacteria 1987
240 Ga0307405_10157897 3300031731 Bacteria 1603
241 Ga0316577_10088639 3300031733 Bacteria 1732
242 Ga0307413_10072525 3300031824 Bacteria 2174
243 Ga0307413_10075950 3300031824 Bacteria 2134
244 Ga0307413_10299002 3300031824 Bacteria 1220
245 Ga0307406_10428522 3300031901 Bacteria 1056
246 Ga0307407_10051531 3300031903 Bacteria 2360
247 Ga0307407_10450623 3300031903 Bacteria 934
248 Ga0307409_100153320 3300031995 Bacteria 2004
249 Ga0307409_100507452 3300031995 Bacteria 1176
250 Ga0307416_100178344 3300032002 Bacteria 1988
251 Ga0307416_101058257 3300032002 Bacteria 915
252 Ga0307411_10223069 3300032005 Bacteria 1464
253 Ga0316585_10042380 3300032137 Bacteria 1452
254 Ga0316580_10015536 3300032139 Bacteria 2330
255 Ga0316580_10038850 3300032139 Bacteria 1471
256 Ga0373956_0028549 3300035119 Bacteria 2429
257 Ga0373955_0063454 3300035172 Bacteria 2046
258 Ga0373931_0218396 3300035691 Bacteria 1147
259 Ga0373931_0224540 3300035691 Bacteria 1132
260 Ga0373931_0465064 3300035691 Bacteria 811
261 Ga0373935_0240015 3300035692 Bacteria 1265
262 Ga0373937_0009558 3300036401 Bacteria 8436
263 Ga0373937_0114013 3300036401 Bacteria 2516
264 Ga0316582_0003575 3300036647 Bacteria 7655
265 Ga0316582_0140481 3300036647 Bacteria 1628
266 Ga0316584_0003428 3300036712 Bacteria 10290
267 Ga0373925_0118221 3300037068 Bacteria 2055
268 Ga0373925_0399595 3300037068 Bacteria 1121
269 Ga0395899_0188287 3300037312 Bacteria 1445
270 Ga0395900_0073930 3300037418 Bacteria 3505
271 Ga0395898_0019357 3300037466 Bacteria 6929
272 Ga0395905_0478543 3300037471 Bacteria 1144
273 Ga0436364_1214371 3300037853 Bacteria 3677
274 Ga0395901_0056357 3300038443 Bacteria 4088
275 Ga0395901_0077142 3300038443 Bacteria 3478
276 Ga0395901_0213896 3300038443 Bacteria 2016
277 Ga0400483_099246 3300039062 Bacteria 2992
278 Ga0400483_196263 3300039062 Bacteria 1526
279 Ga0436360_1190046 3300039438 Bacteria 1463
280 Ga0439465_0019987 3300041413 Bacteria 2095
281 Ga0439465_0063799 3300041413 Bacteria 1224
282 Ga0439465_0100993 3300041413 Bacteria 996
283 Ga0451793_0452152 3300041452 Bacteria 7256
284 Ga0451793_1437933 3300041452 Bacteria 915
285 Ga0451797_1225711 3300041453 Bacteria 1604
286 Ga0451802_0440054 3300041460 Bacteria 673
287 Ga0451807_1625867 3300041486 Bacteria 726
288 Ga0451833_0784683 3300041491 Bacteria 4948
289 Ga0451837_0189149 3300041494 Bacteria 5461
290 Ga0451855_0291083 3300041511 Bacteria 1332
291 Ga0439431_0017535 3300041997 Bacteria 1685
292 Ga0439445_0015452 3300042004 Bacteria 1869
293 Ga0439445_0052336 3300042004 Bacteria 1104
294 Ga0439448_0006929 3300042005 Bacteria 3270
295 Ga0439432_098440 3300042006 Bacteria 876
296 Ga0439450_003860 3300042008 Bacteria 2515
297 Ga0439463_013607 3300042016 Bacteria 2003
298 Ga0450896_001669 3300042133 Bacteria 2779
299 Ga0450898_001181 3300042134 Bacteria 3370
300 Ga0450899_001338 3300042135 Bacteria 2768
301 Ga0450906_001520 3300042145 Bacteria 5064
302 Ga0439446_0019251 3300042156 Bacteria 1918
303 Ga0439446_0130744 3300042156 Bacteria 814
304 Ga0439434_0012377 3300042435 Bacteria 2525
305 Ga0439460_0001148 3300042461 Bacteria 6200
306 Ga0466969_0054372 3300044656 Bacteria 1961
307 Ga0466969_0117424 3300044656 Bacteria 1241
308 Ga0466972_0097871 3300044658 Bacteria 1389
309 Ga0466972_0139428 3300044658 Bacteria 1141
310 Ga0466965_0012980 3300044683 Bacteria 3924
311 Ga0466965_0015494 3300044683 Bacteria 3622
312 Ga0466965_0043278 3300044683 Bacteria 2223
313 Ga0466965_0190861 3300044683 Bacteria 1084
314 Ga0466965_0345241 3300044683 Bacteria 814
315 Ga0466966_0058497 3300044684 Bacteria 2436
316 Ga0466966_0074518 3300044684 Bacteria 2121
317 Ga0466966_0099234 3300044684 Bacteria 1802
318 Ga0466961_0005909 3300044693 Bacteria 7756
319 Ga0466961_0055360 3300044693 Bacteria 2529
320 Ga0466961_0056489 3300044693 Bacteria 2501
321 Ga0466961_0142759 3300044693 Bacteria 1498
322 Ga0466961_0286085 3300044693 Bacteria 1008
323 Ga0466963_0026729 3300044694 Bacteria 3693
324 Ga0466963_0042027 3300044694 Bacteria 3000
325 Ga0466963_0063523 3300044694 Bacteria 2471
326 Ga0466963_0077425 3300044694 Bacteria 2247
327 Ga0466963_0216703 3300044694 Bacteria 1340
328 Ga0466964_0013333 3300044706 Bacteria 3118
329 Ga0466964_0039340 3300044706 Bacteria 1905
330 Ga0466971_0039421 3300044719 Bacteria 2120
331 Ga0466971_0059969 3300044719 Bacteria 1719
332 Ga0466970_0069565 3300044765 Bacteria 1892
333 Ga0466970_0076767 3300044765 Bacteria 1800
334 Ga0466970_0126414 3300044765 Bacteria 1402
335 Ga0466970_0179342 3300044765 Bacteria 1175
336 Ga0466957_0016152 3300044842 Bacteria 4364
337 Ga0466957_0102272 3300044842 Bacteria 1807
338 Ga0466957_0161881 3300044842 Bacteria 1454
339 Ga0466960_0002698 3300044901 Bacteria 6706
340 Ga0466960_0015309 3300044901 Bacteria 3304
341 Ga0466960_0060882 3300044901 Bacteria 1851
342 Ga0466960_0129024 3300044901 Bacteria 1333
343 Ga0466960_0173649 3300044901 Bacteria 1164
344 Ga0466960_0201067 3300044901 Bacteria 1089
345 Ga0466960_0204768 3300044901 Bacteria 1080
346 Ga0466960_0214232 3300044901 Bacteria 1057
347 Ga0466959_0149862 3300045049 Bacteria 1644
348 Ga0466959_0348898 3300045049 Bacteria 1009
349 Ga0451576_0243910 3300045051 Bacteria 1877
350 Ga0466958_0043742 3300045836 Bacteria 2698
351 Ga0466958_0103935 3300045836 Bacteria 1769
352 Ga0466958_0416943 3300045836 Bacteria 868
353 Ga0466967_0026909 3300045976 Bacteria 4774
354 Ga0466967_0068255 3300045976 Bacteria 3174
355 Ga0466967_0189037 3300045976 Bacteria 1945
356 Ga0466967_0195215 3300045976 Bacteria 1915
357 Ga0466967_0204158 3300045976 Bacteria 1872
358 Ga0466967_0317977 3300045976 Bacteria 1501
359 Ga0466967_1034330 3300045976 Bacteria 818
360 Ga0466967_1404095 3300045976 Bacteria 695
361 Ga0495641_0062686 3300046461 Bacteria 1676
362 Ga0495641_0065041 3300046461 Bacteria 1642
363 Ga0495641_0108335 3300046461 Bacteria 1240
364 Ga0495651_0033476 3300046462 Bacteria 4008
365 Ga0495653_0129276 3300046463 Bacteria 1790
366 Ga0495582_0132424 3300046473 Bacteria 1409
367 Ga0495608_0005189 3300046511 Bacteria 9307
368 Ga0495608_0229384 3300046511 Bacteria 1163
369 Ga0495630_0456785 3300046517 Bacteria 979
370 Ga0495630_0492233 3300046517 Bacteria 940
371 Ga0495652_0091997 3300046529 Bacteria 2479
372 Ga0495640_0388724 3300046533 Bacteria 858
373 Ga0495586_0127114 3300046535 Bacteria 1426
374 Ga0495587_0023116 3300046536 Bacteria 3822
375 Ga0495667_0006395 3300046559 Bacteria 7986
376 Ga0495657_0006237 3300046675 Bacteria 9348
377 Ga0495657_0062339 3300046675 Bacteria 2464
378 Ga0495657_0121184 3300046675 Bacteria 1647
379 Ga0495623_0132149 3300046679 Bacteria 1493
380 Ga0495623_0200778 3300046679 Bacteria 1146
381 Ga0495646_0265927 3300046680 Bacteria 915
382 Ga0495658_0231810 3300046683 Bacteria 1158
383 Ga0495624_0040007 3300046690 Bacteria 3004
384 Ga0495589_0209236 3300046794 Bacteria 919
385 Ga0495600_0083399 3300046809 Bacteria 2086
386 Ga0495600_0577108 3300046809 Bacteria 685
387 Ga0495604_0019020 3300047317 Bacteria 5501
388 Ga0495604_0121519 3300047317 Bacteria 1890
389 Ga0495676_0279106 3300047321 Bacteria 1132
390 Ga0495680_0012478 3300047322 Bacteria 7475
391 Ga0495675_0049961 3300047444 Bacteria 2658
392 Ga0495675_0057777 3300047444 Bacteria 2460
393 Ga0495593_0305302 3300047673 Bacteria 796
394 Ga0495614_0137326 3300048089 Bacteria 1085
395 Ga0496100_0225892 3300048903 Bacteria 1376
396 Ga0496100_0227808 3300048903 Bacteria 1370
397 Ga0496101_0051661 3300048904 Bacteria 2962
398 Ga0496101_0409607 3300048904 Bacteria 1068
399 Ga0496102_0026620 3300048905 Bacteria 5161
400 Ga0496102_0601567 3300048905 Bacteria 1023
401 Ga0496103_0029286 3300048906 Bacteria 3346
402 Ga0496104_0007957 3300048907 Bacteria 9398
403 Ga0496104_0063047 3300048907 Bacteria 3515
404 Ga0496104_0281643 3300048907 Bacteria 1576
405 Ga0496104_1086378 3300048907 Bacteria 704
406 Ga0496105_0000120 3300048908 Bacteria 53984
407 Ga0496105_0032956 3300048908 Bacteria 4253
408 Ga0496105_0080889 3300048908 Bacteria 2684
409 Ga0496105_0275514 3300048908 Bacteria 1358
410 Ga0496106_0014173 3300048909 Bacteria 5888
411 Ga0496106_0196199 3300048909 Bacteria 1606
