F475359
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 688 | 317 | 665 | 213 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2855386786|2855387000 |
| Length | 238 |
| Sequence | SPTSPKASPDASPEASPDASGMPADLLAHARAAKGFMPEDEGLLLHRAARERLSHGPVLEVGTYCGKSAIYLGAAARAVGGPQAVVFTVDHHRGSEENQAGWEHHDATLVDDEFGLMDTLPVFRKTLARAGLEDQVVAVVGRSTTVAAHWRTPLSMLFIDGGHAEEHAQNDYTGWAHWLMRDGLLVIHDVFPDPADGGQPPYHVFLRALQSGAFTEVEAVGSMRVLRRTAGDVGERVG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221576 | Nocardioides sp. Root614 | Isolate | Unclassified |
| 2 | 2643221590 | Nocardioides sp. Root682 | Isolate | Unclassified |
| 3 | 2643221601 | Kitasatospora sp. Root187 | Isolate | Unclassified |
| 4 | 2643221615 | Nocardioides sp. Root224 | Isolate | Unclassified |
| 5 | 2643221617 | Nocardioides sp. Root79 | Isolate | Unclassified |
| 6 | 2643221620 | Nocardioides sp. Root240 | Isolate | Unclassified |
| 7 | 2643221631 | Kitasatospora sp. Root107 | Isolate | Unclassified |
| 8 | 2643221641 | Nocardioides sp. Root122 | Isolate | Unclassified |
| 9 | 2643221657 | Nocardioides sp. Root1257 | Isolate | Unclassified |
| 10 | 2643221697 | Aeromicrobium sp. Root495 | Isolate | Unclassified |
| 11 | 2643221961 | Aeromicrobium sp. Root236 | Isolate | Unclassified |
| 12 | 2643221962 | Aeromicrobium sp. Root344 | Isolate | Unclassified |
| 13 | 2738541305 | Nocardioides sp. CF167 | Isolate | Unclassified |
| 14 | 2808606439 | Nocardioides sp. SLBN-172 | Isolate | Unclassified |
| 15 | 2811994874 | Nocardioides sp. SLBN-35 | Isolate | Unclassified |
| 16 | 2811994878 | Nocardioides sp. SLBN-169 | Isolate | Unclassified |
| 17 | 2818991472 | Kitasatospora viridis DSM 44826 | Isolate | Rhizosphere |
| 18 | 2855386786 | Nocardioides ferulae EGI 63112 | Isolate | Unclassified |
| 19 | 2857481737 | Nocardioides sp. R-74106 | Isolate | Unclassified |
| 20 | 2891968417 | Nocardioides luteus SAI-037 | Isolate | Unclassified |
| 21 | 2984576629 | Nocardioides zeae SORGH_AS913 | Isolate | Aerial Root |
| 22 | 2990256926 | Nocardioides zeae SORGH_AS885 | Isolate | Aerial Root |
| 23 | 2995463766 | Streptacidiphilus fuscans NEAU-YB345 | Isolate | Unclassified |
| 24 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 25 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 26 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 27 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 28 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 33 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 43 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 51 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 55 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 60 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 61 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 62 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 64 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 65 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 66 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 67 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 68 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 69 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 70 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 71 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 72 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 73 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 74 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 75 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 76 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 77 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 78 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 79 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 80 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 81 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 82 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 83 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 84 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 85 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 86 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 109 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 110 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 151 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 152 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 153 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 154 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 155 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 156 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 157 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 158 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 159 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 160 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 161 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 162 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 163 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 164 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 165 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 166 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 167 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 168 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 169 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 170 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 171 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 172 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 173 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 174 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 175 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 176 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 177 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 178 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 179 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 180 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 181 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 182 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 183 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 184 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 185 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 186 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 187 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 188 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 189 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 190 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 191 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 192 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 193 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 194 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 195 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 196 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 197 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 198 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 199 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 200 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 201 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 202 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 203 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 204 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 205 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 206 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 207 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 208 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 209 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 210 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 211 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 212 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 213 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 214 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 215 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 240 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 241 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 242 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 243 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 244 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 245 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 246 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 247 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 248 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 249 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 250 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 251 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 252 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 253 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 254 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 255 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 256 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 257 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 268 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 272 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 290 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 291 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 292 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 293 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 294 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 295 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 296 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 297 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 298 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 299 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 307 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 308 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 309 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 310 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 311 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 312 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 313 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 314 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 317 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.08 |
| Metatranscriptomes | 0.58 |
| Isolates | 3.34 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.29 |
| Bulb | 0 |
| Endosphere | 11.05 |
| Nodule | 0 |
| Rhizoplane | 7.12 |
| Rhizosphere | 77.47 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.07 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24743J22301_10027988 | 3300001991 | Bacteria | 1102 |
| 2 | JGI24738J21930_10006398 | 3300002075 | Bacteria | 2766 |
| 3 | JGI24749J21850_1008884 | 3300002076 | Bacteria | 1402 |
| 4 | JGI24744J21845_10013945 | 3300002077 | Bacteria | 1619 |
| 5 | Ga0070658_10234953 | 3300005327 | Bacteria | 1553 |
| 6 | Ga0070658_10447247 | 3300005327 | Bacteria | 1113 |
| 7 | Ga0070683_100054908 | 3300005329 | Bacteria | 3695 |
| 8 | Ga0070683_100243511 | 3300005329 | Bacteria | 1710 |
| 9 | Ga0070683_100309553 | 3300005329 | Bacteria | 1503 |
| 10 | Ga0070683_100329228 | 3300005329 | Bacteria | 1454 |
| 11 | Ga0070690_100126953 | 3300005330 | Bacteria | 1718 |
| 12 | Ga0070670_100723733 | 3300005331 | Bacteria | 896 |
| 13 | Ga0068869_100192843 | 3300005334 | Bacteria | 1603 |
| 14 | Ga0068869_100344200 | 3300005334 | Bacteria | 1214 |
| 15 | Ga0070680_100695111 | 3300005336 | Bacteria | 875 |
| 16 | Ga0070682_100006463 | 3300005337 | Bacteria | 6591 |
| 17 | Ga0070660_100054582 | 3300005339 | Bacteria | 3086 |
| 18 | Ga0070691_10128702 | 3300005341 | Bacteria | 1281 |
| 19 | Ga0070687_100030755 | 3300005343 | Bacteria | 2627 |
| 20 | Ga0070687_100078245 | 3300005343 | Bacteria | 1797 |
| 21 | Ga0070692_10007019 | 3300005345 | Bacteria | 4936 |
| 22 | Ga0070675_100213314 | 3300005354 | Bacteria | 1679 |
| 23 | Ga0070675_100593667 | 3300005354 | Bacteria | 1004 |
| 24 | Ga0070674_100721707 | 3300005356 | Bacteria | 854 |
| 25 | Ga0070673_100789988 | 3300005364 | Bacteria | 876 |
| 26 | Ga0070688_100080592 | 3300005365 | Bacteria | 2106 |
| 27 | Ga0070659_100018976 | 3300005366 | Bacteria | 5199 |
| 28 | Ga0070659_100138654 | 3300005366 | Bacteria | 1979 |
| 29 | Ga0070659_100268611 | 3300005366 | Bacteria | 1417 |
| 30 | Ga0070667_100050973 | 3300005367 | Bacteria | 3489 |
| 31 | Ga0070667_100518333 | 3300005367 | Bacteria | 1094 |
| 32 | Ga0070667_100560210 | 3300005367 | Bacteria | 1051 |
| 33 | Ga0070701_10010297 | 3300005438 | Bacteria | 4129 |
| 34 | Ga0070700_100016157 | 3300005441 | Bacteria | 4247 |
| 35 | Ga0070700_100439711 | 3300005441 | Bacteria | 990 |
| 36 | Ga0070663_100192987 | 3300005455 | Bacteria | 1586 |
| 37 | Ga0070678_100502337 | 3300005456 | Bacteria | 1070 |
| 38 | Ga0070681_10543037 | 3300005458 | Bacteria | 1076 |
| 39 | Ga0070681_10834885 | 3300005458 | Bacteria | 839 |
| 40 | Ga0068867_100012515 | 3300005459 | Bacteria | 6004 |
| 41 | Ga0070685_10065114 | 3300005466 | Bacteria | 2145 |
| 42 | Ga0070698_100005155 | 3300005471 | Bacteria | 14294 |
| 43 | Ga0070684_100003260 | 3300005535 | Bacteria | 12158 |
| 44 | Ga0070684_100100174 | 3300005535 | Bacteria | 2587 |
| 45 | Ga0070684_100183675 | 3300005535 | Bacteria | 1902 |
| 46 | Ga0070684_100948955 | 3300005535 | Bacteria | 806 |
| 47 | Ga0068853_100232183 | 3300005539 | Bacteria | 1688 |
| 48 | Ga0068853_100795626 | 3300005539 | Bacteria | 905 |
| 49 | Ga0070672_100043380 | 3300005543 | Bacteria | 3468 |
| 50 | Ga0070686_100024818 | 3300005544 | Bacteria | 3597 |
| 51 | Ga0070693_100050725 | 3300005547 | Bacteria | 2373 |
| 52 | Ga0070665_100002233 | 3300005548 | Bacteria | 21582 |
| 53 | Ga0070665_100135805 | 3300005548 | Bacteria | 2462 |
| 54 | Ga0070665_100642029 | 3300005548 | Bacteria | 1074 |
| 55 | Ga0070665_100783054 | 3300005548 | Bacteria | 967 |
| 56 | Ga0068855_100137711 | 3300005563 | Bacteria | 2784 |
| 57 | Ga0068855_100289286 | 3300005563 | Bacteria | 1817 |
| 58 | Ga0068857_100035657 | 3300005577 | Bacteria | 4406 |
| 59 | Ga0068857_100395131 | 3300005577 | Bacteria | 1286 |
| 60 | Ga0068857_100855109 | 3300005577 | Bacteria | 871 |
| 61 | Ga0068856_100013871 | 3300005614 | Bacteria | 7794 |
| 62 | Ga0070702_100003103 | 3300005615 | Bacteria | 7356 |
| 63 | Ga0070702_100200321 | 3300005615 | Bacteria | 1321 |
| 64 | Ga0068852_100029857 | 3300005616 | Bacteria | 4481 |
| 65 | Ga0068852_100776866 | 3300005616 | Bacteria | 971 |
| 66 | Ga0068859_100000803 | 3300005617 | Bacteria | 31879 |
| 67 | Ga0068864_100531625 | 3300005618 | Bacteria | 1135 |
| 68 | Ga0068861_100025002 | 3300005719 | Bacteria | 4324 |
| 69 | Ga0068861_100343025 | 3300005719 | Bacteria | 1308 |
| 70 | Ga0068870_10059388 | 3300005840 | Bacteria | 2050 |
| 71 | Ga0068858_100231778 | 3300005842 | Bacteria | 1751 |
| 72 | Ga0068862_100000737 | 3300005844 | Bacteria | 32919 |
| 73 | Ga0081455_10000174 | 3300005937 | Bacteria | 80174 |
| 74 | Ga0081455_10000653 | 3300005937 | Bacteria | 44988 |
| 75 | Ga0081455_10040344 | 3300005937 | Bacteria | 4118 |
| 76 | Ga0081538_10045441 | 3300005981 | Bacteria | 2723 |
| 77 | Ga0081539_10014044 | 3300005985 | Bacteria | 5961 |
| 78 | Ga0075365_10003301 | 3300006038 | Bacteria | 8279 |
| 79 | Ga0075365_10003456 | 3300006038 | Bacteria | 8141 |
| 80 | Ga0075365_10007349 | 3300006038 | Bacteria | 6162 |
| 81 | Ga0075365_10039837 | 3300006038 | Bacteria | 3062 |
| 82 | Ga0075365_10131074 | 3300006038 | Bacteria | 1735 |
| 83 | Ga0075365_10139299 | 3300006038 | Bacteria | 1683 |
| 84 | Ga0075365_10266368 | 3300006038 | Bacteria | 1205 |
| 85 | Ga0075365_10289082 | 3300006038 | Bacteria | 1153 |
| 86 | Ga0075365_10433261 | 3300006038 | Bacteria | 928 |
| 87 | Ga0075368_10091502 | 3300006042 | Bacteria | 1244 |
| 88 | Ga0075363_100022337 | 3300006048 | Bacteria | 3197 |
| 89 | Ga0075363_100035613 | 3300006048 | Bacteria | 2606 |
| 90 | Ga0075363_100056219 | 3300006048 | Bacteria | 2109 |
| 91 | Ga0075363_100064460 | 3300006048 | Bacteria | 1979 |
| 92 | Ga0075363_100163817 | 3300006048 | Bacteria | 1260 |
| 93 | Ga0075364_10003049 | 3300006051 | Bacteria | 9462 |
| 94 | Ga0075364_10044940 | 3300006051 | Bacteria | 2874 |
| 95 | Ga0075364_10119465 | 3300006051 | Bacteria | 1764 |
| 96 | Ga0075364_10154173 | 3300006051 | Bacteria | 1549 |
| 97 | Ga0075364_10272466 | 3300006051 | Bacteria | 1151 |
| 98 | Ga0075364_10371409 | 3300006051 | Bacteria | 975 |
| 99 | Ga0075362_10071379 | 3300006177 | Bacteria | 1586 |
| 100 | Ga0075367_10000369 | 3300006178 | Bacteria | 16254 |
| 101 | Ga0075367_10008834 | 3300006178 | Bacteria | 5241 |
| 102 | Ga0075367_10218629 | 3300006178 | Bacteria | 1192 |
| 103 | Ga0075367_10581789 | 3300006178 | Bacteria | 711 |
| 104 | Ga0075370_10017918 | 3300006353 | Bacteria | 3833 |
| 105 | Ga0075370_10021899 | 3300006353 | Bacteria | 3504 |
| 106 | Ga0075370_10046364 | 3300006353 | Bacteria | 2460 |
| 107 | Ga0075370_10216092 | 3300006353 | Bacteria | 1132 |
| 108 | Ga0068871_100436141 | 3300006358 | Bacteria | 1172 |
| 109 | Ga0075428_100374177 | 3300006844 | Bacteria | 1527 |
| 110 | Ga0075430_100164179 | 3300006846 | Bacteria | 1848 |
| 111 | Ga0075431_100072677 | 3300006847 | Bacteria | 3549 |
| 112 | Ga0075434_100310964 | 3300006871 | Bacteria | 1596 |
| 113 | Ga0068865_100062735 | 3300006881 | Bacteria | 2609 |
| 114 | Ga0068865_100096430 | 3300006881 | Bacteria | 2156 |
| 115 | Ga0097620_100000803 | 3300006931 | Bacteria | 31879 |
| 116 | Ga0111539_11122315 | 3300009094 | Bacteria | 914 |
| 117 | Ga0105245_10005813 | 3300009098 | Bacteria | 10826 |