412 Ga0496107_0051409 3300048910 Bacteria 2972
413 Ga0496108_0083123 3300048911 Bacteria 2716
414 Ga0496108_0110529 3300048911 Bacteria 2350
415 Ga0496108_0160735 3300048911 Bacteria 1941
416 Ga0496108_0279694 3300048911 Bacteria 1453
417 Ga0496108_0458313 3300048911 Bacteria 1114
418 Ga0496109_0050712 3300048912 Bacteria 3779
419 Ga0496109_0084261 3300048912 Bacteria 2932
420 Ga0496109_0110142 3300048912 Bacteria 2560
421 Ga0496109_0112901 3300048912 Bacteria 2527
422 Ga0496110_0016080 3300048913 Bacteria 6239
423 Ga0496110_0255915 3300048913 Bacteria 1594
424 Ga0496110_0271383 3300048913 Bacteria 1544
425 Ga0496110_0340901 3300048913 Bacteria 1365
426 Ga0496110_0344089 3300048913 Bacteria 1358
427 Ga0496110_0662401 3300048913 Bacteria 944
428 Ga0496110_0833567 3300048913 Bacteria 827
429 Ga0496111_0202049 3300048914 Bacteria 1477
430 Ga0496111_0314193 3300048914 Bacteria 1161
431 Ga0496112_0752438 3300048915 Bacteria 901
432 Ga0496112_1018341 3300048915 Bacteria 748
433 Ga0496114_0063023 3300048917 Bacteria 3103
434 Ga0496114_0068261 3300048917 Bacteria 2984
435 Ga0496114_0088306 3300048917 Bacteria 2630
436 Ga0496114_0154463 3300048917 Bacteria 1992
437 Ga0496114_0161437 3300048917 Bacteria 1949
438 Ga0496115_0194966 3300048918 Bacteria 1673
439 Ga0496126_0191536 3300048929 Bacteria 1732
440 Ga0501317_008506 3300049533 Bacteria 1183
441 Ga0501318_009274 3300049534 Bacteria 1069
442 Ga0501031_0045272 3300049568 Bacteria 2871
443 Ga0501031_0227220 3300049568 Bacteria 1215
444 Ga0501032_0004992 3300049569 Bacteria 9922
445 Ga0501032_0041431 3300049569 Bacteria 3128
446 Ga0501032_0084460 3300049569 Bacteria 2111
447 Ga0501033_0005923 3300049570 Bacteria 9598
448 Ga0501033_0011495 3300049570 Bacteria 6776
449 Ga0501033_0384792 3300049570 Bacteria 980
450 Ga0501034_0011800 3300049571 Bacteria 9043
451 Ga0501034_0013733 3300049571 Bacteria 8331
452 Ga0501034_0044210 3300049571 Bacteria 4505
453 Ga0501034_0046611 3300049571 Bacteria 4379
454 Ga0501034_0108296 3300049571 Bacteria 2770
455 Ga0501034_0300967 3300049571 Bacteria 1540
456 Ga0501036_0001691 3300049572 Bacteria 17131
457 Ga0501036_0002033 3300049572 Bacteria 15755
458 Ga0501036_0002935 3300049572 Bacteria 13537
459 Ga0501036_0178307 3300049572 Bacteria 1789
460 Ga0501036_0747063 3300049572 Bacteria 807
461 Ga0501037_0004582 3300049573 Bacteria 10045
462 Ga0501037_0010742 3300049573 Bacteria 6728
463 Ga0501037_0109559 3300049573 Bacteria 1990
464 Ga0501037_0116896 3300049573 Bacteria 1919
465 Ga0501038_0006532 3300049574 Bacteria 10786
466 Ga0501038_0026370 3300049574 Bacteria 5175
467 Ga0501038_0063465 3300049574 Bacteria 3152
468 Ga0501038_0092811 3300049574 Bacteria 2527
469 Ga0501038_0158231 3300049574 Bacteria 1843
470 Ga0501038_0364712 3300049574 Bacteria 1123
471 Ga0501039_0005557 3300049575 Bacteria 9539
472 Ga0501039_0007936 3300049575 Bacteria 8085
473 Ga0501039_0107463 3300049575 Bacteria 2180
474 Ga0501039_0124681 3300049575 Bacteria 2020
475 Ga0501040_0000672 3300049576 Bacteria 21143
476 Ga0501040_0093802 3300049576 Bacteria 2088
477 Ga0501041_0317354 3300049577 Bacteria 983
478 Ga0501042_0004438 3300049578 Bacteria 8950
479 Ga0501042_0005452 3300049578 Bacteria 8195
480 Ga0501042_0044199 3300049578 Bacteria 3173
481 Ga0501042_0064403 3300049578 Bacteria 2619
482 Ga0501042_0115683 3300049578 Bacteria 1931
483 Ga0501042_0361258 3300049578 Bacteria 1051
484 Ga0501043_0011613 3300049579 Bacteria 6894
485 Ga0501043_0033173 3300049579 Bacteria 4061
486 Ga0501043_0048207 3300049579 Bacteria 3349
487 Ga0501046_0008028 3300049580 Bacteria 9225
488 Ga0501046_0028427 3300049580 Bacteria 4553
489 Ga0501046_0078726 3300049580 Bacteria 2549
490 Ga0501046_0083454 3300049580 Bacteria 2466
491 Ga0501047_0012050 3300049581 Bacteria 8182
492 Ga0501047_0026276 3300049581 Bacteria 5600
493 Ga0501047_0052494 3300049581 Bacteria 3940
494 Ga0501047_0323976 3300049581 Bacteria 1380
495 Ga0501047_0341545 3300049581 Bacteria 1335
496 Ga0501047_0769611 3300049581 Bacteria 778
497 Ga0501048_0010763 3300049582 Bacteria 6820
498 Ga0501048_0021577 3300049582 Bacteria 4715
499 Ga0501048_0297861 3300049582 Bacteria 1147
500 Ga0501067_0002053 3300049583 Bacteria 11111
501 Ga0501067_0013627 3300049583 Bacteria 4502
502 Ga0501067_0070232 3300049583 Bacteria 1939
503 Ga0501068_0020200 3300049584 Bacteria 3878
504 Ga0501068_0036899 3300049584 Bacteria 2925
505 Ga0501068_0111959 3300049584 Bacteria 1698
506 Ga0501069_0000070 3300049585 Bacteria 52095
507 Ga0501069_0003304 3300049585 Bacteria 8275
508 Ga0501069_0640600 3300049585 Bacteria 639
509 Ga0501070_0000011 3300049586 Bacteria 191906
510 Ga0501070_0003699 3300049586 Bacteria 13215
511 Ga0501070_0006215 3300049586 Bacteria 10167
512 Ga0501070_0010553 3300049586 Bacteria 7808
513 Ga0501070_0012740 3300049586 Bacteria 7089
514 Ga0501070_0034648 3300049586 Bacteria 4219
515 Ga0501070_0054447 3300049586 Bacteria 3318
516 Ga0501070_0235703 3300049586 Bacteria 1499
517 Ga0501070_0307645 3300049586 Bacteria 1290
518 Ga0501071_0001879 3300049587 Bacteria 12471
519 Ga0501071_0002144 3300049587 Bacteria 11857
520 Ga0501071_0003221 3300049587 Bacteria 10169
521 Ga0501071_0010142 3300049587 Bacteria 6304
522 Ga0501071_0039789 3300049587 Bacteria 3364
523 Ga0501071_0041074 3300049587 Bacteria 3312
524 Ga0501071_0046239 3300049587 Bacteria 3126
525 Ga0501071_0139948 3300049587 Bacteria 1802
526 Ga0501072_0003311 3300049588 Bacteria 12116
527 Ga0501072_0015013 3300049588 Bacteria 5937
528 Ga0501072_0070277 3300049588 Bacteria 2765
529 Ga0501072_0135730 3300049588 Bacteria 1961
530 Ga0501072_0298741 3300049588 Bacteria 1280
531 Ga0501073_0004316 3300049589 Bacteria 10670
532 Ga0501073_0030490 3300049589 Bacteria 3851
533 Ga0501073_0041947 3300049589 Bacteria 3231
534 Ga0501073_0061684 3300049589 Bacteria 2616
535 Ga0501073_0238625 3300049589 Bacteria 1256
536 Ga0501074_0000999 3300049590 Bacteria 18394
537 Ga0501074_0007271 3300049590 Bacteria 8003
538 Ga0501074_0014355 3300049590 Bacteria 5763
539 Ga0501074_0026730 3300049590 Bacteria 4185
540 Ga0501074_0057010 3300049590 Bacteria 2815
541 Ga0501074_0142338 3300049590 Bacteria 1715
542 Ga0501074_0167082 3300049590 Bacteria 1571
543 Ga0501074_0176845 3300049590 Bacteria 1523
544 Ga0501074_0186762 3300049590 Bacteria 1478
545 Ga0501074_0486856 3300049590 Bacteria 874
546 Ga0501075_0000279 3300049591 Bacteria 28284
547 Ga0501075_0102658 3300049591 Bacteria 2172
548 Ga0501075_0142624 3300049591 Bacteria 1826
549 Ga0501075_0198127 3300049591 Bacteria 1532
550 Ga0501075_0297838 3300049591 Bacteria 1229
551 Ga0501076_0010194 3300049592 Bacteria 6963
552 Ga0501076_0167165 3300049592 Bacteria 1793
553 Ga0501076_0301600 3300049592 Bacteria 1313
554 Ga0501076_0431247 3300049592 Bacteria 1085
555 Ga0501077_0000632 3300049593 Bacteria 21344
556 Ga0501077_0004798 3300049593 Bacteria 8222
557 Ga0501077_0015631 3300049593 Bacteria 4780
558 Ga0501077_0036081 3300049593 Bacteria 3149
559 Ga0501077_0061143 3300049593 Bacteria 2390
560 Ga0501079_0002731 3300049741 Bacteria 12856
561 Ga0501079_0004880 3300049741 Bacteria 9941
562 Ga0501079_0071192 3300049741 Bacteria 2686
563 Ga0501079_0600061 3300049741 Bacteria 866
564 Ga0501080_0001015 3300049742 Bacteria 23068
565 Ga0501080_0006490 3300049742 Bacteria 10503
566 Ga0501080_0010183 3300049742 Bacteria 8597
567 Ga0501080_0017318 3300049742 Bacteria 6660
568 Ga0501080_0046390 3300049742 Bacteria 4046
569 Ga0501080_0085067 3300049742 Bacteria 2939
570 Ga0501080_1056524 3300049742 Bacteria 702
571 Ga0501081_0006922 3300049743 Bacteria 7368
572 Ga0501081_0222144 3300049743 Bacteria 1374
573 Ga0501081_0462293 3300049743 Bacteria 943
574 Ga0501083_0000140 3300049744 Bacteria 49326
575 Ga0501083_0005954 3300049744 Bacteria 8633
576 Ga0501083_0036475 3300049744 Bacteria 3354
577 Ga0501083_0153823 3300049744 Bacteria 1506
578 Ga0501035_0070799 3300049822 Bacteria 3089
579 Ga0501035_0383065 3300049822 Bacteria 1172
580 Ga0501044_0038860 3300049823 Bacteria 4969
581 Ga0501044_0261735 3300049823 Bacteria 1668
582 Ga0501044_0392921 3300049823 Bacteria 1300
583 Ga0501044_0495168 3300049823 Bacteria 1124