| 118 | Ga0105245_10049450 | 3300009098 | Bacteria | 3765 |
| 119 | Ga0105245_10118657 | 3300009098 | Bacteria | 2469 |
| 120 | Ga0114129_10430248 | 3300009147 | Bacteria | 1734 |
| 121 | Ga0114129_10506070 | 3300009147 | Bacteria | 1577 |
| 122 | Ga0114129_12074325 | 3300009147 | Bacteria | 686 |
| 123 | Ga0105243_10034754 | 3300009148 | Bacteria | 3906 |
| 124 | Ga0105243_10363985 | 3300009148 | Bacteria | 1332 |
| 125 | Ga0105242_10142209 | 3300009176 | Bacteria | 2083 |
| 126 | Ga0105242_10333462 | 3300009176 | Bacteria | 1395 |
| 127 | Ga0105248_10024173 | 3300009177 | Bacteria | 6753 |
| 128 | Ga0105248_10662485 | 3300009177 | Bacteria | 1178 |
| 129 | Ga0105237_10024005 | 3300009545 | Bacteria | 6239 |
| 130 | Ga0105238_10845125 | 3300009551 | Bacteria | 932 |
| 131 | Ga0105249_10247605 | 3300009553 | Bacteria | 1765 |
| 132 | Ga0105249_11103153 | 3300009553 | Bacteria | 864 |
| 133 | Ga0105239_10005059 | 3300010375 | Bacteria | 15578 |
| 134 | Ga0105239_10057126 | 3300010375 | Bacteria | 4281 |
| 135 | Ga0105239_10375404 | 3300010375 | Bacteria | 1607 |
| 136 | Ga0105239_10570938 | 3300010375 | Bacteria | 1289 |
| 137 | Ga0157371_10318746 | 3300013102 | Bacteria | 1128 |
| 138 | Ga0157369_10244425 | 3300013105 | Bacteria | 1874 |
| 139 | Ga0157369_10704736 | 3300013105 | Bacteria | 1039 |
| 140 | Ga0157369_10868025 | 3300013105 | Bacteria | 926 |
| 141 | Ga0157378_10653417 | 3300013297 | Bacteria | 1067 |
| 142 | Ga0157372_10336115 | 3300013307 | Bacteria | 1759 |
| 143 | Ga0157372_10453037 | 3300013307 | Bacteria | 1495 |
| 144 | Ga0157375_10007170 | 3300013308 | Bacteria | 9744 |
| 145 | Ga0157375_10170764 | 3300013308 | Bacteria | 2322 |
| 146 | Ga0157375_10187919 | 3300013308 | Bacteria | 2220 |
| 147 | Ga0157375_10310984 | 3300013308 | Bacteria | 1740 |
| 148 | Ga0157375_11637636 | 3300013308 | Bacteria | 761 |
| 149 | Ga0157375_11738631 | 3300013308 | Bacteria | 739 |
| 150 | Ga0163163_10036031 | 3300014325 | Bacteria | 4803 |
| 151 | Ga0163163_10179740 | 3300014325 | Bacteria | 2163 |
| 152 | Ga0163163_10418852 | 3300014325 | Bacteria | 1398 |
| 153 | Ga0163163_10802272 | 3300014325 | Bacteria | 1005 |
| 154 | Ga0157380_10042357 | 3300014326 | Bacteria | 3559 |
| 155 | Ga0157380_10192436 | 3300014326 | Bacteria | 1802 |
| 156 | Ga0157380_10876349 | 3300014326 | Bacteria | 922 |
| 157 | Ga0157377_10030982 | 3300014745 | Bacteria | 2903 |
| 158 | Ga0157379_11065282 | 3300014968 | Bacteria | 773 |
| 159 | Ga0157379_11091617 | 3300014968 | Bacteria | 764 |
| 160 | Ga0157376_10115402 | 3300014969 | Bacteria | 2371 |
| 161 | Ga0163161_10439361 | 3300017792 | Bacteria | 1053 |
| 162 | Ga0163161_10515782 | 3300017792 | Bacteria | 975 |
| 163 | Ga0206353_10819393 | 3300020082 | Bacteria | 1971 |
| 164 | Ga0206353_10844963 | 3300020082 | Bacteria | 3688 |
| 165 | Ga0213875_10082824 | 3300021388 | Bacteria | 1497 |
| 166 | Ga0207688_10006221 | 3300025901 | Bacteria | 6493 |
| 167 | Ga0207688_10365722 | 3300025901 | Bacteria | 891 |
| 168 | Ga0207647_10055544 | 3300025904 | Bacteria | 2433 |
| 169 | Ga0207647_10071719 | 3300025904 | Bacteria | 2089 |
| 170 | Ga0207643_10005923 | 3300025908 | Bacteria | 6528 |
| 171 | Ga0207643_10241858 | 3300025908 | Bacteria | 1110 |
| 172 | Ga0207705_10024073 | 3300025909 | Bacteria | 4345 |
| 173 | Ga0207705_10351347 | 3300025909 | Bacteria | 1136 |
| 174 | Ga0207707_10660624 | 3300025912 | Bacteria | 880 |
| 175 | Ga0207663_10041402 | 3300025916 | Bacteria | 2808 |
| 176 | Ga0207660_10307178 | 3300025917 | Bacteria | 1264 |
| 177 | Ga0207662_10044104 | 3300025918 | Bacteria | 2632 |
| 178 | Ga0207657_10061364 | 3300025919 | Bacteria | 3224 |
| 179 | Ga0207652_10114067 | 3300025921 | Bacteria | 2399 |
| 180 | Ga0207652_10160546 | 3300025921 | Bacteria | 2015 |
| 181 | Ga0207687_10032584 | 3300025927 | Bacteria | 3530 |
| 182 | Ga0207687_10050619 | 3300025927 | Bacteria | 2892 |
| 183 | Ga0207687_10622700 | 3300025927 | Bacteria | 911 |
| 184 | Ga0207690_10010917 | 3300025932 | Bacteria | 5415 |
| 185 | Ga0207690_10182349 | 3300025932 | Bacteria | 1582 |
| 186 | Ga0207686_10242325 | 3300025934 | Bacteria | 1313 |
| 187 | Ga0207686_10366478 | 3300025934 | Bacteria | 1089 |
| 188 | Ga0207709_10011145 | 3300025935 | Bacteria | 4958 |
| 189 | Ga0207670_10133163 | 3300025936 | Bacteria | 1824 |
| 190 | Ga0207669_10481336 | 3300025937 | Bacteria | 989 |
| 191 | Ga0207704_10103639 | 3300025938 | Bacteria | 1903 |
| 192 | Ga0207704_10433438 | 3300025938 | Bacteria | 1045 |
| 193 | Ga0207665_10474220 | 3300025939 | Bacteria | 963 |
| 194 | Ga0207691_10019859 | 3300025940 | Bacteria | 6355 |
| 195 | Ga0207711_10316935 | 3300025941 | Bacteria | 1440 |
| 196 | Ga0207711_10513266 | 3300025941 | Bacteria | 1117 |
| 197 | Ga0207711_10654927 | 3300025941 | Bacteria | 980 |
| 198 | Ga0207689_10052657 | 3300025942 | Bacteria | 3353 |
| 199 | Ga0207661_10078143 | 3300025944 | Bacteria | 2723 |
| 200 | Ga0207661_10416773 | 3300025944 | Bacteria | 1219 |
| 201 | Ga0207661_10540064 | 3300025944 | Bacteria | 1067 |
| 202 | Ga0207679_10064055 | 3300025945 | Bacteria | 2746 |
| 203 | Ga0207679_10447519 | 3300025945 | Bacteria | 1145 |
| 204 | Ga0207667_10143257 | 3300025949 | Bacteria | 2460 |
| 205 | Ga0207667_10257811 | 3300025949 | Bacteria | 1783 |
| 206 | Ga0207668_10490810 | 3300025972 | Bacteria | 1055 |
| 207 | Ga0207658_10117652 | 3300025986 | Bacteria | 2113 |
| 208 | Ga0207658_10274665 | 3300025986 | Bacteria | 1442 |
| 209 | Ga0207677_10525243 | 3300026023 | Bacteria | 1027 |
| 210 | Ga0207639_10276562 | 3300026041 | Bacteria | 1475 |
| 211 | Ga0207678_10258548 | 3300026067 | Bacteria | 1492 |
| 212 | Ga0207708_10002108 | 3300026075 | Bacteria | 14651 |
| 213 | Ga0207708_10183758 | 3300026075 | Bacteria | 1661 |
| 214 | Ga0207648_10028837 | 3300026089 | Bacteria | 4920 |
| 215 | Ga0207676_10091364 | 3300026095 | Bacteria | 2501 |
| 216 | Ga0207674_10006182 | 3300026116 | Bacteria | 14128 |
| 217 | Ga0207674_10741718 | 3300026116 | Bacteria | 948 |
| 218 | Ga0207675_100008177 | 3300026118 | Bacteria | 9860 |
| 219 | Ga0207675_100120472 | 3300026118 | Bacteria | 2482 |
| 220 | Ga0207675_100506869 | 3300026118 | Bacteria | 1202 |
| 221 | Ga0207683_10091161 | 3300026121 | Bacteria | 2715 |
| 222 | Ga0207683_10161648 | 3300026121 | Bacteria | 2025 |
| 223 | Ga0207698_10154448 | 3300026142 | Bacteria | 1997 |
| 224 | Ga0207698_10387871 | 3300026142 | Bacteria | 1331 |
| 225 | Ga0209813_10007573 | 3300027866 | Bacteria | 2708 |
| 226 | Ga0268266_10032400 | 3300028379 | Bacteria | 4440 |
| 227 | Ga0268266_10362948 | 3300028379 | Bacteria | 1363 |
| 228 | Ga0268265_10000124 | 3300028380 | Bacteria | 96763 |
| 229 | Ga0268265_10849848 | 3300028380 | Bacteria | 893 |
| 230 | Ga0268264_10000896 | 3300028381 | Bacteria | 31371 |
| 231 | Ga0265327_10000566 | 3300031251 | Bacteria | 62909 |
| 232 | Ga0265327_10001801 | 3300031251 | Bacteria | 25152 |
| 233 | Ga0265327_10042533 | 3300031251 | Bacteria | 2438 |
| 234 | Ga0265327_10113768 | 3300031251 | Bacteria | 1290 |
| 235 | Ga0316576_10014866 | 3300031727 | Bacteria | 5208 |
| 236 | Ga0316576_10088499 | 3300031727 | Bacteria | 2305 |
| 237 | Ga0316576_10108804 | 3300031727 | Bacteria | 2077 |
| 238 | Ga0316578_10056478 | 3300031728 | Bacteria | 2306 |
| 239 | Ga0316578_10076503 | 3300031728 | Bacteria | 1987 |
| 240 | Ga0307405_10157897 | 3300031731 | Bacteria | 1603 |
| 241 | Ga0316577_10088639 | 3300031733 | Bacteria | 1732 |
| 242 | Ga0307413_10072525 | 3300031824 | Bacteria | 2174 |
| 243 | Ga0307413_10075950 | 3300031824 | Bacteria | 2134 |
| 244 | Ga0307413_10299002 | 3300031824 | Bacteria | 1220 |
| 245 | Ga0307406_10428522 | 3300031901 | Bacteria | 1056 |
| 246 | Ga0307407_10051531 | 3300031903 | Bacteria | 2360 |
| 247 | Ga0307407_10450623 | 3300031903 | Bacteria | 934 |
| 248 | Ga0307409_100153320 | 3300031995 | Bacteria | 2004 |
| 249 | Ga0307409_100507452 | 3300031995 | Bacteria | 1176 |
| 250 | Ga0307416_100178344 | 3300032002 | Bacteria | 1988 |
| 251 | Ga0307416_101058257 | 3300032002 | Bacteria | 915 |
| 252 | Ga0307411_10223069 | 3300032005 | Bacteria | 1464 |
| 253 | Ga0316585_10042380 | 3300032137 | Bacteria | 1452 |
| 254 | Ga0316580_10015536 | 3300032139 | Bacteria | 2330 |
| 255 | Ga0316580_10038850 | 3300032139 | Bacteria | 1471 |
| 256 | Ga0373956_0028549 | 3300035119 | Bacteria | 2429 |
| 257 | Ga0373955_0063454 | 3300035172 | Bacteria | 2046 |
| 258 | Ga0373931_0218396 | 3300035691 | Bacteria | 1147 |
| 259 | Ga0373931_0224540 | 3300035691 | Bacteria | 1132 |
| 260 | Ga0373931_0465064 | 3300035691 | Bacteria | 811 |
| 261 | Ga0373935_0240015 | 3300035692 | Bacteria | 1265 |
| 262 | Ga0373937_0009558 | 3300036401 | Bacteria | 8436 |
| 263 | Ga0373937_0114013 | 3300036401 | Bacteria | 2516 |
| 264 | Ga0316582_0003575 | 3300036647 | Bacteria | 7655 |
| 265 | Ga0316582_0140481 | 3300036647 | Bacteria | 1628 |
| 266 | Ga0316584_0003428 | 3300036712 | Bacteria | 10290 |
| 267 | Ga0373925_0118221 | 3300037068 | Bacteria | 2055 |
| 268 | Ga0373925_0399595 | 3300037068 | Bacteria | 1121 |
| 269 | Ga0395899_0188287 | 3300037312 | Bacteria | 1445 |
| 270 | Ga0395900_0073930 | 3300037418 | Bacteria | 3505 |
| 271 | Ga0395898_0019357 | 3300037466 | Bacteria | 6929 |
| 272 | Ga0395905_0478543 | 3300037471 | Bacteria | 1144 |
| 273 | Ga0436364_1214371 | 3300037853 | Bacteria | 3677 |
| 274 | Ga0395901_0056357 | 3300038443 | Bacteria | 4088 |
| 275 | Ga0395901_0077142 | 3300038443 | Bacteria | 3478 |
| 276 | Ga0395901_0213896 | 3300038443 | Bacteria | 2016 |
| 277 | Ga0400483_099246 | 3300039062 | Bacteria | 2992 |
| 278 | Ga0400483_196263 | 3300039062 | Bacteria | 1526 |
| 279 | Ga0436360_1190046 | 3300039438 | Bacteria | 1463 |
| 280 | Ga0439465_0019987 | 3300041413 | Bacteria | 2095 |
| 281 | Ga0439465_0063799 | 3300041413 | Bacteria | 1224 |
| 282 | Ga0439465_0100993 | 3300041413 | Bacteria | 996 |
| 283 | Ga0451793_0452152 | 3300041452 | Bacteria | 7256 |
| 284 | Ga0451793_1437933 | 3300041452 | Bacteria | 915 |
| 285 | Ga0451797_1225711 | 3300041453 | Bacteria | 1604 |
| 286 | Ga0451802_0440054 | 3300041460 | Bacteria | 673 |
| 287 | Ga0451807_1625867 | 3300041486 | Bacteria | 726 |
| 288 | Ga0451833_0784683 | 3300041491 | Bacteria | 4948 |
| 289 | Ga0451837_0189149 | 3300041494 | Bacteria | 5461 |
| 290 | Ga0451855_0291083 | 3300041511 | Bacteria | 1332 |
| 291 | Ga0439431_0017535 | 3300041997 | Bacteria | 1685 |
| 292 | Ga0439445_0015452 | 3300042004 | Bacteria | 1869 |
| 293 | Ga0439445_0052336 | 3300042004 | Bacteria | 1104 |
| 294 | Ga0439448_0006929 | 3300042005 | Bacteria | 3270 |
| 295 | Ga0439432_098440 | 3300042006 | Bacteria | 876 |
| 296 | Ga0439450_003860 | 3300042008 | Bacteria | 2515 |
| 297 | Ga0439463_013607 | 3300042016 | Bacteria | 2003 |
| 298 | Ga0450896_001669 | 3300042133 | Bacteria | 2779 |
| 299 | Ga0450898_001181 | 3300042134 | Bacteria | 3370 |
| 300 | Ga0450899_001338 | 3300042135 | Bacteria | 2768 |
| 301 | Ga0450906_001520 | 3300042145 | Bacteria | 5064 |
| 302 | Ga0439446_0019251 | 3300042156 | Bacteria | 1918 |
| 303 | Ga0439446_0130744 | 3300042156 | Bacteria | 814 |
| 304 | Ga0439434_0012377 | 3300042435 | Bacteria | 2525 |
| 305 | Ga0439460_0001148 | 3300042461 | Bacteria | 6200 |
| 306 | Ga0466969_0054372 | 3300044656 | Bacteria | 1961 |
| 307 | Ga0466969_0117424 | 3300044656 | Bacteria | 1241 |
| 308 | Ga0466972_0097871 | 3300044658 | Bacteria | 1389 |
| 309 | Ga0466972_0139428 | 3300044658 | Bacteria | 1141 |
| 310 | Ga0466965_0012980 | 3300044683 | Bacteria | 3924 |
| 311 | Ga0466965_0015494 | 3300044683 | Bacteria | 3622 |
| 312 | Ga0466965_0043278 | 3300044683 | Bacteria | 2223 |
| 313 | Ga0466965_0190861 | 3300044683 | Bacteria | 1084 |
| 314 | Ga0466965_0345241 | 3300044683 | Bacteria | 814 |
| 315 | Ga0466966_0058497 | 3300044684 | Bacteria | 2436 |
| 316 | Ga0466966_0074518 | 3300044684 | Bacteria | 2121 |
| 317 | Ga0466966_0099234 | 3300044684 | Bacteria | 1802 |
| 318 | Ga0466961_0005909 | 3300044693 | Bacteria | 7756 |
| 319 | Ga0466961_0055360 | 3300044693 | Bacteria | 2529 |
| 320 | Ga0466961_0056489 | 3300044693 | Bacteria | 2501 |
| 321 | Ga0466961_0142759 | 3300044693 | Bacteria | 1498 |
| 322 | Ga0466961_0286085 | 3300044693 | Bacteria | 1008 |
| 323 | Ga0466963_0026729 | 3300044694 | Bacteria | 3693 |
| 324 | Ga0466963_0042027 | 3300044694 | Bacteria | 3000 |
| 325 | Ga0466963_0063523 | 3300044694 | Bacteria | 2471 |
| 326 | Ga0466963_0077425 | 3300044694 | Bacteria | 2247 |
| 327 | Ga0466963_0216703 | 3300044694 | Bacteria | 1340 |
| 328 | Ga0466964_0013333 | 3300044706 | Bacteria | 3118 |
| 329 | Ga0466964_0039340 | 3300044706 | Bacteria | 1905 |
| 330 | Ga0466971_0039421 | 3300044719 | Bacteria | 2120 |
| 331 | Ga0466971_0059969 | 3300044719 | Bacteria | 1719 |
| 332 | Ga0466970_0069565 | 3300044765 | Bacteria | 1892 |
| 333 | Ga0466970_0076767 | 3300044765 | Bacteria | 1800 |
| 334 | Ga0466970_0126414 | 3300044765 | Bacteria | 1402 |
| 335 | Ga0466970_0179342 | 3300044765 | Bacteria | 1175 |
| 336 | Ga0466957_0016152 | 3300044842 | Bacteria | 4364 |
| 337 | Ga0466957_0102272 | 3300044842 | Bacteria | 1807 |
| 338 | Ga0466957_0161881 | 3300044842 | Bacteria | 1454 |
| 339 | Ga0466960_0002698 | 3300044901 | Bacteria | 6706 |
| 340 | Ga0466960_0015309 | 3300044901 | Bacteria | 3304 |
| 341 | Ga0466960_0060882 | 3300044901 | Bacteria | 1851 |
| 342 | Ga0466960_0129024 | 3300044901 | Bacteria | 1333 |
| 343 | Ga0466960_0173649 | 3300044901 | Bacteria | 1164 |
| 344 | Ga0466960_0201067 | 3300044901 | Bacteria | 1089 |
| 345 | Ga0466960_0204768 | 3300044901 | Bacteria | 1080 |
| 346 | Ga0466960_0214232 | 3300044901 | Bacteria | 1057 |
| 347 | Ga0466959_0149862 | 3300045049 | Bacteria | 1644 |
| 348 | Ga0466959_0348898 | 3300045049 | Bacteria | 1009 |
| 349 | Ga0451576_0243910 | 3300045051 | Bacteria | 1877 |
| 350 | Ga0466958_0043742 | 3300045836 | Bacteria | 2698 |
| 351 | Ga0466958_0103935 | 3300045836 | Bacteria | 1769 |
| 352 | Ga0466958_0416943 | 3300045836 | Bacteria | 868 |
| 353 | Ga0466967_0026909 | 3300045976 | Bacteria | 4774 |
| 354 | Ga0466967_0068255 | 3300045976 | Bacteria | 3174 |
| 355 | Ga0466967_0189037 | 3300045976 | Bacteria | 1945 |
| 356 | Ga0466967_0195215 | 3300045976 | Bacteria | 1915 |
| 357 | Ga0466967_0204158 | 3300045976 | Bacteria | 1872 |
| 358 | Ga0466967_0317977 | 3300045976 | Bacteria | 1501 |
| 359 | Ga0466967_1034330 | 3300045976 | Bacteria | 818 |
| 360 | Ga0466967_1404095 | 3300045976 | Bacteria | 695 |
| 361 | Ga0495641_0062686 | 3300046461 | Bacteria | 1676 |
| 362 | Ga0495641_0065041 | 3300046461 | Bacteria | 1642 |
| 363 | Ga0495641_0108335 | 3300046461 | Bacteria | 1240 |
| 364 | Ga0495651_0033476 | 3300046462 | Bacteria | 4008 |
| 365 | Ga0495653_0129276 | 3300046463 | Bacteria | 1790 |
| 366 | Ga0495582_0132424 | 3300046473 | Bacteria | 1409 |
| 367 | Ga0495608_0005189 | 3300046511 | Bacteria | 9307 |
| 368 | Ga0495608_0229384 | 3300046511 | Bacteria | 1163 |
| 369 | Ga0495630_0456785 | 3300046517 | Bacteria | 979 |
| 370 | Ga0495630_0492233 | 3300046517 | Bacteria | 940 |
| 371 | Ga0495652_0091997 | 3300046529 | Bacteria | 2479 |
| 372 | Ga0495640_0388724 | 3300046533 | Bacteria | 858 |
| 373 | Ga0495586_0127114 | 3300046535 | Bacteria | 1426 |
| 374 | Ga0495587_0023116 | 3300046536 | Bacteria | 3822 |
| 375 | Ga0495667_0006395 | 3300046559 | Bacteria | 7986 |
| 376 | Ga0495657_0006237 | 3300046675 | Bacteria | 9348 |
| 377 | Ga0495657_0062339 | 3300046675 | Bacteria | 2464 |
| 378 | Ga0495657_0121184 | 3300046675 | Bacteria | 1647 |
| 379 | Ga0495623_0132149 | 3300046679 | Bacteria | 1493 |
| 380 | Ga0495623_0200778 | 3300046679 | Bacteria | 1146 |
| 381 | Ga0495646_0265927 | 3300046680 | Bacteria | 915 |
| 382 | Ga0495658_0231810 | 3300046683 | Bacteria | 1158 |
| 383 | Ga0495624_0040007 | 3300046690 | Bacteria | 3004 |
| 384 | Ga0495589_0209236 | 3300046794 | Bacteria | 919 |
| 385 | Ga0495600_0083399 | 3300046809 | Bacteria | 2086 |
| 386 | Ga0495600_0577108 | 3300046809 | Bacteria | 685 |
| 387 | Ga0495604_0019020 | 3300047317 | Bacteria | 5501 |
| 388 | Ga0495604_0121519 | 3300047317 | Bacteria | 1890 |
| 389 | Ga0495676_0279106 | 3300047321 | Bacteria | 1132 |
| 390 | Ga0495680_0012478 | 3300047322 | Bacteria | 7475 |
| 391 | Ga0495675_0049961 | 3300047444 | Bacteria | 2658 |
| 392 | Ga0495675_0057777 | 3300047444 | Bacteria | 2460 |
| 393 | Ga0495593_0305302 | 3300047673 | Bacteria | 796 |
| 394 | Ga0495614_0137326 | 3300048089 | Bacteria | 1085 |
| 395 | Ga0496100_0225892 | 3300048903 | Bacteria | 1376 |
| 396 | Ga0496100_0227808 | 3300048903 | Bacteria | 1370 |
| 397 | Ga0496101_0051661 | 3300048904 | Bacteria | 2962 |
| 398 | Ga0496101_0409607 | 3300048904 | Bacteria | 1068 |
| 399 | Ga0496102_0026620 | 3300048905 | Bacteria | 5161 |
| 400 | Ga0496102_0601567 | 3300048905 | Bacteria | 1023 |
| 401 | Ga0496103_0029286 | 3300048906 | Bacteria | 3346 |
| 402 | Ga0496104_0007957 | 3300048907 | Bacteria | 9398 |
| 403 | Ga0496104_0063047 | 3300048907 | Bacteria | 3515 |
| 404 | Ga0496104_0281643 | 3300048907 | Bacteria | 1576 |
| 405 | Ga0496104_1086378 | 3300048907 | Bacteria | 704 |
| 406 | Ga0496105_0000120 | 3300048908 | Bacteria | 53984 |
| 407 | Ga0496105_0032956 | 3300048908 | Bacteria | 4253 |
| 408 | Ga0496105_0080889 | 3300048908 | Bacteria | 2684 |
| 409 | Ga0496105_0275514 | 3300048908 | Bacteria | 1358 |
| 410 | Ga0496106_0014173 | 3300048909 | Bacteria | 5888 |
| 411 | Ga0496106_0196199 | 3300048909 | Bacteria | 1606 |
| 412 | Ga0496107_0051409 | 3300048910 | Bacteria | 2972 |
| 413 | Ga0496108_0083123 | 3300048911 | Bacteria | 2716 |
| 414 | Ga0496108_0110529 | 3300048911 | Bacteria | 2350 |