584 Ga0501045_0011714 3300049824 Bacteria 6161
585 Ga0501045_0053014 3300049824 Bacteria 2963
586 Ga0501045_0104635 3300049824 Bacteria 2097
587 Ga0501045_0358015 3300049824 Bacteria 1086
588 Ga0501045_0634028 3300049824 Bacteria 790
589 nmdc:mga03n38_10458_c1 3300050490 Bacteria 3414
590 nmdc:mga03n38_110028_c1 3300050490 Bacteria 1340
591 nmdc:mga03n38_15323_c1 3300050490 Bacteria 2958
592 nmdc:mga03n38_208628_c1 3300050490 Bacteria 1014
593 nmdc:mga03n38_371614_c1 3300050490 Bacteria 782
594 nmdc:mga03n38_65003_c1 3300050490 Bacteria 1671
595 nmdc:mga00v17_16636_c1 3300050491 Bacteria 4147
596 nmdc:mga00v17_3074_c1 3300050491 Bacteria 8576
597 nmdc:mga00v17_73061_c1 3300050491 Bacteria 2129
598 nmdc:mga0yw44_110306_c1 3300050492 Bacteria 1762
599 nmdc:mga0yw44_11576_c1 3300050492 Bacteria 4563
600 nmdc:mga0yw44_125_c2 3300050492 Bacteria 26416
601 nmdc:mga0yw44_165465_c1 3300050492 Bacteria 1450
602 nmdc:mga0yw44_194411_c1 3300050492 Bacteria 1339
603 nmdc:mga0yw44_211258_c1 3300050492 Bacteria 1284
604 nmdc:mga0yw44_239639_c1 3300050492 Bacteria 1205
605 nmdc:mga0yw44_264372_c1 3300050492 Bacteria 1147
606 nmdc:mga0yw44_266828_c1 3300050492 Bacteria 1142
607 nmdc:mga0yw44_301517_c1 3300050492 Bacteria 1074
608 nmdc:mga0yw44_3056_c1 3300050492 Bacteria 7325
609 nmdc:mga0yw44_329861_c1 3300050492 Bacteria 1025
610 nmdc:mga0yw44_386124_c1 3300050492 Bacteria 946
611 nmdc:mga0yw44_435_c1 3300050492 Bacteria 14683
612 nmdc:mga0yw44_76432_c1 3300050492 Bacteria 2090
613 nmdc:mga0yw44_77431_c1 3300050492 Bacteria 2077
614 nmdc:mga06z11_195442_c1 3300050494 Bacteria 1173
615 nmdc:mga06z11_23480_c1 3300050494 Bacteria 2898
616 nmdc:mga06z11_4639_c1 3300050494 Bacteria 5421
617 nmdc:mga06z11_499533_c1 3300050494 Bacteria 737
618 nmdc:mga06z11_62882_c1 3300050494 Bacteria 1940
619 nmdc:mga04h51_116063_c1 3300050495 Bacteria 992
620 nmdc:mga04h51_4724_c1 3300050495 Bacteria 3414
621 nmdc:mga04h51_94602_c1 3300050495 Bacteria 1080
622 nmdc:mga07m45_20544_c1 3300050496 Bacteria 3587
623 nmdc:mga05p37_824159_c1 3300050507 Bacteria 1011
624 nmdc:mga05p37_841915_c1 3300050507 Bacteria 997
625 nmdc:mga09592_1031327_c1 3300050508 Bacteria 686
626 nmdc:mga0qj67_160807_c1 3300050509 Bacteria 1823
627 nmdc:mga06r32_308979_c1 3300050510 Bacteria 1567
628 nmdc:mga08y16_479936_c1 3300050511 Bacteria 1265
629 Ga0495601_0094095 3300053077 Bacteria 1931
630 Ga0495601_0187981 3300053077 Bacteria 1350
631 Ga0495612_0112774 3300053078 Bacteria 1165
632 Ga0495655_0091543 3300053083 Bacteria 887
633 Ga0495595_0057968 3300053084 Bacteria 1807
634 Ga0495619_0004026 3300053085 Bacteria 9411
635 Ga0495619_0017291 3300053085 Bacteria 4567
636 Ga0495619_0272177 3300053085 Bacteria 1174
637 Ga0495619_0501477 3300053085 Bacteria 835
638 Ga0500644_0000499 3300053088 Bacteria 16960
639 Ga0500644_0096558 3300053088 Bacteria 1116
640 Ga0500583_0044371 3300053092 Bacteria 2036
641 Ga0500641_0001880 3300053096 Bacteria 7452
642 Ga0500641_0034811 3300053096 Bacteria 2007
643 Ga0500556_0000985 3300053104 Bacteria 15093
644 Ga0500593_001205 3300053117 Bacteria 9343
645 Ga0500655_025574 3300053133 Bacteria 1121
646 Ga0500568_0000050 3300053139 Bacteria 115722
647 Ga0500573_0007551 3300053140 Bacteria 5937
648 Ga0500573_0073995 3300053140 Bacteria 1941
649 Ga0501084_0000502 3300054114 Bacteria 30008
650 Ga0501084_0003106 3300054114 Bacteria 13460
651 Ga0501084_0011106 3300054114 Bacteria 7459
652 Ga0501084_0215016 3300054114 Bacteria 1622
653 Ga0501084_0729665 3300054114 Bacteria 835
654 Ga0501084_0732665 3300054114 Bacteria 833
655 Ga0501082_0001956 3300060353 Bacteria 18133
656 Ga0501082_0055744 3300060353 Bacteria 3404
657 Ga0501082_0458567 3300060353 Bacteria 1114
658 Ga0501082_0519489 3300060353 Bacteria 1041
659 Ga0501082_0871621 3300060353 Bacteria 788
660 Ga0466962_0086962 3300061719 Bacteria 1497
661 Ga0530510_0000347 3300061734 Bacteria 29869
662 Ga0530510_0008061 3300061734 Bacteria 7348
663 Ga0530510_0009732 3300061734 Bacteria 6745
664 Ga0530510_0358346 3300061734 Bacteria 1096
665 Ga0530510_0747794 3300061734 Bacteria 746

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009147 Ga0114129_10506070 Ga0114129_105060702 180
2 3300050507 nmdc:mga05p37_841915_c1 nmdc:mga05p37_841915_c1_190_762 180
3 3300050508 nmdc:mga09592_1031327_c1 nmdc:mga09592_1031327_c1_104_676 180
4 3300046683 Ga0495658_0231810 Ga0495658_0231810_547_1137 187
5 3300039062 Ga0400483_196263 Ga0400483_196263_42_620 189
6 3300006871 Ga0075434_100310964 Ga0075434_1003109642 190
7 3300009177 Ga0105248_10662485 Ga0105248_106624851 191
8 3300014968 Ga0157379_11091617 Ga0157379_110916171 191
9 3300025941 Ga0207711_10654927 Ga0207711_106549271 191
10 3300013308 Ga0157375_10310984 Ga0157375_103109842 196
11 3300025939 Ga0207665_10474220 Ga0207665_104742202 196
12 3300060353 Ga0501082_0458567 Ga0501082_0458567_229_846 196
13 3300046794 Ga0495589_0209236 Ga0495589_0209236_266_880 197
14 3300049586 Ga0501070_0307645 Ga0501070_0307645_651_1268 197
15 3300049585 Ga0501069_0640600 Ga0501069_0640600_24_629 198
16 3300041460 Ga0451802_0440054 Ga0451802_0440054_43_642 199
17 3300044656 Ga0466969_0117424 Ga0466969_0117424_619_1218 199
18 3300044901 Ga0466960_0060882 Ga0466960_0060882_11_610 199
19 3300044901 Ga0466960_0173649 Ga0466960_0173649_548_1147 199
20 3300045976 Ga0466967_1034330 Ga0466967_1034330_38_637 199
21 3300048907 Ga0496104_1086378 Ga0496104_1086378_89_688 199
22 3300050490 nmdc:mga03n38_371614_c1 nmdc:mga03n38_371614_c1_149_757 199
23 3300050492 nmdc:mga0yw44_264372_c1 nmdc:mga0yw44_264372_c1_35_634 199
24 3300037068 Ga0373925_0399595 Ga0373925_0399595_186_806 200
25 3300005327 Ga0070658_10447247 Ga0070658_104472471 201
26 3300006038 Ga0075365_10003301 Ga0075365_100033011 201
27 3300006038 Ga0075365_10131074 Ga0075365_101310743 201
28 3300006048 Ga0075363_100056219 Ga0075363_1000562193 201
29 3300025909 Ga0207705_10351347 Ga0207705_103513472 201
30 3300049572 Ga0501036_0747063 Ga0501036_0747063_126_770 201
31 3300050490 nmdc:mga03n38_65003_c1 nmdc:mga03n38_65003_c1_869_1492 201
32 3300050492 nmdc:mga0yw44_125_c2 nmdc:mga0yw44_125_c2_25639_26262 201
33 3300050492 nmdc:mga0yw44_194411_c1 nmdc:mga0yw44_194411_c1_704_1327 201
34 3300050492 nmdc:mga0yw44_76432_c1 nmdc:mga0yw44_76432_c1_75_698 201
35 3300005354 Ga0070675_100593667 Ga0070675_1005936672 202
36 3300005364 Ga0070673_100789988 Ga0070673_1007899881 202
37 3300009551 Ga0105238_10845125 Ga0105238_108451252 202
38 3300013308 Ga0157375_10187919 Ga0157375_101879193 202
39 3300025916 Ga0207663_10041402 Ga0207663_100414021 202
40 3300031251 Ga0265327_10000566 Ga0265327_1000056614 202
41 3300031251 Ga0265327_10113768 Ga0265327_101137682 202
42 3300031727 Ga0316576_10108804 Ga0316576_101088042 202
43 3300031728 Ga0316578_10056478 Ga0316578_100564781 202
44 3300032139 Ga0316580_10038850 Ga0316580_100388502 202
45 3300035119 Ga0373956_0028549 Ga0373956_0028549_1678_2307 202
46 3300035691 Ga0373931_0224540 Ga0373931_0224540_309_944 202
47 3300036401 Ga0373937_0009558 Ga0373937_0009558_7770_8399 202
48 3300046461 Ga0495641_0108335 Ga0495641_0108335_353_988 202
49 3300046462 Ga0495651_0033476 Ga0495651_0033476_1899_2528 202
50 3300046463 Ga0495653_0129276 Ga0495653_0129276_422_1051 202
51 3300046511 Ga0495608_0005189 Ga0495608_0005189_2735_3364 202
52 3300046529 Ga0495652_0091997 Ga0495652_0091997_519_1148 202
53 3300046533 Ga0495640_0388724 Ga0495640_0388724_219_848 202
54 3300046536 Ga0495587_0023116 Ga0495587_0023116_391_1020 202
55 3300046559 Ga0495667_0006395 Ga0495667_0006395_3796_4425 202
56 3300046675 Ga0495657_0006237 Ga0495657_0006237_5767_6396 202
57 3300046679 Ga0495623_0132149 Ga0495623_0132149_519_1148 202
58 3300046809 Ga0495600_0083399 Ga0495600_0083399_719_1348 202
59 3300047317 Ga0495604_0121519 Ga0495604_0121519_847_1476 202
60 3300047322 Ga0495680_0012478 Ga0495680_0012478_1068_1697 202
61 3300047444 Ga0495675_0049961 Ga0495675_0049961_1752_2381 202
62 3300048911 Ga0496108_0160735 Ga0496108_0160735_1090_1704 202
63 3300048912 Ga0496109_0112901 Ga0496109_0112901_99_713 202
64 3300048915 Ga0496112_1018341 Ga0496112_1018341_70_684 202