| 415 | Ga0496108_0160735 | 3300048911 | Bacteria | 1941 |
| 416 | Ga0496108_0279694 | 3300048911 | Bacteria | 1453 |
| 417 | Ga0496108_0458313 | 3300048911 | Bacteria | 1114 |
| 418 | Ga0496109_0050712 | 3300048912 | Bacteria | 3779 |
| 419 | Ga0496109_0084261 | 3300048912 | Bacteria | 2932 |
| 420 | Ga0496109_0110142 | 3300048912 | Bacteria | 2560 |
| 421 | Ga0496109_0112901 | 3300048912 | Bacteria | 2527 |
| 422 | Ga0496110_0016080 | 3300048913 | Bacteria | 6239 |
| 423 | Ga0496110_0255915 | 3300048913 | Bacteria | 1594 |
| 424 | Ga0496110_0271383 | 3300048913 | Bacteria | 1544 |
| 425 | Ga0496110_0340901 | 3300048913 | Bacteria | 1365 |
| 426 | Ga0496110_0344089 | 3300048913 | Bacteria | 1358 |
| 427 | Ga0496110_0662401 | 3300048913 | Bacteria | 944 |
| 428 | Ga0496110_0833567 | 3300048913 | Bacteria | 827 |
| 429 | Ga0496111_0202049 | 3300048914 | Bacteria | 1477 |
| 430 | Ga0496111_0314193 | 3300048914 | Bacteria | 1161 |
| 431 | Ga0496112_0752438 | 3300048915 | Bacteria | 901 |
| 432 | Ga0496112_1018341 | 3300048915 | Bacteria | 748 |
| 433 | Ga0496114_0063023 | 3300048917 | Bacteria | 3103 |
| 434 | Ga0496114_0068261 | 3300048917 | Bacteria | 2984 |
| 435 | Ga0496114_0088306 | 3300048917 | Bacteria | 2630 |
| 436 | Ga0496114_0154463 | 3300048917 | Bacteria | 1992 |
| 437 | Ga0496114_0161437 | 3300048917 | Bacteria | 1949 |
| 438 | Ga0496115_0194966 | 3300048918 | Bacteria | 1673 |
| 439 | Ga0496126_0191536 | 3300048929 | Bacteria | 1732 |
| 440 | Ga0501317_008506 | 3300049533 | Bacteria | 1183 |
| 441 | Ga0501318_009274 | 3300049534 | Bacteria | 1069 |
| 442 | Ga0501031_0045272 | 3300049568 | Bacteria | 2871 |
| 443 | Ga0501031_0227220 | 3300049568 | Bacteria | 1215 |
| 444 | Ga0501032_0004992 | 3300049569 | Bacteria | 9922 |
| 445 | Ga0501032_0041431 | 3300049569 | Bacteria | 3128 |
| 446 | Ga0501032_0084460 | 3300049569 | Bacteria | 2111 |
| 447 | Ga0501033_0005923 | 3300049570 | Bacteria | 9598 |
| 448 | Ga0501033_0011495 | 3300049570 | Bacteria | 6776 |
| 449 | Ga0501033_0384792 | 3300049570 | Bacteria | 980 |
| 450 | Ga0501034_0011800 | 3300049571 | Bacteria | 9043 |
| 451 | Ga0501034_0013733 | 3300049571 | Bacteria | 8331 |
| 452 | Ga0501034_0044210 | 3300049571 | Bacteria | 4505 |
| 453 | Ga0501034_0046611 | 3300049571 | Bacteria | 4379 |
| 454 | Ga0501034_0108296 | 3300049571 | Bacteria | 2770 |
| 455 | Ga0501034_0300967 | 3300049571 | Bacteria | 1540 |
| 456 | Ga0501036_0001691 | 3300049572 | Bacteria | 17131 |
| 457 | Ga0501036_0002033 | 3300049572 | Bacteria | 15755 |
| 458 | Ga0501036_0002935 | 3300049572 | Bacteria | 13537 |
| 459 | Ga0501036_0178307 | 3300049572 | Bacteria | 1789 |
| 460 | Ga0501036_0747063 | 3300049572 | Bacteria | 807 |
| 461 | Ga0501037_0004582 | 3300049573 | Bacteria | 10045 |
| 462 | Ga0501037_0010742 | 3300049573 | Bacteria | 6728 |
| 463 | Ga0501037_0109559 | 3300049573 | Bacteria | 1990 |
| 464 | Ga0501037_0116896 | 3300049573 | Bacteria | 1919 |
| 465 | Ga0501038_0006532 | 3300049574 | Bacteria | 10786 |
| 466 | Ga0501038_0026370 | 3300049574 | Bacteria | 5175 |
| 467 | Ga0501038_0063465 | 3300049574 | Bacteria | 3152 |
| 468 | Ga0501038_0092811 | 3300049574 | Bacteria | 2527 |
| 469 | Ga0501038_0158231 | 3300049574 | Bacteria | 1843 |
| 470 | Ga0501038_0364712 | 3300049574 | Bacteria | 1123 |
| 471 | Ga0501039_0005557 | 3300049575 | Bacteria | 9539 |
| 472 | Ga0501039_0007936 | 3300049575 | Bacteria | 8085 |
| 473 | Ga0501039_0107463 | 3300049575 | Bacteria | 2180 |
| 474 | Ga0501039_0124681 | 3300049575 | Bacteria | 2020 |
| 475 | Ga0501040_0000672 | 3300049576 | Bacteria | 21143 |
| 476 | Ga0501040_0093802 | 3300049576 | Bacteria | 2088 |
| 477 | Ga0501041_0317354 | 3300049577 | Bacteria | 983 |
| 478 | Ga0501042_0004438 | 3300049578 | Bacteria | 8950 |
| 479 | Ga0501042_0005452 | 3300049578 | Bacteria | 8195 |
| 480 | Ga0501042_0044199 | 3300049578 | Bacteria | 3173 |
| 481 | Ga0501042_0064403 | 3300049578 | Bacteria | 2619 |
| 482 | Ga0501042_0115683 | 3300049578 | Bacteria | 1931 |
| 483 | Ga0501042_0361258 | 3300049578 | Bacteria | 1051 |
| 484 | Ga0501043_0011613 | 3300049579 | Bacteria | 6894 |
| 485 | Ga0501043_0033173 | 3300049579 | Bacteria | 4061 |
| 486 | Ga0501043_0048207 | 3300049579 | Bacteria | 3349 |
| 487 | Ga0501046_0008028 | 3300049580 | Bacteria | 9225 |
| 488 | Ga0501046_0028427 | 3300049580 | Bacteria | 4553 |
| 489 | Ga0501046_0078726 | 3300049580 | Bacteria | 2549 |
| 490 | Ga0501046_0083454 | 3300049580 | Bacteria | 2466 |
| 491 | Ga0501047_0012050 | 3300049581 | Bacteria | 8182 |
| 492 | Ga0501047_0026276 | 3300049581 | Bacteria | 5600 |
| 493 | Ga0501047_0052494 | 3300049581 | Bacteria | 3940 |
| 494 | Ga0501047_0323976 | 3300049581 | Bacteria | 1380 |
| 495 | Ga0501047_0341545 | 3300049581 | Bacteria | 1335 |
| 496 | Ga0501047_0769611 | 3300049581 | Bacteria | 778 |
| 497 | Ga0501048_0010763 | 3300049582 | Bacteria | 6820 |
| 498 | Ga0501048_0021577 | 3300049582 | Bacteria | 4715 |
| 499 | Ga0501048_0297861 | 3300049582 | Bacteria | 1147 |
| 500 | Ga0501067_0002053 | 3300049583 | Bacteria | 11111 |
| 501 | Ga0501067_0013627 | 3300049583 | Bacteria | 4502 |
| 502 | Ga0501067_0070232 | 3300049583 | Bacteria | 1939 |
| 503 | Ga0501068_0020200 | 3300049584 | Bacteria | 3878 |
| 504 | Ga0501068_0036899 | 3300049584 | Bacteria | 2925 |
| 505 | Ga0501068_0111959 | 3300049584 | Bacteria | 1698 |
| 506 | Ga0501069_0000070 | 3300049585 | Bacteria | 52095 |
| 507 | Ga0501069_0003304 | 3300049585 | Bacteria | 8275 |
| 508 | Ga0501069_0640600 | 3300049585 | Bacteria | 639 |
| 509 | Ga0501070_0000011 | 3300049586 | Bacteria | 191906 |
| 510 | Ga0501070_0003699 | 3300049586 | Bacteria | 13215 |
| 511 | Ga0501070_0006215 | 3300049586 | Bacteria | 10167 |
| 512 | Ga0501070_0010553 | 3300049586 | Bacteria | 7808 |
| 513 | Ga0501070_0012740 | 3300049586 | Bacteria | 7089 |
| 514 | Ga0501070_0034648 | 3300049586 | Bacteria | 4219 |
| 515 | Ga0501070_0054447 | 3300049586 | Bacteria | 3318 |
| 516 | Ga0501070_0235703 | 3300049586 | Bacteria | 1499 |
| 517 | Ga0501070_0307645 | 3300049586 | Bacteria | 1290 |
| 518 | Ga0501071_0001879 | 3300049587 | Bacteria | 12471 |
| 519 | Ga0501071_0002144 | 3300049587 | Bacteria | 11857 |
| 520 | Ga0501071_0003221 | 3300049587 | Bacteria | 10169 |
| 521 | Ga0501071_0010142 | 3300049587 | Bacteria | 6304 |
| 522 | Ga0501071_0039789 | 3300049587 | Bacteria | 3364 |
| 523 | Ga0501071_0041074 | 3300049587 | Bacteria | 3312 |
| 524 | Ga0501071_0046239 | 3300049587 | Bacteria | 3126 |
| 525 | Ga0501071_0139948 | 3300049587 | Bacteria | 1802 |
| 526 | Ga0501072_0003311 | 3300049588 | Bacteria | 12116 |
| 527 | Ga0501072_0015013 | 3300049588 | Bacteria | 5937 |
| 528 | Ga0501072_0070277 | 3300049588 | Bacteria | 2765 |
| 529 | Ga0501072_0135730 | 3300049588 | Bacteria | 1961 |
| 530 | Ga0501072_0298741 | 3300049588 | Bacteria | 1280 |
| 531 | Ga0501073_0004316 | 3300049589 | Bacteria | 10670 |
| 532 | Ga0501073_0030490 | 3300049589 | Bacteria | 3851 |
| 533 | Ga0501073_0041947 | 3300049589 | Bacteria | 3231 |
| 534 | Ga0501073_0061684 | 3300049589 | Bacteria | 2616 |
| 535 | Ga0501073_0238625 | 3300049589 | Bacteria | 1256 |
| 536 | Ga0501074_0000999 | 3300049590 | Bacteria | 18394 |
| 537 | Ga0501074_0007271 | 3300049590 | Bacteria | 8003 |
| 538 | Ga0501074_0014355 | 3300049590 | Bacteria | 5763 |
| 539 | Ga0501074_0026730 | 3300049590 | Bacteria | 4185 |
| 540 | Ga0501074_0057010 | 3300049590 | Bacteria | 2815 |
| 541 | Ga0501074_0142338 | 3300049590 | Bacteria | 1715 |
| 542 | Ga0501074_0167082 | 3300049590 | Bacteria | 1571 |
| 543 | Ga0501074_0176845 | 3300049590 | Bacteria | 1523 |
| 544 | Ga0501074_0186762 | 3300049590 | Bacteria | 1478 |
| 545 | Ga0501074_0486856 | 3300049590 | Bacteria | 874 |
| 546 | Ga0501075_0000279 | 3300049591 | Bacteria | 28284 |
| 547 | Ga0501075_0102658 | 3300049591 | Bacteria | 2172 |
| 548 | Ga0501075_0142624 | 3300049591 | Bacteria | 1826 |
| 549 | Ga0501075_0198127 | 3300049591 | Bacteria | 1532 |
| 550 | Ga0501075_0297838 | 3300049591 | Bacteria | 1229 |
| 551 | Ga0501076_0010194 | 3300049592 | Bacteria | 6963 |
| 552 | Ga0501076_0167165 | 3300049592 | Bacteria | 1793 |
| 553 | Ga0501076_0301600 | 3300049592 | Bacteria | 1313 |
| 554 | Ga0501076_0431247 | 3300049592 | Bacteria | 1085 |
| 555 | Ga0501077_0000632 | 3300049593 | Bacteria | 21344 |
| 556 | Ga0501077_0004798 | 3300049593 | Bacteria | 8222 |
| 557 | Ga0501077_0015631 | 3300049593 | Bacteria | 4780 |
| 558 | Ga0501077_0036081 | 3300049593 | Bacteria | 3149 |
| 559 | Ga0501077_0061143 | 3300049593 | Bacteria | 2390 |
| 560 | Ga0501079_0002731 | 3300049741 | Bacteria | 12856 |
| 561 | Ga0501079_0004880 | 3300049741 | Bacteria | 9941 |
| 562 | Ga0501079_0071192 | 3300049741 | Bacteria | 2686 |
| 563 | Ga0501079_0600061 | 3300049741 | Bacteria | 866 |