65 3300048917 Ga0496114_0088306 Ga0496114_0088306_792_1427 202
66 3300053084 Ga0495595_0057968 Ga0495595_0057968_841_1470 202
67 3300053085 Ga0495619_0004026 Ga0495619_0004026_2542_3171 202
68 3300053085 Ga0495619_0272177 Ga0495619_0272177_500_1114 202
69 3300053139 Ga0500568_0000050 Ga0500568_0000050_81571_82188 202
70 iso_pu_bacteria 2808606439 2809196378 202
71 iso_pu_bacteria 2811994878 2812351456 202
72 3300005458 Ga0070681_10834885 Ga0070681_108348851 203
73 3300005547 Ga0070693_100050725 Ga0070693_1000507252 203
74 3300005617 Ga0068859_100000803 Ga0068859_10000080325 203
75 3300005844 Ga0068862_100000737 Ga0068862_10000073730 203
76 3300005985 Ga0081539_10014044 Ga0081539_100140447 203
77 3300006048 Ga0075363_100022337 Ga0075363_1000223372 203
78 3300006931 Ga0097620_100000803 Ga0097620_10000080325 203
79 3300013297 Ga0157378_10653417 Ga0157378_106534171 203
80 3300013308 Ga0157375_11637636 Ga0157375_116376361 203
81 3300014325 Ga0163163_10418852 Ga0163163_104188523 203
82 3300025927 Ga0207687_10622700 Ga0207687_106227001 203
83 3300026121 Ga0207683_10161648 Ga0207683_101616482 203
84 3300028380 Ga0268265_10000124 Ga0268265_1000012452 203
85 3300028380 Ga0268265_10849848 Ga0268265_108498482 203
86 3300031251 Ga0265327_10042533 Ga0265327_100425331 203
87 3300035172 Ga0373955_0063454 Ga0373955_0063454_648_1265 203
88 3300035691 Ga0373931_0218396 Ga0373931_0218396_296_913 203
89 3300035691 Ga0373931_0465064 Ga0373931_0465064_116_733 203
90 3300035692 Ga0373935_0240015 Ga0373935_0240015_205_822 203
91 3300036401 Ga0373937_0114013 Ga0373937_0114013_1162_1779 203
92 3300037068 Ga0373925_0118221 Ga0373925_0118221_1121_1738 203
93 3300044684 Ga0466966_0074518 Ga0466966_0074518_255_884 203
94 3300044693 Ga0466961_0286085 Ga0466961_0286085_97_726 203
95 3300046473 Ga0495582_0132424 Ga0495582_0132424_760_1374 203
96 3300046675 Ga0495657_0062339 Ga0495657_0062339_625_1251 203
97 3300046680 Ga0495646_0265927 Ga0495646_0265927_204_821 203
98 3300046690 Ga0495624_0040007 Ga0495624_0040007_588_1205 203
99 3300047321 Ga0495676_0279106 Ga0495676_0279106_122_739 203
100 3300048089 Ga0495614_0137326 Ga0495614_0137326_148_762 203
101 3300048903 Ga0496100_0227808 Ga0496100_0227808_607_1227 203
102 3300048904 Ga0496101_0409607 Ga0496101_0409607_188_808 203
103 3300048905 Ga0496102_0601567 Ga0496102_0601567_351_968 203
104 3300048907 Ga0496104_0063047 Ga0496104_0063047_1026_1646 203
105 3300048908 Ga0496105_0032956 Ga0496105_0032956_2418_3038 203
106 3300048908 Ga0496105_0080889 Ga0496105_0080889_1741_2361 203
107 3300048913 Ga0496110_0255915 Ga0496110_0255915_234_857 203
108 3300048913 Ga0496110_0271383 Ga0496110_0271383_783_1406 203
109 3300048913 Ga0496110_0662401 Ga0496110_0662401_23_640 203
110 3300049571 Ga0501034_0300967 Ga0501034_0300967_66_680 203
111 3300049572 Ga0501036_0178307 Ga0501036_0178307_988_1602 203
112 3300049573 Ga0501037_0109559 Ga0501037_0109559_1336_1950 203
113 3300049574 Ga0501038_0364712 Ga0501038_0364712_59_673 203
114 3300049579 Ga0501043_0011613 Ga0501043_0011613_2919_3533 203
115 3300049580 Ga0501046_0028427 Ga0501046_0028427_3087_3701 203
116 3300049581 Ga0501047_0012050 Ga0501047_0012050_4163_4777 203
117 3300049586 Ga0501070_0034648 Ga0501070_0034648_1287_1901 203
118 3300049823 Ga0501044_0495168 Ga0501044_0495168_186_803 203
119 3300050490 nmdc:mga03n38_10458_c1 nmdc:mga03n38_10458_c1_249_866 203
120 3300050511 nmdc:mga08y16_479936_c1 nmdc:mga08y16_479936_c1_135_752 203
121 3300053083 Ga0495655_0091543 Ga0495655_0091543_162_773 203
122 3300053085 Ga0495619_0017291 Ga0495619_0017291_2754_3371 203
123 3300061734 Ga0530510_0747794 Ga0530510_0747794_61_690 203
124 iso_pu_bacteria 2643221601 2644019006 203
125 iso_pu_bacteria 2643221631 2644180139 203
126 iso_pu_bacteria 2643221697 2644538147 203
127 iso_pu_bacteria 2995463766 2995467534 203
128 3300005548 Ga0070665_100783054 Ga0070665_1007830542 204
129 3300005937 Ga0081455_10000653 Ga0081455_1000065338 204
130 3300005937 Ga0081455_10040344 Ga0081455_100403442 204
131 3300006051 Ga0075364_10044940 Ga0075364_100449402 204
132 3300006844 Ga0075428_100374177 Ga0075428_1003741772 204
133 3300006846 Ga0075430_100164179 Ga0075430_1001641792 204
134 3300006847 Ga0075431_100072677 Ga0075431_1000726772 204
135 3300009147 Ga0114129_10430248 Ga0114129_104302482 204
136 3300009147 Ga0114129_12074325 Ga0114129_120743251 204
137 3300014968 Ga0157379_11065282 Ga0157379_110652821 204
138 3300025972 Ga0207668_10490810 Ga0207668_104908101 204
139 3300031727 Ga0316576_10014866 Ga0316576_100148663 204
140 3300031727 Ga0316576_10088499 Ga0316576_100884993 204
141 3300031728 Ga0316578_10076503 Ga0316578_100765032 204
142 3300031733 Ga0316577_10088639 Ga0316577_100886392 204
143 3300031995 Ga0307409_100507452 Ga0307409_1005074522 204
144 3300032137 Ga0316585_10042380 Ga0316585_100423802 204
145 3300032139 Ga0316580_10015536 Ga0316580_100155363 204
146 3300036647 Ga0316582_0003575 Ga0316582_0003575_6168_6791 204
147 3300036647 Ga0316582_0140481 Ga0316582_0140481_824_1444 204
148 3300036712 Ga0316584_0003428 Ga0316584_0003428_3206_3829 204
149 3300042005 Ga0439448_0006929 Ga0439448_0006929_816_1442 204
150 3300042008 Ga0439450_003860 Ga0439450_003860_1187_1813 204
151 3300042016 Ga0439463_013607 Ga0439463_013607_233_859 204
152 3300042461 Ga0439460_0001148 Ga0439460_0001148_4471_5097 204
153 3300046511 Ga0495608_0229384 Ga0495608_0229384_40_657 204
154 3300046517 Ga0495630_0456785 Ga0495630_0456785_62_679 204
155 3300046675 Ga0495657_0121184 Ga0495657_0121184_85_702 204
156 3300048911 Ga0496108_0279694 Ga0496108_0279694_28_666 204
157 3300049569 Ga0501032_0041431 Ga0501032_0041431_859_1482 204
158 3300049570 Ga0501033_0005923 Ga0501033_0005923_3907_4530 204
159 3300049571 Ga0501034_0013733 Ga0501034_0013733_7018_7635 204
160 3300049572 Ga0501036_0002033 Ga0501036_0002033_5618_6235 204
161 3300049572 Ga0501036_0002935 Ga0501036_0002935_12613_13236 204
162 3300049573 Ga0501037_0010742 Ga0501037_0010742_4208_4831 204
163 3300049573 Ga0501037_0116896 Ga0501037_0116896_695_1312 204
164 3300049574 Ga0501038_0026370 Ga0501038_0026370_1840_2457 204
165 3300049574 Ga0501038_0092811 Ga0501038_0092811_824_1447 204
166 3300049575 Ga0501039_0005557 Ga0501039_0005557_1194_1817 204
167 3300049575 Ga0501039_0107463 Ga0501039_0107463_503_1120 204
168 3300049576 Ga0501040_0000672 Ga0501040_0000672_9795_10418 204
169 3300049578 Ga0501042_0005452 Ga0501042_0005452_94_717 204
170 3300049578 Ga0501042_0064403 Ga0501042_0064403_1162_1779 204
171 3300049579 Ga0501043_0033173 Ga0501043_0033173_989_1612 204
172 3300049579 Ga0501043_0048207 Ga0501043_0048207_1024_1641 204
173 3300049580 Ga0501046_0083454 Ga0501046_0083454_762_1385 204
174 3300049581 Ga0501047_0026276 Ga0501047_0026276_885_1502 204
175 3300049581 Ga0501047_0769611 Ga0501047_0769611_86_709 204
176 3300049582 Ga0501048_0010763 Ga0501048_0010763_1869_2492 204
177 3300049582 Ga0501048_0021577 Ga0501048_0021577_3220_3837 204
178 3300049584 Ga0501068_0036899 Ga0501068_0036899_1048_1671 204
179 3300049587 Ga0501071_0002144 Ga0501071_0002144_1289_1912 204
180 3300049588 Ga0501072_0003311 Ga0501072_0003311_9734_10357 204
181 3300049589 Ga0501073_0030490 Ga0501073_0030490_3018_3635 204
182 3300049590 Ga0501074_0007271 Ga0501074_0007271_6500_7117 204
183 3300049590 Ga0501074_0026730 Ga0501074_0026730_3532_4155 204
184 3300049591 Ga0501075_0000279 Ga0501075_0000279_6846_7469 204
185 3300049592 Ga0501076_0010194 Ga0501076_0010194_4626_5249 204
186 3300049592 Ga0501076_0301600 Ga0501076_0301600_27_644 204
187 3300049593 Ga0501077_0000632 Ga0501077_0000632_5797_6420 204
188 3300049741 Ga0501079_0002731 Ga0501079_0002731_2777_3400 204
189 3300049742 Ga0501080_0017318 Ga0501080_0017318_4997_5617 204
190 3300049742 Ga0501080_1056524 Ga0501080_1056524_16_639 204
191 3300049743 Ga0501081_0006922 Ga0501081_0006922_2011_2634 204
192 3300049744 Ga0501083_0000140 Ga0501083_0000140_35991_36611 204
193 3300049744 Ga0501083_0036475 Ga0501083_0036475_1426_2049 204
194 3300049822 Ga0501035_0070799 Ga0501035_0070799_2001_2624 204
195 3300049823 Ga0501044_0038860 Ga0501044_0038860_3968_4585 204