| 564 | Ga0501080_0001015 | 3300049742 | Bacteria | 23068 |
| 565 | Ga0501080_0006490 | 3300049742 | Bacteria | 10503 |
| 566 | Ga0501080_0010183 | 3300049742 | Bacteria | 8597 |
| 567 | Ga0501080_0017318 | 3300049742 | Bacteria | 6660 |
| 568 | Ga0501080_0046390 | 3300049742 | Bacteria | 4046 |
| 569 | Ga0501080_0085067 | 3300049742 | Bacteria | 2939 |
| 570 | Ga0501080_1056524 | 3300049742 | Bacteria | 702 |
| 571 | Ga0501081_0006922 | 3300049743 | Bacteria | 7368 |
| 572 | Ga0501081_0222144 | 3300049743 | Bacteria | 1374 |
| 573 | Ga0501081_0462293 | 3300049743 | Bacteria | 943 |
| 574 | Ga0501083_0000140 | 3300049744 | Bacteria | 49326 |
| 575 | Ga0501083_0005954 | 3300049744 | Bacteria | 8633 |
| 576 | Ga0501083_0036475 | 3300049744 | Bacteria | 3354 |
| 577 | Ga0501083_0153823 | 3300049744 | Bacteria | 1506 |
| 578 | Ga0501035_0070799 | 3300049822 | Bacteria | 3089 |
| 579 | Ga0501035_0383065 | 3300049822 | Bacteria | 1172 |
| 580 | Ga0501044_0038860 | 3300049823 | Bacteria | 4969 |
| 581 | Ga0501044_0261735 | 3300049823 | Bacteria | 1668 |
| 582 | Ga0501044_0392921 | 3300049823 | Bacteria | 1300 |
| 583 | Ga0501044_0495168 | 3300049823 | Bacteria | 1124 |
| 584 | Ga0501045_0011714 | 3300049824 | Bacteria | 6161 |
| 585 | Ga0501045_0053014 | 3300049824 | Bacteria | 2963 |
| 586 | Ga0501045_0104635 | 3300049824 | Bacteria | 2097 |
| 587 | Ga0501045_0358015 | 3300049824 | Bacteria | 1086 |
| 588 | Ga0501045_0634028 | 3300049824 | Bacteria | 790 |
| 589 | nmdc:mga03n38_10458_c1 | 3300050490 | Bacteria | 3414 |
| 590 | nmdc:mga03n38_110028_c1 | 3300050490 | Bacteria | 1340 |
| 591 | nmdc:mga03n38_15323_c1 | 3300050490 | Bacteria | 2958 |
| 592 | nmdc:mga03n38_208628_c1 | 3300050490 | Bacteria | 1014 |
| 593 | nmdc:mga03n38_371614_c1 | 3300050490 | Bacteria | 782 |
| 594 | nmdc:mga03n38_65003_c1 | 3300050490 | Bacteria | 1671 |
| 595 | nmdc:mga00v17_16636_c1 | 3300050491 | Bacteria | 4147 |
| 596 | nmdc:mga00v17_3074_c1 | 3300050491 | Bacteria | 8576 |
| 597 | nmdc:mga00v17_73061_c1 | 3300050491 | Bacteria | 2129 |
| 598 | nmdc:mga0yw44_110306_c1 | 3300050492 | Bacteria | 1762 |
| 599 | nmdc:mga0yw44_11576_c1 | 3300050492 | Bacteria | 4563 |
| 600 | nmdc:mga0yw44_125_c2 | 3300050492 | Bacteria | 26416 |
| 601 | nmdc:mga0yw44_165465_c1 | 3300050492 | Bacteria | 1450 |
| 602 | nmdc:mga0yw44_194411_c1 | 3300050492 | Bacteria | 1339 |
| 603 | nmdc:mga0yw44_211258_c1 | 3300050492 | Bacteria | 1284 |
| 604 | nmdc:mga0yw44_239639_c1 | 3300050492 | Bacteria | 1205 |
| 605 | nmdc:mga0yw44_264372_c1 | 3300050492 | Bacteria | 1147 |
| 606 | nmdc:mga0yw44_266828_c1 | 3300050492 | Bacteria | 1142 |
| 607 | nmdc:mga0yw44_301517_c1 | 3300050492 | Bacteria | 1074 |
| 608 | nmdc:mga0yw44_3056_c1 | 3300050492 | Bacteria | 7325 |
| 609 | nmdc:mga0yw44_329861_c1 | 3300050492 | Bacteria | 1025 |
| 610 | nmdc:mga0yw44_386124_c1 | 3300050492 | Bacteria | 946 |
| 611 | nmdc:mga0yw44_435_c1 | 3300050492 | Bacteria | 14683 |
| 612 | nmdc:mga0yw44_76432_c1 | 3300050492 | Bacteria | 2090 |
| 613 | nmdc:mga0yw44_77431_c1 | 3300050492 | Bacteria | 2077 |
| 614 | nmdc:mga06z11_195442_c1 | 3300050494 | Bacteria | 1173 |
| 615 | nmdc:mga06z11_23480_c1 | 3300050494 | Bacteria | 2898 |
| 616 | nmdc:mga06z11_4639_c1 | 3300050494 | Bacteria | 5421 |
| 617 | nmdc:mga06z11_499533_c1 | 3300050494 | Bacteria | 737 |
| 618 | nmdc:mga06z11_62882_c1 | 3300050494 | Bacteria | 1940 |
| 619 | nmdc:mga04h51_116063_c1 | 3300050495 | Bacteria | 992 |
| 620 | nmdc:mga04h51_4724_c1 | 3300050495 | Bacteria | 3414 |
| 621 | nmdc:mga04h51_94602_c1 | 3300050495 | Bacteria | 1080 |
| 622 | nmdc:mga07m45_20544_c1 | 3300050496 | Bacteria | 3587 |
| 623 | nmdc:mga05p37_824159_c1 | 3300050507 | Bacteria | 1011 |
| 624 | nmdc:mga05p37_841915_c1 | 3300050507 | Bacteria | 997 |
| 625 | nmdc:mga09592_1031327_c1 | 3300050508 | Bacteria | 686 |
| 626 | nmdc:mga0qj67_160807_c1 | 3300050509 | Bacteria | 1823 |
| 627 | nmdc:mga06r32_308979_c1 | 3300050510 | Bacteria | 1567 |
| 628 | nmdc:mga08y16_479936_c1 | 3300050511 | Bacteria | 1265 |
| 629 | Ga0495601_0094095 | 3300053077 | Bacteria | 1931 |
| 630 | Ga0495601_0187981 | 3300053077 | Bacteria | 1350 |
| 631 | Ga0495612_0112774 | 3300053078 | Bacteria | 1165 |
| 632 | Ga0495655_0091543 | 3300053083 | Bacteria | 887 |
| 633 | Ga0495595_0057968 | 3300053084 | Bacteria | 1807 |
| 634 | Ga0495619_0004026 | 3300053085 | Bacteria | 9411 |
| 635 | Ga0495619_0017291 | 3300053085 | Bacteria | 4567 |
| 636 | Ga0495619_0272177 | 3300053085 | Bacteria | 1174 |
| 637 | Ga0495619_0501477 | 3300053085 | Bacteria | 835 |
| 638 | Ga0500644_0000499 | 3300053088 | Bacteria | 16960 |
| 639 | Ga0500644_0096558 | 3300053088 | Bacteria | 1116 |
| 640 | Ga0500583_0044371 | 3300053092 | Bacteria | 2036 |
| 641 | Ga0500641_0001880 | 3300053096 | Bacteria | 7452 |
| 642 | Ga0500641_0034811 | 3300053096 | Bacteria | 2007 |
| 643 | Ga0500556_0000985 | 3300053104 | Bacteria | 15093 |
| 644 | Ga0500593_001205 | 3300053117 | Bacteria | 9343 |
| 645 | Ga0500655_025574 | 3300053133 | Bacteria | 1121 |
| 646 | Ga0500568_0000050 | 3300053139 | Bacteria | 115722 |
| 647 | Ga0500573_0007551 | 3300053140 | Bacteria | 5937 |
| 648 | Ga0500573_0073995 | 3300053140 | Bacteria | 1941 |
| 649 | Ga0501084_0000502 | 3300054114 | Bacteria | 30008 |
| 650 | Ga0501084_0003106 | 3300054114 | Bacteria | 13460 |
| 651 | Ga0501084_0011106 | 3300054114 | Bacteria | 7459 |
| 652 | Ga0501084_0215016 | 3300054114 | Bacteria | 1622 |
| 653 | Ga0501084_0729665 | 3300054114 | Bacteria | 835 |
| 654 | Ga0501084_0732665 | 3300054114 | Bacteria | 833 |
| 655 | Ga0501082_0001956 | 3300060353 | Bacteria | 18133 |
| 656 | Ga0501082_0055744 | 3300060353 | Bacteria | 3404 |
| 657 | Ga0501082_0458567 | 3300060353 | Bacteria | 1114 |
| 658 | Ga0501082_0519489 | 3300060353 | Bacteria | 1041 |
| 659 | Ga0501082_0871621 | 3300060353 | Bacteria | 788 |
| 660 | Ga0466962_0086962 | 3300061719 | Bacteria | 1497 |
| 661 | Ga0530510_0000347 | 3300061734 | Bacteria | 29869 |
| 662 | Ga0530510_0008061 | 3300061734 | Bacteria | 7348 |
| 663 | Ga0530510_0009732 | 3300061734 | Bacteria | 6745 |
| 664 | Ga0530510_0358346 | 3300061734 | Bacteria | 1096 |
| 665 | Ga0530510_0747794 | 3300061734 | Bacteria | 746 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009147 | Ga0114129_10506070 | Ga0114129_105060702 | 180 |
| 2 | 3300050507 | nmdc:mga05p37_841915_c1 | nmdc:mga05p37_841915_c1_190_762 | 180 |
| 3 | 3300050508 | nmdc:mga09592_1031327_c1 | nmdc:mga09592_1031327_c1_104_676 | 180 |
| 4 | 3300046683 | Ga0495658_0231810 | Ga0495658_0231810_547_1137 | 187 |
| 5 | 3300039062 | Ga0400483_196263 | Ga0400483_196263_42_620 | 189 |
| 6 | 3300006871 | Ga0075434_100310964 | Ga0075434_1003109642 | 190 |
| 7 | 3300009177 | Ga0105248_10662485 | Ga0105248_106624851 | 191 |
| 8 | 3300014968 | Ga0157379_11091617 | Ga0157379_110916171 | 191 |
| 9 | 3300025941 | Ga0207711_10654927 | Ga0207711_106549271 | 191 |
| 10 | 3300013308 | Ga0157375_10310984 | Ga0157375_103109842 | 196 |
| 11 | 3300025939 | Ga0207665_10474220 | Ga0207665_104742202 | 196 |
| 12 | 3300060353 | Ga0501082_0458567 | Ga0501082_0458567_229_846 | 196 |
| 13 | 3300046794 | Ga0495589_0209236 | Ga0495589_0209236_266_880 | 197 |
| 14 | 3300049586 | Ga0501070_0307645 | Ga0501070_0307645_651_1268 | 197 |
| 15 | 3300049585 | Ga0501069_0640600 | Ga0501069_0640600_24_629 | 198 |
| 16 | 3300041460 | Ga0451802_0440054 | Ga0451802_0440054_43_642 | 199 |
| 17 | 3300044656 | Ga0466969_0117424 | Ga0466969_0117424_619_1218 | 199 |
| 18 | 3300044901 | Ga0466960_0060882 | Ga0466960_0060882_11_610 | 199 |
| 19 | 3300044901 | Ga0466960_0173649 | Ga0466960_0173649_548_1147 | 199 |
| 20 | 3300045976 | Ga0466967_1034330 | Ga0466967_1034330_38_637 | 199 |
| 21 | 3300048907 | Ga0496104_1086378 | Ga0496104_1086378_89_688 | 199 |
| 22 | 3300050490 | nmdc:mga03n38_371614_c1 | nmdc:mga03n38_371614_c1_149_757 | 199 |
| 23 | 3300050492 | nmdc:mga0yw44_264372_c1 | nmdc:mga0yw44_264372_c1_35_634 | 199 |
| 24 | 3300037068 | Ga0373925_0399595 | Ga0373925_0399595_186_806 | 200 |
| 25 | 3300005327 | Ga0070658_10447247 | Ga0070658_104472471 | 201 |
| 26 | 3300006038 | Ga0075365_10003301 | Ga0075365_100033011 | 201 |
| 27 | 3300006038 | Ga0075365_10131074 | Ga0075365_101310743 | 201 |
| 28 | 3300006048 | Ga0075363_100056219 | Ga0075363_1000562193 | 201 |
| 29 | 3300025909 | Ga0207705_10351347 | Ga0207705_103513472 | 201 |
| 30 | 3300049572 | Ga0501036_0747063 | Ga0501036_0747063_126_770 | 201 |
| 31 | 3300050490 | nmdc:mga03n38_65003_c1 | nmdc:mga03n38_65003_c1_869_1492 | 201 |
| 32 | 3300050492 | nmdc:mga0yw44_125_c2 | nmdc:mga0yw44_125_c2_25639_26262 | 201 |
| 33 | 3300050492 | nmdc:mga0yw44_194411_c1 | nmdc:mga0yw44_194411_c1_704_1327 | 201 |
| 34 | 3300050492 | nmdc:mga0yw44_76432_c1 | nmdc:mga0yw44_76432_c1_75_698 | 201 |