196 3300049824 Ga0501045_0011714 Ga0501045_0011714_5054_5677 204
197 3300050494 nmdc:mga06z11_62882_c1 nmdc:mga06z11_62882_c1_876_1499 204
198 3300050507 nmdc:mga05p37_824159_c1 nmdc:mga05p37_824159_c1_318_944 204
199 3300050509 nmdc:mga0qj67_160807_c1 nmdc:mga0qj67_160807_c1_27_653 204
200 3300050510 nmdc:mga06r32_308979_c1 nmdc:mga06r32_308979_c1_768_1394 204
201 3300053077 Ga0495601_0094095 Ga0495601_0094095_420_1037 204
202 3300053092 Ga0500583_0044371 Ga0500583_0044371_240_866 204
203 3300054114 Ga0501084_0000502 Ga0501084_0000502_24431_25054 204
204 3300054114 Ga0501084_0003106 Ga0501084_0003106_6822_7442 204
205 3300060353 Ga0501082_0055744 Ga0501082_0055744_1102_1725 204
206 3300061734 Ga0530510_0000347 Ga0530510_0000347_22708_23331 204
207 3300005563 Ga0068855_100289286 Ga0068855_1002892862 205
208 3300013105 Ga0157369_10704736 Ga0157369_107047362 205
209 3300025912 Ga0207707_10660624 Ga0207707_106606242 205
210 3300025949 Ga0207667_10143257 Ga0207667_101432573 205
211 3300038443 Ga0395901_0056357 Ga0395901_0056357_3212_3832 205
212 3300041452 Ga0451793_0452152 Ga0451793_0452152_1625_2251 205
213 3300041486 Ga0451807_1625867 Ga0451807_1625867_79_705 205
214 3300041491 Ga0451833_0784683 Ga0451833_0784683_1105_1731 205
215 3300041494 Ga0451837_0189149 Ga0451837_0189149_3873_4499 205
216 3300042004 Ga0439445_0015452 Ga0439445_0015452_1010_1654 205
217 3300042006 Ga0439432_098440 Ga0439432_098440_125_769 205
218 3300044683 Ga0466965_0043278 Ga0466965_0043278_750_1370 205
219 3300044684 Ga0466966_0058497 Ga0466966_0058497_263_883 205
220 3300044765 Ga0466970_0069565 Ga0466970_0069565_831_1451 205
221 3300044765 Ga0466970_0076767 Ga0466970_0076767_785_1405 205
222 3300044901 Ga0466960_0201067 Ga0466960_0201067_120_749 205
223 3300046679 Ga0495623_0200778 Ga0495623_0200778_208_876 205
224 3300047317 Ga0495604_0019020 Ga0495604_0019020_961_1629 205
225 3300047444 Ga0495675_0057777 Ga0495675_0057777_1326_1994 205
226 3300049568 Ga0501031_0045272 Ga0501031_0045272_1963_2583 205
227 3300049569 Ga0501032_0004992 Ga0501032_0004992_2290_2910 205
228 3300049570 Ga0501033_0011495 Ga0501033_0011495_1583_2203 205
229 3300049570 Ga0501033_0384792 Ga0501033_0384792_150_770 205
230 3300049571 Ga0501034_0044210 Ga0501034_0044210_1796_2416 205
231 3300049572 Ga0501036_0001691 Ga0501036_0001691_14034_14654 205
232 3300049573 Ga0501037_0004582 Ga0501037_0004582_7011_7631 205
233 3300049574 Ga0501038_0006532 Ga0501038_0006532_1483_2103 205
234 3300049574 Ga0501038_0063465 Ga0501038_0063465_158_793 205
235 3300049575 Ga0501039_0007936 Ga0501039_0007936_1598_2218 205
236 3300049578 Ga0501042_0044199 Ga0501042_0044199_1022_1642 205
237 3300049580 Ga0501046_0008028 Ga0501046_0008028_2231_2851 205
238 3300049580 Ga0501046_0078726 Ga0501046_0078726_1413_2033 205
239 3300049581 Ga0501047_0052494 Ga0501047_0052494_2170_2790 205
240 3300049586 Ga0501070_0006215 Ga0501070_0006215_5878_6498 205
241 3300049586 Ga0501070_0054447 Ga0501070_0054447_1899_2543 205
242 3300049589 Ga0501073_0061684 Ga0501073_0061684_1474_2109 205
243 3300049590 Ga0501074_0486856 Ga0501074_0486856_163_783 205
244 3300049822 Ga0501035_0383065 Ga0501035_0383065_517_1137 205
245 3300049823 Ga0501044_0392921 Ga0501044_0392921_517_1137 205
246 3300053078 Ga0495612_0112774 Ga0495612_0112774_479_1114 205
247 3300054114 Ga0501084_0215016 Ga0501084_0215016_523_1143 205
248 3300060353 Ga0501082_0519489 Ga0501082_0519489_208_828 205
249 iso_pu_bacteria 2891968417 2891970931 205
250 3300005981 Ga0081538_10045441 Ga0081538_100454413 206
251 3300006038 Ga0075365_10266368 Ga0075365_102663682 206
252 3300006042 Ga0075368_10091502 Ga0075368_100915022 206
253 3300006051 Ga0075364_10003049 Ga0075364_100030493 206
254 3300031251 Ga0265327_10001801 Ga0265327_1000180123 206
255 3300031731 Ga0307405_10157897 Ga0307405_101578972 206
256 3300031824 Ga0307413_10075950 Ga0307413_100759503 206
257 3300032005 Ga0307411_10223069 Ga0307411_102230692 206
258 3300039062 Ga0400483_099246 Ga0400483_099246_221_856 206
259 3300044658 Ga0466972_0139428 Ga0466972_0139428_485_1108 206
260 3300044765 Ga0466970_0126414 Ga0466970_0126414_176_799 206
261 3300049582 Ga0501048_0297861 Ga0501048_0297861_356_1003 206
262 3300049585 Ga0501069_0000070 Ga0501069_0000070_2374_3012 206
263 3300049586 Ga0501070_0000011 Ga0501070_0000011_151783_152421 206
264 3300049587 Ga0501071_0001879 Ga0501071_0001879_10969_11607 206
265 3300049587 Ga0501071_0039789 Ga0501071_0039789_609_1256 206
266 3300049590 Ga0501074_0057010 Ga0501074_0057010_910_1548 206
267 3300049592 Ga0501076_0431247 Ga0501076_0431247_83_724 206
268 3300049593 Ga0501077_0015631 Ga0501077_0015631_769_1416 206
269 3300049742 Ga0501080_0001015 Ga0501080_0001015_9746_10384 206
270 3300049824 Ga0501045_0104635 Ga0501045_0104635_280_927 206
271 3300050491 nmdc:mga00v17_3074_c1 nmdc:mga00v17_3074_c1_5882_6514 206
272 3300050492 nmdc:mga0yw44_239639_c1 nmdc:mga0yw44_239639_c1_100_732 206
273 3300050495 nmdc:mga04h51_116063_c1 nmdc:mga04h51_116063_c1_230_862 206
274 3300050495 nmdc:mga04h51_94602_c1 nmdc:mga04h51_94602_c1_256_888 206
275 3300061734 Ga0530510_0008061 Ga0530510_0008061_2478_3125 206
276 3300005539 Ga0068853_100795626 Ga0068853_1007956262 207
277 3300042133 Ga0450896_001669 Ga0450896_001669_2053_2727 207
278 3300042134 Ga0450898_001181 Ga0450898_001181_178_852 207
279 3300042135 Ga0450899_001338 Ga0450899_001338_1538_2212 207
280 3300042145 Ga0450906_001520 Ga0450906_001520_1695_2369 207
281 3300046535 Ga0495586_0127114 Ga0495586_0127114_618_1253 207
282 3300049588 Ga0501072_0070277 Ga0501072_0070277_63_695 207
283 3300049592 Ga0501076_0167165 Ga0501076_0167165_720_1349 207
284 3300049741 Ga0501079_0600061 Ga0501079_0600061_18_650 207
285 3300049743 Ga0501081_0462293 Ga0501081_0462293_195_827 207
286 3300049824 Ga0501045_0634028 Ga0501045_0634028_111_743 207
287 3300061734 Ga0530510_0009732 Ga0530510_0009732_759_1391 207
288 3300005367 Ga0070667_100560210 Ga0070667_1005602102 208
289 3300006353 Ga0075370_10046364 Ga0075370_100463641 208
290 3300021388 Ga0213875_10082824 Ga0213875_100828242 208
291 3300025986 Ga0207658_10117652 Ga0207658_101176522 208
292 3300026118 Ga0207675_100506869 Ga0207675_1005068692 208
293 3300037853 Ga0436364_1214371 Ga0436364_1214371_555_1196 208
294 3300041413 Ga0439465_0019987 Ga0439465_0019987_1242_1895 208
295 3300041413 Ga0439465_0063799 Ga0439465_0063799_122_763 208
296 3300042004 Ga0439445_0052336 Ga0439445_0052336_224_877 208
297 3300042156 Ga0439446_0130744 Ga0439446_0130744_144_797 208
298 3300044901 Ga0466960_0204768 Ga0466960_0204768_153_779 208
299 3300050496 nmdc:mga07m45_20544_c1 nmdc:mga07m45_20544_c1_372_1025 208
300 iso_pu_bacteria 2818991472 2819743093 208
301 3300039438 Ga0436360_1190046 Ga0436360_1190046_120_764 209
302 3300046809 Ga0495600_0577108 Ga0495600_0577108_20_661 209
303 3300047673 Ga0495593_0305302 Ga0495593_0305302_111_752 209
304 3300053077 Ga0495601_0187981 Ga0495601_0187981_234_875 209
305 iso_pu_bacteria 2643221617 2644098584 209
306 iso_pu_bacteria 2643221620 2644114557 209
307 iso_pu_bacteria 2811994874 2812332555 209
308 3300025945 Ga0207679_10064055 Ga0207679_100640552 210
309 iso_pu_bacteria 2643221576 2643888809 210
310 iso_pu_bacteria 2643221590 2643957864 210
311 iso_pu_bacteria 2643221615 2644089310 210
312 iso_pu_bacteria 2643221641 2644229356 210
313 iso_pu_bacteria 2643221657 2644319155 210
314 iso_pu_bacteria 2643221961 2645721833 210
315 iso_pu_bacteria 2643221962 2645724222 210
316 iso_pu_bacteria 2738541305 2738869853 210
317 3300006048 Ga0075363_100035613 Ga0075363_1000356133 211
318 3300006048 Ga0075363_100163817 Ga0075363_1001638172 211
319 3300006178 Ga0075367_10218629 Ga0075367_102186292 211
320 3300006353 Ga0075370_10021899 Ga0075370_100218992 211
321 3300037471 Ga0395905_0478543 Ga0395905_0478543_89_739 211
322 3300049578 Ga0501042_0361258 Ga0501042_0361258_214_849 211
323 3300049581 Ga0501047_0323976 Ga0501047_0323976_289_945 211
324 3300049593 Ga0501077_0036081 Ga0501077_0036081_1285_1941 211
325 3300049823 Ga0501044_0261735 Ga0501044_0261735_113_769 211
326 3300049824 Ga0501045_0358015 Ga0501045_0358015_436_1071 211
327 3300050490 nmdc:mga03n38_15323_c1 nmdc:mga03n38_15323_c1_257_901 211
328 3300050491 nmdc:mga00v17_73061_c1 nmdc:mga00v17_73061_c1_1340_1984 211
329 3300050492 nmdc:mga0yw44_165465_c1 nmdc:mga0yw44_165465_c1_482_1126 211
330 3300050492 nmdc:mga0yw44_77431_c1 nmdc:mga0yw44_77431_c1_1297_1941 211
331 3300053088 Ga0500644_0000499 Ga0500644_0000499_14139_14792 211
332 3300053133 Ga0500655_025574 Ga0500655_025574_142_795 211
333 3300049533 Ga0501317_008506 Ga0501317_008506_332_1057 212
334 3300037418 Ga0395900_0073930 Ga0395900_0073930_2011_2673 213
335 3300048912 Ga0496109_0084261 Ga0496109_0084261_1351_2007 213
336 3300048914 Ga0496111_0314193 Ga0496111_0314193_98_739 213
337 3300048915 Ga0496112_0752438 Ga0496112_0752438_31_678 213
338 iso_pu_bacteria 2984576629 2984580259 213
339 iso_pu_bacteria 2990256926 2990259109 213
340 3300001991 JGI24743J22301_10027988 JGI24743J22301_100279882 214
341 3300002075 JGI24738J21930_10006398 JGI24738J21930_100063983 214
342 3300002076 JGI24749J21850_1008884 JGI24749J21850_10088842 214
343 3300002077 JGI24744J21845_10013945 JGI24744J21845_100139452 214
344 3300005327 Ga0070658_10234953 Ga0070658_102349532 214
345 3300005329 Ga0070683_100054908 Ga0070683_1000549085 214
346 3300005329 Ga0070683_100243511 Ga0070683_1002435112 214
347 3300005329 Ga0070683_100309553 Ga0070683_1003095532 214
348 3300005329 Ga0070683_100329228 Ga0070683_1003292282 214
349 3300005330 Ga0070690_100126953 Ga0070690_1001269532 214
350 3300005331 Ga0070670_100723733 Ga0070670_1007237332 214
351 3300005334 Ga0068869_100192843 Ga0068869_1001928432 214
352 3300005334 Ga0068869_100344200 Ga0068869_1003442001 214
353 3300005336 Ga0070680_100695111 Ga0070680_1006951112 214
354 3300005337 Ga0070682_100006463 Ga0070682_1000064632 214
355 3300005339 Ga0070660_100054582 Ga0070660_1000545824 214
356 3300005341 Ga0070691_10128702 Ga0070691_101287022 214
357 3300005343 Ga0070687_100030755 Ga0070687_1000307552 214
358 3300005343 Ga0070687_100078245 Ga0070687_1000782452 214
359 3300005345 Ga0070692_10007019 Ga0070692_100070194 214
360 3300005354 Ga0070675_100213314 Ga0070675_1002133142 214
361 3300005356 Ga0070674_100721707 Ga0070674_1007217071 214
362 3300005365 Ga0070688_100080592 Ga0070688_1000805922 214
363 3300005366 Ga0070659_100018976 Ga0070659_1000189763 214
364 3300005366 Ga0070659_100138654 Ga0070659_1001386542 214
365 3300005366 Ga0070659_100268611 Ga0070659_1002686112 214
366 3300005367 Ga0070667_100050973 Ga0070667_1000509732 214
367 3300005367 Ga0070667_100518333 Ga0070667_1005183332 214
368 3300005438 Ga0070701_10010297 Ga0070701_100102975 214
369 3300005441 Ga0070700_100016157 Ga0070700_1000161572 214
370 3300005441 Ga0070700_100439711 Ga0070700_1004397111 214
371 3300005455 Ga0070663_100192987 Ga0070663_1001929872 214
372 3300005456 Ga0070678_100502337 Ga0070678_1005023372 214
373 3300005458 Ga0070681_10543037 Ga0070681_105430372 214
374 3300005459 Ga0068867_100012515 Ga0068867_1000125154 214
375 3300005466 Ga0070685_10065114 Ga0070685_100651142 214
376 3300005471 Ga0070698_100005155 Ga0070698_1000051555 214
377 3300005535 Ga0070684_100003260 Ga0070684_1000032603 214
378 3300005535 Ga0070684_100100174 Ga0070684_1001001742 214
379 3300005535 Ga0070684_100183675 Ga0070684_1001836752 214
380 3300005535 Ga0070684_100948955 Ga0070684_1009489552 214
381 3300005539 Ga0068853_100232183 Ga0068853_1002321832 214
382 3300005543 Ga0070672_100043380 Ga0070672_1000433802 214
383 3300005544 Ga0070686_100024818 Ga0070686_1000248182 214
384 3300005548 Ga0070665_100002233 Ga0070665_10000223312 214
385 3300005548 Ga0070665_100135805 Ga0070665_1001358052 214
386 3300005548 Ga0070665_100642029 Ga0070665_1006420292 214
387 3300005563 Ga0068855_100137711 Ga0068855_1001377112 214
388 3300005577 Ga0068857_100035657 Ga0068857_1000356572 214
389 3300005577 Ga0068857_100395131 Ga0068857_1003951312 214
390 3300005577 Ga0068857_100855109 Ga0068857_1008551092 214
391 3300005614 Ga0068856_100013871 Ga0068856_1000138715 214
392 3300005615 Ga0070702_100003103 Ga0070702_1000031035 214
393 3300005615 Ga0070702_100200321 Ga0070702_1002003212 214
394 3300005616 Ga0068852_100029857 Ga0068852_1000298572 214
395 3300005616 Ga0068852_100776866 Ga0068852_1007768662 214
396 3300005618 Ga0068864_100531625 Ga0068864_1005316251 214
397 3300005719 Ga0068861_100025002 Ga0068861_1000250022 214
398 3300005719 Ga0068861_100343025 Ga0068861_1003430252 214
399 3300005840 Ga0068870_10059388 Ga0068870_100593882 214
400 3300005842 Ga0068858_100231778 Ga0068858_1002317782 214
401 3300005937 Ga0081455_10000174 Ga0081455_1000017427 214
402 3300006038 Ga0075365_10003456 Ga0075365_100034562 214
403 3300006038 Ga0075365_10007349 Ga0075365_100073493 214
404 3300006038 Ga0075365_10039837 Ga0075365_100398373 214
405 3300006038 Ga0075365_10139299 Ga0075365_101392992 214
406 3300006038 Ga0075365_10289082 Ga0075365_102890822 214
407 3300006038 Ga0075365_10433261 Ga0075365_104332612 214
408 3300006048 Ga0075363_100064460 Ga0075363_1000644602 214
409 3300006051 Ga0075364_10119465 Ga0075364_101194652 214
410 3300006051 Ga0075364_10154173 Ga0075364_101541732 214
411 3300006051 Ga0075364_10272466 Ga0075364_102724662 214
412 3300006051 Ga0075364_10371409 Ga0075364_103714092 214
413 3300006177 Ga0075362_10071379 Ga0075362_100713792 214
414 3300006178 Ga0075367_10000369 Ga0075367_100003696 214
415 3300006178 Ga0075367_10008834 Ga0075367_100088344 214
416 3300006178 Ga0075367_10581789 Ga0075367_105817891 214
417 3300006353 Ga0075370_10017918 Ga0075370_100179184 214
418 3300006353 Ga0075370_10216092 Ga0075370_102160921 214
419 3300006358 Ga0068871_100436141 Ga0068871_1004361412 214
420 3300006881 Ga0068865_100062735 Ga0068865_1000627353 214
421 3300006881 Ga0068865_100096430 Ga0068865_1000964302 214
422 3300009094 Ga0111539_11122315 Ga0111539_111223152 214
423 3300009098 Ga0105245_10005813 Ga0105245_1000581311 214
424 3300009098 Ga0105245_10049450 Ga0105245_100494502 214
425 3300009098 Ga0105245_10118657 Ga0105245_101186573 214
426 3300009148 Ga0105243_10034754 Ga0105243_100347545 214
427 3300009148 Ga0105243_10363985 Ga0105243_103639851 214
428 3300009176 Ga0105242_10142209 Ga0105242_101422092 214
429 3300009176 Ga0105242_10333462 Ga0105242_103334622 214
430 3300009177 Ga0105248_10024173 Ga0105248_100241735 214
431 3300009545 Ga0105237_10024005 Ga0105237_100240052 214
432 3300009553 Ga0105249_10247605 Ga0105249_102476052 214
433 3300009553 Ga0105249_11103153 Ga0105249_111031531 214
434 3300010375 Ga0105239_10005059 Ga0105239_100050599 214
435 3300010375 Ga0105239_10057126 Ga0105239_100571263 214
436 3300010375 Ga0105239_10375404 Ga0105239_103754041 214
437 3300010375 Ga0105239_10570938 Ga0105239_105709382 214
438 3300013102 Ga0157371_10318746 Ga0157371_103187461 214
439 3300013105 Ga0157369_10244425 Ga0157369_102444252 214
440 3300013105 Ga0157369_10868025 Ga0157369_108680252 214
441 3300013307 Ga0157372_10336115 Ga0157372_103361152 214
442 3300013307 Ga0157372_10453037 Ga0157372_104530372 214
443 3300013308 Ga0157375_10007170 Ga0157375_100071707 214
444 3300013308 Ga0157375_10170764 Ga0157375_101707642 214
445 3300013308 Ga0157375_11738631 Ga0157375_117386311 214
446 3300014325 Ga0163163_10036031 Ga0163163_100360313 214
447 3300014325 Ga0163163_10179740 Ga0163163_101797402 214
448 3300014325 Ga0163163_10802272 Ga0163163_108022722 214
449 3300014326 Ga0157380_10042357 Ga0157380_100423572 214
450 3300014326 Ga0157380_10192436 Ga0157380_101924362 214
451 3300014326 Ga0157380_10876349 Ga0157380_108763491 214
452 3300014745 Ga0157377_10030982 Ga0157377_100309822 214
453 3300014969 Ga0157376_10115402 Ga0157376_101154021 214
454 3300017792 Ga0163161_10439361 Ga0163161_104393612 214
455 3300017792 Ga0163161_10515782 Ga0163161_105157822 214
456 3300020082 Ga0206353_10819393 Ga0206353_108193933 214
457 3300020082 Ga0206353_10844963 Ga0206353_108449632 214
458 3300025901 Ga0207688_10006221 Ga0207688_100062214 214
459 3300025901 Ga0207688_10365722 Ga0207688_103657222 214
460 3300025904 Ga0207647_10055544 Ga0207647_100555442 214
461 3300025904 Ga0207647_10071719 Ga0207647_100717192 214