| 35 | 3300005354 | Ga0070675_100593667 | Ga0070675_1005936672 | 202 |
| 36 | 3300005364 | Ga0070673_100789988 | Ga0070673_1007899881 | 202 |
| 37 | 3300009551 | Ga0105238_10845125 | Ga0105238_108451252 | 202 |
| 38 | 3300013308 | Ga0157375_10187919 | Ga0157375_101879193 | 202 |
| 39 | 3300025916 | Ga0207663_10041402 | Ga0207663_100414021 | 202 |
| 40 | 3300031251 | Ga0265327_10000566 | Ga0265327_1000056614 | 202 |
| 41 | 3300031251 | Ga0265327_10113768 | Ga0265327_101137682 | 202 |
| 42 | 3300031727 | Ga0316576_10108804 | Ga0316576_101088042 | 202 |
| 43 | 3300031728 | Ga0316578_10056478 | Ga0316578_100564781 | 202 |
| 44 | 3300032139 | Ga0316580_10038850 | Ga0316580_100388502 | 202 |
| 45 | 3300035119 | Ga0373956_0028549 | Ga0373956_0028549_1678_2307 | 202 |
| 46 | 3300035691 | Ga0373931_0224540 | Ga0373931_0224540_309_944 | 202 |
| 47 | 3300036401 | Ga0373937_0009558 | Ga0373937_0009558_7770_8399 | 202 |
| 48 | 3300046461 | Ga0495641_0108335 | Ga0495641_0108335_353_988 | 202 |
| 49 | 3300046462 | Ga0495651_0033476 | Ga0495651_0033476_1899_2528 | 202 |
| 50 | 3300046463 | Ga0495653_0129276 | Ga0495653_0129276_422_1051 | 202 |
| 51 | 3300046511 | Ga0495608_0005189 | Ga0495608_0005189_2735_3364 | 202 |
| 52 | 3300046529 | Ga0495652_0091997 | Ga0495652_0091997_519_1148 | 202 |
| 53 | 3300046533 | Ga0495640_0388724 | Ga0495640_0388724_219_848 | 202 |
| 54 | 3300046536 | Ga0495587_0023116 | Ga0495587_0023116_391_1020 | 202 |
| 55 | 3300046559 | Ga0495667_0006395 | Ga0495667_0006395_3796_4425 | 202 |
| 56 | 3300046675 | Ga0495657_0006237 | Ga0495657_0006237_5767_6396 | 202 |
| 57 | 3300046679 | Ga0495623_0132149 | Ga0495623_0132149_519_1148 | 202 |
| 58 | 3300046809 | Ga0495600_0083399 | Ga0495600_0083399_719_1348 | 202 |
| 59 | 3300047317 | Ga0495604_0121519 | Ga0495604_0121519_847_1476 | 202 |
| 60 | 3300047322 | Ga0495680_0012478 | Ga0495680_0012478_1068_1697 | 202 |
| 61 | 3300047444 | Ga0495675_0049961 | Ga0495675_0049961_1752_2381 | 202 |
| 62 | 3300048911 | Ga0496108_0160735 | Ga0496108_0160735_1090_1704 | 202 |
| 63 | 3300048912 | Ga0496109_0112901 | Ga0496109_0112901_99_713 | 202 |
| 64 | 3300048915 | Ga0496112_1018341 | Ga0496112_1018341_70_684 | 202 |
| 65 | 3300048917 | Ga0496114_0088306 | Ga0496114_0088306_792_1427 | 202 |
| 66 | 3300053084 | Ga0495595_0057968 | Ga0495595_0057968_841_1470 | 202 |
| 67 | 3300053085 | Ga0495619_0004026 | Ga0495619_0004026_2542_3171 | 202 |
| 68 | 3300053085 | Ga0495619_0272177 | Ga0495619_0272177_500_1114 | 202 |
| 69 | 3300053139 | Ga0500568_0000050 | Ga0500568_0000050_81571_82188 | 202 |
| 70 | iso_pu_bacteria | 2808606439 | 2809196378 | 202 |
| 71 | iso_pu_bacteria | 2811994878 | 2812351456 | 202 |
| 72 | 3300005458 | Ga0070681_10834885 | Ga0070681_108348851 | 203 |
| 73 | 3300005547 | Ga0070693_100050725 | Ga0070693_1000507252 | 203 |
| 74 | 3300005617 | Ga0068859_100000803 | Ga0068859_10000080325 | 203 |
| 75 | 3300005844 | Ga0068862_100000737 | Ga0068862_10000073730 | 203 |
| 76 | 3300005985 | Ga0081539_10014044 | Ga0081539_100140447 | 203 |
| 77 | 3300006048 | Ga0075363_100022337 | Ga0075363_1000223372 | 203 |
| 78 | 3300006931 | Ga0097620_100000803 | Ga0097620_10000080325 | 203 |
| 79 | 3300013297 | Ga0157378_10653417 | Ga0157378_106534171 | 203 |
| 80 | 3300013308 | Ga0157375_11637636 | Ga0157375_116376361 | 203 |
| 81 | 3300014325 | Ga0163163_10418852 | Ga0163163_104188523 | 203 |
| 82 | 3300025927 | Ga0207687_10622700 | Ga0207687_106227001 | 203 |
| 83 | 3300026121 | Ga0207683_10161648 | Ga0207683_101616482 | 203 |
| 84 | 3300028380 | Ga0268265_10000124 | Ga0268265_1000012452 | 203 |
| 85 | 3300028380 | Ga0268265_10849848 | Ga0268265_108498482 | 203 |
| 86 | 3300031251 | Ga0265327_10042533 | Ga0265327_100425331 | 203 |
| 87 | 3300035172 | Ga0373955_0063454 | Ga0373955_0063454_648_1265 | 203 |
| 88 | 3300035691 | Ga0373931_0218396 | Ga0373931_0218396_296_913 | 203 |
| 89 | 3300035691 | Ga0373931_0465064 | Ga0373931_0465064_116_733 | 203 |
| 90 | 3300035692 | Ga0373935_0240015 | Ga0373935_0240015_205_822 | 203 |
| 91 | 3300036401 | Ga0373937_0114013 | Ga0373937_0114013_1162_1779 | 203 |
| 92 | 3300037068 | Ga0373925_0118221 | Ga0373925_0118221_1121_1738 | 203 |
| 93 | 3300044684 | Ga0466966_0074518 | Ga0466966_0074518_255_884 | 203 |
| 94 | 3300044693 | Ga0466961_0286085 | Ga0466961_0286085_97_726 | 203 |
| 95 | 3300046473 | Ga0495582_0132424 | Ga0495582_0132424_760_1374 | 203 |
| 96 | 3300046675 | Ga0495657_0062339 | Ga0495657_0062339_625_1251 | 203 |
| 97 | 3300046680 | Ga0495646_0265927 | Ga0495646_0265927_204_821 | 203 |
| 98 | 3300046690 | Ga0495624_0040007 | Ga0495624_0040007_588_1205 | 203 |
| 99 | 3300047321 | Ga0495676_0279106 | Ga0495676_0279106_122_739 | 203 |
| 100 | 3300048089 | Ga0495614_0137326 | Ga0495614_0137326_148_762 | 203 |
| 101 | 3300048903 | Ga0496100_0227808 | Ga0496100_0227808_607_1227 | 203 |
| 102 | 3300048904 | Ga0496101_0409607 | Ga0496101_0409607_188_808 | 203 |
| 103 | 3300048905 | Ga0496102_0601567 | Ga0496102_0601567_351_968 | 203 |
| 104 | 3300048907 | Ga0496104_0063047 | Ga0496104_0063047_1026_1646 | 203 |
| 105 | 3300048908 | Ga0496105_0032956 | Ga0496105_0032956_2418_3038 | 203 |
| 106 | 3300048908 | Ga0496105_0080889 | Ga0496105_0080889_1741_2361 | 203 |
| 107 | 3300048913 | Ga0496110_0255915 | Ga0496110_0255915_234_857 | 203 |
| 108 | 3300048913 | Ga0496110_0271383 | Ga0496110_0271383_783_1406 | 203 |
| 109 | 3300048913 | Ga0496110_0662401 | Ga0496110_0662401_23_640 | 203 |
| 110 | 3300049571 | Ga0501034_0300967 | Ga0501034_0300967_66_680 | 203 |
| 111 | 3300049572 | Ga0501036_0178307 | Ga0501036_0178307_988_1602 | 203 |
| 112 | 3300049573 | Ga0501037_0109559 | Ga0501037_0109559_1336_1950 | 203 |
| 113 | 3300049574 | Ga0501038_0364712 | Ga0501038_0364712_59_673 | 203 |
| 114 | 3300049579 | Ga0501043_0011613 | Ga0501043_0011613_2919_3533 | 203 |
| 115 | 3300049580 | Ga0501046_0028427 | Ga0501046_0028427_3087_3701 | 203 |
| 116 | 3300049581 | Ga0501047_0012050 | Ga0501047_0012050_4163_4777 | 203 |
| 117 | 3300049586 | Ga0501070_0034648 | Ga0501070_0034648_1287_1901 | 203 |
| 118 | 3300049823 | Ga0501044_0495168 | Ga0501044_0495168_186_803 | 203 |
| 119 | 3300050490 | nmdc:mga03n38_10458_c1 | nmdc:mga03n38_10458_c1_249_866 | 203 |
| 120 | 3300050511 | nmdc:mga08y16_479936_c1 | nmdc:mga08y16_479936_c1_135_752 | 203 |
| 121 | 3300053083 | Ga0495655_0091543 | Ga0495655_0091543_162_773 | 203 |
| 122 | 3300053085 | Ga0495619_0017291 | Ga0495619_0017291_2754_3371 | 203 |
| 123 | 3300061734 | Ga0530510_0747794 | Ga0530510_0747794_61_690 | 203 |
| 124 | iso_pu_bacteria | 2643221601 | 2644019006 | 203 |
| 125 | iso_pu_bacteria | 2643221631 | 2644180139 | 203 |
| 126 | iso_pu_bacteria | 2643221697 | 2644538147 | 203 |
| 127 | iso_pu_bacteria | 2995463766 | 2995467534 | 203 |
| 128 | 3300005548 | Ga0070665_100783054 | Ga0070665_1007830542 | 204 |
| 129 | 3300005937 | Ga0081455_10000653 | Ga0081455_1000065338 | 204 |
| 130 | 3300005937 | Ga0081455_10040344 | Ga0081455_100403442 | 204 |
| 131 | 3300006051 | Ga0075364_10044940 | Ga0075364_100449402 | 204 |
| 132 | 3300006844 | Ga0075428_100374177 | Ga0075428_1003741772 | 204 |
| 133 | 3300006846 | Ga0075430_100164179 | Ga0075430_1001641792 | 204 |
| 134 | 3300006847 | Ga0075431_100072677 | Ga0075431_1000726772 | 204 |
| 135 | 3300009147 | Ga0114129_10430248 | Ga0114129_104302482 | 204 |
| 136 | 3300009147 | Ga0114129_12074325 | Ga0114129_120743251 | 204 |
| 137 | 3300014968 | Ga0157379_11065282 | Ga0157379_110652821 | 204 |
| 138 | 3300025972 | Ga0207668_10490810 | Ga0207668_104908101 | 204 |
| 139 | 3300031727 | Ga0316576_10014866 | Ga0316576_100148663 | 204 |
| 140 | 3300031727 | Ga0316576_10088499 | Ga0316576_100884993 | 204 |
| 141 | 3300031728 | Ga0316578_10076503 | Ga0316578_100765032 | 204 |
| 142 | 3300031733 | Ga0316577_10088639 | Ga0316577_100886392 | 204 |
| 143 | 3300031995 | Ga0307409_100507452 | Ga0307409_1005074522 | 204 |
| 144 | 3300032137 | Ga0316585_10042380 | Ga0316585_100423802 | 204 |
| 145 | 3300032139 | Ga0316580_10015536 | Ga0316580_100155363 | 204 |
| 146 | 3300036647 | Ga0316582_0003575 | Ga0316582_0003575_6168_6791 | 204 |
| 147 | 3300036647 | Ga0316582_0140481 | Ga0316582_0140481_824_1444 | 204 |
| 148 | 3300036712 | Ga0316584_0003428 | Ga0316584_0003428_3206_3829 | 204 |
| 149 | 3300042005 | Ga0439448_0006929 | Ga0439448_0006929_816_1442 | 204 |
| 150 | 3300042008 | Ga0439450_003860 | Ga0439450_003860_1187_1813 | 204 |
| 151 | 3300042016 | Ga0439463_013607 | Ga0439463_013607_233_859 | 204 |
| 152 | 3300042461 | Ga0439460_0001148 | Ga0439460_0001148_4471_5097 | 204 |
| 153 | 3300046511 | Ga0495608_0229384 | Ga0495608_0229384_40_657 | 204 |
| 154 | 3300046517 | Ga0495630_0456785 | Ga0495630_0456785_62_679 | 204 |
| 155 | 3300046675 | Ga0495657_0121184 | Ga0495657_0121184_85_702 | 204 |
| 156 | 3300048911 | Ga0496108_0279694 | Ga0496108_0279694_28_666 | 204 |