462 3300025908 Ga0207643_10005923 Ga0207643_100059234 214
463 3300025908 Ga0207643_10241858 Ga0207643_102418582 214
464 3300025909 Ga0207705_10024073 Ga0207705_100240732 214
465 3300025917 Ga0207660_10307178 Ga0207660_103071782 214
466 3300025918 Ga0207662_10044104 Ga0207662_100441042 214
467 3300025919 Ga0207657_10061364 Ga0207657_100613642 214
468 3300025921 Ga0207652_10114067 Ga0207652_101140673 214
469 3300025921 Ga0207652_10160546 Ga0207652_101605462 214
470 3300025927 Ga0207687_10032584 Ga0207687_100325843 214
471 3300025927 Ga0207687_10050619 Ga0207687_100506192 214
472 3300025932 Ga0207690_10010917 Ga0207690_100109173 214
473 3300025932 Ga0207690_10182349 Ga0207690_101823492 214
474 3300025934 Ga0207686_10242325 Ga0207686_102423252 214
475 3300025934 Ga0207686_10366478 Ga0207686_103664782 214
476 3300025935 Ga0207709_10011145 Ga0207709_100111452 214
477 3300025936 Ga0207670_10133163 Ga0207670_101331632 214
478 3300025937 Ga0207669_10481336 Ga0207669_104813362 214
479 3300025938 Ga0207704_10103639 Ga0207704_101036392 214
480 3300025938 Ga0207704_10433438 Ga0207704_104334381 214
481 3300025940 Ga0207691_10019859 Ga0207691_100198594 214
482 3300025941 Ga0207711_10316935 Ga0207711_103169352 214
483 3300025941 Ga0207711_10513266 Ga0207711_105132662 214
484 3300025942 Ga0207689_10052657 Ga0207689_100526574 214
485 3300025944 Ga0207661_10078143 Ga0207661_100781433 214
486 3300025944 Ga0207661_10416773 Ga0207661_104167731 214
487 3300025944 Ga0207661_10540064 Ga0207661_105400642 214
488 3300025945 Ga0207679_10447519 Ga0207679_104475192 214
489 3300025949 Ga0207667_10257811 Ga0207667_102578112 214
490 3300025986 Ga0207658_10274665 Ga0207658_102746652 214
491 3300026023 Ga0207677_10525243 Ga0207677_105252432 214
492 3300026041 Ga0207639_10276562 Ga0207639_102765622 214
493 3300026067 Ga0207678_10258548 Ga0207678_102585482 214
494 3300026075 Ga0207708_10002108 Ga0207708_100021085 214
495 3300026075 Ga0207708_10183758 Ga0207708_101837582 214
496 3300026089 Ga0207648_10028837 Ga0207648_100288375 214
497 3300026095 Ga0207676_10091364 Ga0207676_100913642 214
498 3300026116 Ga0207674_10006182 Ga0207674_100061825 214
499 3300026116 Ga0207674_10741718 Ga0207674_107417181 214
500 3300026118 Ga0207675_100008177 Ga0207675_1000081779 214
501 3300026118 Ga0207675_100120472 Ga0207675_1001204722 214
502 3300026121 Ga0207683_10091161 Ga0207683_100911612 214
503 3300026142 Ga0207698_10154448 Ga0207698_101544482 214
504 3300026142 Ga0207698_10387871 Ga0207698_103878712 214
505 3300027866 Ga0209813_10007573 Ga0209813_100075732 214
506 3300028379 Ga0268266_10032400 Ga0268266_100324003 214
507 3300028379 Ga0268266_10362948 Ga0268266_103629481 214
508 3300028381 Ga0268264_10000896 Ga0268264_1000089618 214
509 3300031824 Ga0307413_10072525 Ga0307413_100725252 214
510 3300031824 Ga0307413_10299002 Ga0307413_102990022 214
511 3300031901 Ga0307406_10428522 Ga0307406_104285222 214
512 3300031903 Ga0307407_10051531 Ga0307407_100515312 214
513 3300031903 Ga0307407_10450623 Ga0307407_104506231 214
514 3300031995 Ga0307409_100153320 Ga0307409_1001533202 214
515 3300032002 Ga0307416_100178344 Ga0307416_1001783442 214
516 3300032002 Ga0307416_101058257 Ga0307416_1010582571 214
517 3300037312 Ga0395899_0188287 Ga0395899_0188287_638_1282 214
518 3300037466 Ga0395898_0019357 Ga0395898_0019357_1187_1831 214
519 3300038443 Ga0395901_0077142 Ga0395901_0077142_1205_1870 214
520 3300038443 Ga0395901_0213896 Ga0395901_0213896_1147_1791 214
521 3300041413 Ga0439465_0100993 Ga0439465_0100993_28_699 214
522 3300041452 Ga0451793_1437933 Ga0451793_1437933_145_789 214
523 3300041453 Ga0451797_1225711 Ga0451797_1225711_698_1345 214
524 3300041511 Ga0451855_0291083 Ga0451855_0291083_612_1256 214
525 3300041997 Ga0439431_0017535 Ga0439431_0017535_718_1389 214
526 3300042156 Ga0439446_0019251 Ga0439446_0019251_558_1229 214
527 3300042435 Ga0439434_0012377 Ga0439434_0012377_1355_2026 214
528 3300044656 Ga0466969_0054372 Ga0466969_0054372_707_1351 214
529 3300044658 Ga0466972_0097871 Ga0466972_0097871_718_1377 214
530 3300044683 Ga0466965_0012980 Ga0466965_0012980_1720_2379 214
531 3300044683 Ga0466965_0015494 Ga0466965_0015494_2206_2883 214
532 3300044683 Ga0466965_0190861 Ga0466965_0190861_197_841 214
533 3300044683 Ga0466965_0345241 Ga0466965_0345241_87_788 214
534 3300044684 Ga0466966_0099234 Ga0466966_0099234_801_1445 214
535 3300044693 Ga0466961_0005909 Ga0466961_0005909_4269_4913 214
536 3300044693 Ga0466961_0055360 Ga0466961_0055360_122_781 214
537 3300044693 Ga0466961_0056489 Ga0466961_0056489_1339_1983 214
538 3300044693 Ga0466961_0142759 Ga0466961_0142759_606_1250 214
539 3300044694 Ga0466963_0026729 Ga0466963_0026729_725_1369 214
540 3300044694 Ga0466963_0042027 Ga0466963_0042027_2013_2663 214
541 3300044694 Ga0466963_0063523 Ga0466963_0063523_1554_2198 214
542 3300044694 Ga0466963_0077425 Ga0466963_0077425_1195_1854 214
543 3300044694 Ga0466963_0216703 Ga0466963_0216703_462_1106 214
544 3300044706 Ga0466964_0013333 Ga0466964_0013333_1751_2410 214
545 3300044706 Ga0466964_0039340 Ga0466964_0039340_281_925 214
546 3300044719 Ga0466971_0039421 Ga0466971_0039421_255_899 214
547 3300044719 Ga0466971_0059969 Ga0466971_0059969_45_704 214
548 3300044765 Ga0466970_0179342 Ga0466970_0179342_293_937 214
549 3300044842 Ga0466957_0016152 Ga0466957_0016152_607_1251 214
550 3300044842 Ga0466957_0102272 Ga0466957_0102272_854_1498 214
551 3300044842 Ga0466957_0161881 Ga0466957_0161881_496_1149 214
552 3300044901 Ga0466960_0002698 Ga0466960_0002698_2968_3627 214
553 3300044901 Ga0466960_0015309 Ga0466960_0015309_2001_2645 214
554 3300044901 Ga0466960_0129024 Ga0466960_0129024_536_1183 214
555 3300044901 Ga0466960_0214232 Ga0466960_0214232_228_887 214
556 3300045049 Ga0466959_0149862 Ga0466959_0149862_852_1496 214
557 3300045049 Ga0466959_0348898 Ga0466959_0348898_342_986 214
558 3300045051 Ga0451576_0243910 Ga0451576_0243910_878_1534 214
559 3300045836 Ga0466958_0043742 Ga0466958_0043742_1572_2216 214
560 3300045836 Ga0466958_0103935 Ga0466958_0103935_980_1624 214
561 3300045836 Ga0466958_0416943 Ga0466958_0416943_29_673 214
562 3300045976 Ga0466967_0026909 Ga0466967_0026909_2357_3007 214
563 3300045976 Ga0466967_0068255 Ga0466967_0068255_2216_2866 214
564 3300045976 Ga0466967_0189037 Ga0466967_0189037_728_1387 214
565 3300045976 Ga0466967_0195215 Ga0466967_0195215_1102_1761 214
566 3300045976 Ga0466967_0204158 Ga0466967_0204158_141_785 214
567 3300045976 Ga0466967_0317977 Ga0466967_0317977_50_700 214
568 3300045976 Ga0466967_1404095 Ga0466967_1404095_10_660 214
569 3300046461 Ga0495641_0062686 Ga0495641_0062686_209_859 214
570 3300046461 Ga0495641_0065041 Ga0495641_0065041_410_1060 214
571 3300046517 Ga0495630_0492233 Ga0495630_0492233_71_730 214
572 3300048903 Ga0496100_0225892 Ga0496100_0225892_191_853 214
573 3300048904 Ga0496101_0051661 Ga0496101_0051661_2164_2823 214
574 3300048905 Ga0496102_0026620 Ga0496102_0026620_4294_4950 214
575 3300048906 Ga0496103_0029286 Ga0496103_0029286_1037_1696 214
576 3300048907 Ga0496104_0007957 Ga0496104_0007957_6611_7270 214
577 3300048907 Ga0496104_0281643 Ga0496104_0281643_453_1115 214
578 3300048908 Ga0496105_0000120 Ga0496105_0000120_53188_53847 214
579 3300048908 Ga0496105_0275514 Ga0496105_0275514_247_918 214
580 3300048909 Ga0496106_0014173 Ga0496106_0014173_2326_2985 214
581 3300048909 Ga0496106_0196199 Ga0496106_0196199_409_1068 214
582 3300048910 Ga0496107_0051409 Ga0496107_0051409_2165_2824 214
583 3300048911 Ga0496108_0083123 Ga0496108_0083123_917_1573 214
584 3300048911 Ga0496108_0110529 Ga0496108_0110529_1415_2059 214
585 3300048911 Ga0496108_0458313 Ga0496108_0458313_308_979 214
586 3300048912 Ga0496109_0050712 Ga0496109_0050712_668_1327 214
587 3300048912 Ga0496109_0110142 Ga0496109_0110142_83_742 214
588 3300048913 Ga0496110_0016080 Ga0496110_0016080_3004_3660 214
589 3300048913 Ga0496110_0340901 Ga0496110_0340901_671_1330 214
590 3300048913 Ga0496110_0344089 Ga0496110_0344089_32_703 214
591 3300048913 Ga0496110_0833567 Ga0496110_0833567_45_689 214
592 3300048914 Ga0496111_0202049 Ga0496111_0202049_176_835 214
593 3300048917 Ga0496114_0063023 Ga0496114_0063023_815_1474 214
594 3300048917 Ga0496114_0068261 Ga0496114_0068261_211_870 214
595 3300048917 Ga0496114_0154463 Ga0496114_0154463_869_1516 214
596 3300048917 Ga0496114_0161437 Ga0496114_0161437_1047_1691 214
597 3300048918 Ga0496115_0194966 Ga0496115_0194966_1002_1661 214
598 3300048929 Ga0496126_0191536 Ga0496126_0191536_731_1375 214
599 3300049534 Ga0501318_009274 Ga0501318_009274_393_1037 214
600 3300049568 Ga0501031_0227220 Ga0501031_0227220_32_676 214
601 3300049569 Ga0501032_0084460 Ga0501032_0084460_704_1357 214
602 3300049571 Ga0501034_0011800 Ga0501034_0011800_7931_8581 214
603 3300049571 Ga0501034_0046611 Ga0501034_0046611_463_1113 214
604 3300049571 Ga0501034_0108296 Ga0501034_0108296_653_1297 214
605 3300049574 Ga0501038_0158231 Ga0501038_0158231_108_761 214
606 3300049575 Ga0501039_0124681 Ga0501039_0124681_23_667 214
607 3300049576 Ga0501040_0093802 Ga0501040_0093802_369_1022 214
608 3300049577 Ga0501041_0317354 Ga0501041_0317354_223_873 214
609 3300049578 Ga0501042_0004438 Ga0501042_0004438_7021_7665 214
610 3300049578 Ga0501042_0115683 Ga0501042_0115683_471_1124 214
611 3300049581 Ga0501047_0341545 Ga0501047_0341545_449_1099 214
612 3300049583 Ga0501067_0002053 Ga0501067_0002053_1333_1983 214
613 3300049583 Ga0501067_0013627 Ga0501067_0013627_3543_4193 214
614 3300049583 Ga0501067_0070232 Ga0501067_0070232_871_1515 214
615 3300049584 Ga0501068_0020200 Ga0501068_0020200_199_849 214
616 3300049584 Ga0501068_0111959 Ga0501068_0111959_705_1361 214
617 3300049585 Ga0501069_0003304 Ga0501069_0003304_5826_6476 214
618 3300049586 Ga0501070_0003699 Ga0501070_0003699_10755_11405 214
619 3300049586 Ga0501070_0010553 Ga0501070_0010553_6661_7311 214
620 3300049586 Ga0501070_0012740 Ga0501070_0012740_918_1568 214
621 3300049586 Ga0501070_0235703 Ga0501070_0235703_807_1463 214
622 3300049587 Ga0501071_0003221 Ga0501071_0003221_56_700 214
623 3300049587 Ga0501071_0010142 Ga0501071_0010142_2033_2683 214
624 3300049587 Ga0501071_0041074 Ga0501071_0041074_2434_3078 214
625 3300049587 Ga0501071_0046239 Ga0501071_0046239_225_875 214
626 3300049587 Ga0501071_0139948 Ga0501071_0139948_909_1562 214
627 3300049588 Ga0501072_0015013 Ga0501072_0015013_5146_5796 214
628 3300049588 Ga0501072_0135730 Ga0501072_0135730_81_731 214
629 3300049588 Ga0501072_0298741 Ga0501072_0298741_401_1045 214
630 3300049589 Ga0501073_0004316 Ga0501073_0004316_9682_10332 214
631 3300049589 Ga0501073_0041947 Ga0501073_0041947_452_1102 214
632 3300049589 Ga0501073_0238625 Ga0501073_0238625_564_1208 214
633 3300049590 Ga0501074_0000999 Ga0501074_0000999_10813_11463 214
634 3300049590 Ga0501074_0014355 Ga0501074_0014355_4237_4887 214
635 3300049590 Ga0501074_0142338 Ga0501074_0142338_917_1567 214
636 3300049590 Ga0501074_0167082 Ga0501074_0167082_173_826 214
637 3300049590 Ga0501074_0176845 Ga0501074_0176845_229_882 214
638 3300049590 Ga0501074_0186762 Ga0501074_0186762_549_1214 214
639 3300049591 Ga0501075_0102658 Ga0501075_0102658_108_752 214
640 3300049591 Ga0501075_0142624 Ga0501075_0142624_535_1200 214
641 3300049591 Ga0501075_0198127 Ga0501075_0198127_370_1020 214
642 3300049591 Ga0501075_0297838 Ga0501075_0297838_520_1173 214
643 3300049593 Ga0501077_0004798 Ga0501077_0004798_3418_4068 214
644 3300049593 Ga0501077_0061143 Ga0501077_0061143_1570_2220 214
645 3300049741 Ga0501079_0004880 Ga0501079_0004880_4851_5501 214
646 3300049741 Ga0501079_0071192 Ga0501079_0071192_1158_1802 214
647 3300049742 Ga0501080_0006490 Ga0501080_0006490_900_1550 214
648 3300049742 Ga0501080_0010183 Ga0501080_0010183_5443_6093 214
649 3300049742 Ga0501080_0046390 Ga0501080_0046390_251_901 214
650 3300049742 Ga0501080_0085067 Ga0501080_0085067_2182_2826 214
651 3300049743 Ga0501081_0222144 Ga0501081_0222144_57_710 214
652 3300049744 Ga0501083_0005954 Ga0501083_0005954_7910_8560 214
653 3300049744 Ga0501083_0153823 Ga0501083_0153823_394_1044 214
654 3300049824 Ga0501045_0053014 Ga0501045_0053014_1886_2539 214
655 3300050490 nmdc:mga03n38_110028_c1 nmdc:mga03n38_110028_c1_516_1160 214
656 3300050490 nmdc:mga03n38_208628_c1 nmdc:mga03n38_208628_c1_259_915 214
657 3300050491 nmdc:mga00v17_16636_c1 nmdc:mga00v17_16636_c1_2104_2748 214
658 3300050492 nmdc:mga0yw44_110306_c1 nmdc:mga0yw44_110306_c1_45_689 214
659 3300050492 nmdc:mga0yw44_11576_c1 nmdc:mga0yw44_11576_c1_175_831 214
660 3300050492 nmdc:mga0yw44_211258_c1 nmdc:mga0yw44_211258_c1_299_943 214
661 3300050492 nmdc:mga0yw44_266828_c1 nmdc:mga0yw44_266828_c1_307_954 214
662 3300050492 nmdc:mga0yw44_301517_c1 nmdc:mga0yw44_301517_c1_111_758 214
663 3300050492 nmdc:mga0yw44_3056_c1 nmdc:mga0yw44_3056_c1_774_1418 214
664 3300050492 nmdc:mga0yw44_329861_c1 nmdc:mga0yw44_329861_c1_121_765 214
665 3300050492 nmdc:mga0yw44_386124_c1 nmdc:mga0yw44_386124_c1_194_838 214
666 3300050492 nmdc:mga0yw44_435_c1 nmdc:mga0yw44_435_c1_5338_5982 214
667 3300050494 nmdc:mga06z11_195442_c1 nmdc:mga06z11_195442_c1_412_1059 214
668 3300050494 nmdc:mga06z11_23480_c1 nmdc:mga06z11_23480_c1_621_1265 214
669 3300050494 nmdc:mga06z11_4639_c1 nmdc:mga06z11_4639_c1_3450_4106 214
670 3300050494 nmdc:mga06z11_499533_c1 nmdc:mga06z11_499533_c1_75_719 214
671 3300050495 nmdc:mga04h51_4724_c1 nmdc:mga04h51_4724_c1_19_666 214
672 3300053085 Ga0495619_0501477 Ga0495619_0501477_172_816 214
673 3300053088 Ga0500644_0096558 Ga0500644_0096558_91_738 214
674 3300053096 Ga0500641_0001880 Ga0500641_0001880_5514_6158 214
675 3300053096 Ga0500641_0034811 Ga0500641_0034811_1324_1968 214
676 3300053104 Ga0500556_0000985 Ga0500556_0000985_12542_13201 214
677 3300053117 Ga0500593_001205 Ga0500593_001205_1784_2443 214
678 3300053140 Ga0500573_0007551 Ga0500573_0007551_877_1521 214
679 3300053140 Ga0500573_0073995 Ga0500573_0073995_516_1172 214
680 3300054114 Ga0501084_0011106 Ga0501084_0011106_6545_7195 214
681 3300054114 Ga0501084_0729665 Ga0501084_0729665_26_682 214
682 3300054114 Ga0501084_0732665 Ga0501084_0732665_110_754 214
683 3300060353 Ga0501082_0001956 Ga0501082_0001956_3759_4409 214
684 3300060353 Ga0501082_0871621 Ga0501082_0871621_29_673 214
685 3300061719 Ga0466962_0086962 Ga0466962_0086962_555_1199 214
686 3300061734 Ga0530510_0358346 Ga0530510_0358346_438_1082 214
687 iso_pu_bacteria 2855386786 2855387000 214
688 iso_pu_bacteria 2857481737 2857482240 214

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13578

Methyltransf_24

Methyltransferase domain

59

190

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
6g7d-assembly1.cif.gz_A structure of met1 from mycobacterium hassiacum in complex with sam and glycerol. 0.9642 3 213
6g80-assembly1.cif.gz_A structure of mycobacterium hassiacum met1 from orthorhombic crystals. 0.9515 3 213
6g7d-assembly1.cif.gz_A structure of met1 from mycobacterium hassiacum in complex with sam and glycerol. 0.951 3 213
2gpy-assembly1.cif.gz_A crystal structure of putative o-methyltransferase from bacillus halodurans 0.8016 21 206
4xvz-assembly2.cif.gz_D mycf mycinamicin iii 3'-o-methyltransferase in complex with mg 0.7943 11 206
ID Description Score Start End Superfamily
af_K7N0B7_9_135_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8477 14 146 3.40.50.150
af_F4HS78_116_300_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7907 13 200 3.40.50.150
af_F4HS78_116_300_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7791 13 200 3.40.50.150
af_A1Y9I9_44_257_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7749 16 207 3.40.50.150
af_K8ERZ6_162_450_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7705 19 163 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A849AA15-F1-model_v4 deleted 0.9785 1 204
AF-A0A6L6ANL0-F1-model_v4 deleted 0.976 16 212
AF-H5XA09-F1-model_v4 Putative O-methyltransferase 0.9751 1 213 GO:0005886
GO:0008168
GO:0030206
GO:0032259
GO:0071770
AF-A0A399R0Y4-F1-model_v4 Class I SAM-dependent methyltransferase 0.9751 9 206 GO:0005886
GO:0008168
GO:0030206
GO:0032259
GO:0071770
AF-C7QHP1-F1-model_v4 Secreted protein 0.9719 1 205 GO:0005886
GO:0030206
GO:0071770

Feature Viewer

pLDDT pTM Quality
92.85 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map