| 157 | 3300049569 | Ga0501032_0041431 | Ga0501032_0041431_859_1482 | 204 |
| 158 | 3300049570 | Ga0501033_0005923 | Ga0501033_0005923_3907_4530 | 204 |
| 159 | 3300049571 | Ga0501034_0013733 | Ga0501034_0013733_7018_7635 | 204 |
| 160 | 3300049572 | Ga0501036_0002033 | Ga0501036_0002033_5618_6235 | 204 |
| 161 | 3300049572 | Ga0501036_0002935 | Ga0501036_0002935_12613_13236 | 204 |
| 162 | 3300049573 | Ga0501037_0010742 | Ga0501037_0010742_4208_4831 | 204 |
| 163 | 3300049573 | Ga0501037_0116896 | Ga0501037_0116896_695_1312 | 204 |
| 164 | 3300049574 | Ga0501038_0026370 | Ga0501038_0026370_1840_2457 | 204 |
| 165 | 3300049574 | Ga0501038_0092811 | Ga0501038_0092811_824_1447 | 204 |
| 166 | 3300049575 | Ga0501039_0005557 | Ga0501039_0005557_1194_1817 | 204 |
| 167 | 3300049575 | Ga0501039_0107463 | Ga0501039_0107463_503_1120 | 204 |
| 168 | 3300049576 | Ga0501040_0000672 | Ga0501040_0000672_9795_10418 | 204 |
| 169 | 3300049578 | Ga0501042_0005452 | Ga0501042_0005452_94_717 | 204 |
| 170 | 3300049578 | Ga0501042_0064403 | Ga0501042_0064403_1162_1779 | 204 |
| 171 | 3300049579 | Ga0501043_0033173 | Ga0501043_0033173_989_1612 | 204 |
| 172 | 3300049579 | Ga0501043_0048207 | Ga0501043_0048207_1024_1641 | 204 |
| 173 | 3300049580 | Ga0501046_0083454 | Ga0501046_0083454_762_1385 | 204 |
| 174 | 3300049581 | Ga0501047_0026276 | Ga0501047_0026276_885_1502 | 204 |
| 175 | 3300049581 | Ga0501047_0769611 | Ga0501047_0769611_86_709 | 204 |
| 176 | 3300049582 | Ga0501048_0010763 | Ga0501048_0010763_1869_2492 | 204 |
| 177 | 3300049582 | Ga0501048_0021577 | Ga0501048_0021577_3220_3837 | 204 |
| 178 | 3300049584 | Ga0501068_0036899 | Ga0501068_0036899_1048_1671 | 204 |
| 179 | 3300049587 | Ga0501071_0002144 | Ga0501071_0002144_1289_1912 | 204 |
| 180 | 3300049588 | Ga0501072_0003311 | Ga0501072_0003311_9734_10357 | 204 |
| 181 | 3300049589 | Ga0501073_0030490 | Ga0501073_0030490_3018_3635 | 204 |
| 182 | 3300049590 | Ga0501074_0007271 | Ga0501074_0007271_6500_7117 | 204 |
| 183 | 3300049590 | Ga0501074_0026730 | Ga0501074_0026730_3532_4155 | 204 |
| 184 | 3300049591 | Ga0501075_0000279 | Ga0501075_0000279_6846_7469 | 204 |
| 185 | 3300049592 | Ga0501076_0010194 | Ga0501076_0010194_4626_5249 | 204 |
| 186 | 3300049592 | Ga0501076_0301600 | Ga0501076_0301600_27_644 | 204 |
| 187 | 3300049593 | Ga0501077_0000632 | Ga0501077_0000632_5797_6420 | 204 |
| 188 | 3300049741 | Ga0501079_0002731 | Ga0501079_0002731_2777_3400 | 204 |
| 189 | 3300049742 | Ga0501080_0017318 | Ga0501080_0017318_4997_5617 | 204 |
| 190 | 3300049742 | Ga0501080_1056524 | Ga0501080_1056524_16_639 | 204 |
| 191 | 3300049743 | Ga0501081_0006922 | Ga0501081_0006922_2011_2634 | 204 |
| 192 | 3300049744 | Ga0501083_0000140 | Ga0501083_0000140_35991_36611 | 204 |
| 193 | 3300049744 | Ga0501083_0036475 | Ga0501083_0036475_1426_2049 | 204 |
| 194 | 3300049822 | Ga0501035_0070799 | Ga0501035_0070799_2001_2624 | 204 |
| 195 | 3300049823 | Ga0501044_0038860 | Ga0501044_0038860_3968_4585 | 204 |
| 196 | 3300049824 | Ga0501045_0011714 | Ga0501045_0011714_5054_5677 | 204 |
| 197 | 3300050494 | nmdc:mga06z11_62882_c1 | nmdc:mga06z11_62882_c1_876_1499 | 204 |
| 198 | 3300050507 | nmdc:mga05p37_824159_c1 | nmdc:mga05p37_824159_c1_318_944 | 204 |
| 199 | 3300050509 | nmdc:mga0qj67_160807_c1 | nmdc:mga0qj67_160807_c1_27_653 | 204 |
| 200 | 3300050510 | nmdc:mga06r32_308979_c1 | nmdc:mga06r32_308979_c1_768_1394 | 204 |
| 201 | 3300053077 | Ga0495601_0094095 | Ga0495601_0094095_420_1037 | 204 |
| 202 | 3300053092 | Ga0500583_0044371 | Ga0500583_0044371_240_866 | 204 |
| 203 | 3300054114 | Ga0501084_0000502 | Ga0501084_0000502_24431_25054 | 204 |
| 204 | 3300054114 | Ga0501084_0003106 | Ga0501084_0003106_6822_7442 | 204 |
| 205 | 3300060353 | Ga0501082_0055744 | Ga0501082_0055744_1102_1725 | 204 |
| 206 | 3300061734 | Ga0530510_0000347 | Ga0530510_0000347_22708_23331 | 204 |
| 207 | 3300005563 | Ga0068855_100289286 | Ga0068855_1002892862 | 205 |
| 208 | 3300013105 | Ga0157369_10704736 | Ga0157369_107047362 | 205 |
| 209 | 3300025912 | Ga0207707_10660624 | Ga0207707_106606242 | 205 |
| 210 | 3300025949 | Ga0207667_10143257 | Ga0207667_101432573 | 205 |
| 211 | 3300038443 | Ga0395901_0056357 | Ga0395901_0056357_3212_3832 | 205 |
| 212 | 3300041452 | Ga0451793_0452152 | Ga0451793_0452152_1625_2251 | 205 |
| 213 | 3300041486 | Ga0451807_1625867 | Ga0451807_1625867_79_705 | 205 |
| 214 | 3300041491 | Ga0451833_0784683 | Ga0451833_0784683_1105_1731 | 205 |
| 215 | 3300041494 | Ga0451837_0189149 | Ga0451837_0189149_3873_4499 | 205 |
| 216 | 3300042004 | Ga0439445_0015452 | Ga0439445_0015452_1010_1654 | 205 |
| 217 | 3300042006 | Ga0439432_098440 | Ga0439432_098440_125_769 | 205 |
| 218 | 3300044683 | Ga0466965_0043278 | Ga0466965_0043278_750_1370 | 205 |
| 219 | 3300044684 | Ga0466966_0058497 | Ga0466966_0058497_263_883 | 205 |
| 220 | 3300044765 | Ga0466970_0069565 | Ga0466970_0069565_831_1451 | 205 |
| 221 | 3300044765 | Ga0466970_0076767 | Ga0466970_0076767_785_1405 | 205 |
| 222 | 3300044901 | Ga0466960_0201067 | Ga0466960_0201067_120_749 | 205 |
| 223 | 3300046679 | Ga0495623_0200778 | Ga0495623_0200778_208_876 | 205 |
| 224 | 3300047317 | Ga0495604_0019020 | Ga0495604_0019020_961_1629 | 205 |
| 225 | 3300047444 | Ga0495675_0057777 | Ga0495675_0057777_1326_1994 | 205 |
| 226 | 3300049568 | Ga0501031_0045272 | Ga0501031_0045272_1963_2583 | 205 |
| 227 | 3300049569 | Ga0501032_0004992 | Ga0501032_0004992_2290_2910 | 205 |
| 228 | 3300049570 | Ga0501033_0011495 | Ga0501033_0011495_1583_2203 | 205 |
| 229 | 3300049570 | Ga0501033_0384792 | Ga0501033_0384792_150_770 | 205 |
| 230 | 3300049571 | Ga0501034_0044210 | Ga0501034_0044210_1796_2416 | 205 |
| 231 | 3300049572 | Ga0501036_0001691 | Ga0501036_0001691_14034_14654 | 205 |
| 232 | 3300049573 | Ga0501037_0004582 | Ga0501037_0004582_7011_7631 | 205 |
| 233 | 3300049574 | Ga0501038_0006532 | Ga0501038_0006532_1483_2103 | 205 |
| 234 | 3300049574 | Ga0501038_0063465 | Ga0501038_0063465_158_793 | 205 |
| 235 | 3300049575 | Ga0501039_0007936 | Ga0501039_0007936_1598_2218 | 205 |
| 236 | 3300049578 | Ga0501042_0044199 | Ga0501042_0044199_1022_1642 | 205 |
| 237 | 3300049580 | Ga0501046_0008028 | Ga0501046_0008028_2231_2851 | 205 |
| 238 | 3300049580 | Ga0501046_0078726 | Ga0501046_0078726_1413_2033 | 205 |
| 239 | 3300049581 | Ga0501047_0052494 | Ga0501047_0052494_2170_2790 | 205 |
| 240 | 3300049586 | Ga0501070_0006215 | Ga0501070_0006215_5878_6498 | 205 |
| 241 | 3300049586 | Ga0501070_0054447 | Ga0501070_0054447_1899_2543 | 205 |
| 242 | 3300049589 | Ga0501073_0061684 | Ga0501073_0061684_1474_2109 | 205 |
| 243 | 3300049590 | Ga0501074_0486856 | Ga0501074_0486856_163_783 | 205 |
| 244 | 3300049822 | Ga0501035_0383065 | Ga0501035_0383065_517_1137 | 205 |
| 245 | 3300049823 | Ga0501044_0392921 | Ga0501044_0392921_517_1137 | 205 |
| 246 | 3300053078 | Ga0495612_0112774 | Ga0495612_0112774_479_1114 | 205 |
| 247 | 3300054114 | Ga0501084_0215016 | Ga0501084_0215016_523_1143 | 205 |
| 248 | 3300060353 | Ga0501082_0519489 | Ga0501082_0519489_208_828 | 205 |
| 249 | iso_pu_bacteria | 2891968417 | 2891970931 | 205 |
| 250 | 3300005981 | Ga0081538_10045441 | Ga0081538_100454413 | 206 |
| 251 | 3300006038 | Ga0075365_10266368 | Ga0075365_102663682 | 206 |
| 252 | 3300006042 | Ga0075368_10091502 | Ga0075368_100915022 | 206 |
| 253 | 3300006051 | Ga0075364_10003049 | Ga0075364_100030493 | 206 |
| 254 | 3300031251 | Ga0265327_10001801 | Ga0265327_1000180123 | 206 |
| 255 | 3300031731 | Ga0307405_10157897 | Ga0307405_101578972 | 206 |
| 256 | 3300031824 | Ga0307413_10075950 | Ga0307413_100759503 | 206 |
| 257 | 3300032005 | Ga0307411_10223069 | Ga0307411_102230692 | 206 |
| 258 | 3300039062 | Ga0400483_099246 | Ga0400483_099246_221_856 | 206 |
| 259 | 3300044658 | Ga0466972_0139428 | Ga0466972_0139428_485_1108 | 206 |
| 260 | 3300044765 | Ga0466970_0126414 | Ga0466970_0126414_176_799 | 206 |
| 261 | 3300049582 | Ga0501048_0297861 | Ga0501048_0297861_356_1003 | 206 |
| 262 | 3300049585 | Ga0501069_0000070 | Ga0501069_0000070_2374_3012 | 206 |
| 263 | 3300049586 | Ga0501070_0000011 | Ga0501070_0000011_151783_152421 | 206 |
| 264 | 3300049587 | Ga0501071_0001879 | Ga0501071_0001879_10969_11607 | 206 |
| 265 | 3300049587 | Ga0501071_0039789 | Ga0501071_0039789_609_1256 | 206 |
| 266 | 3300049590 | Ga0501074_0057010 | Ga0501074_0057010_910_1548 | 206 |
| 267 | 3300049592 | Ga0501076_0431247 | Ga0501076_0431247_83_724 | 206 |
| 268 | 3300049593 | Ga0501077_0015631 | Ga0501077_0015631_769_1416 | 206 |
| 269 | 3300049742 | Ga0501080_0001015 | Ga0501080_0001015_9746_10384 | 206 |
| 270 | 3300049824 | Ga0501045_0104635 | Ga0501045_0104635_280_927 | 206 |
| 271 | 3300050491 | nmdc:mga00v17_3074_c1 | nmdc:mga00v17_3074_c1_5882_6514 | 206 |
| 272 | 3300050492 | nmdc:mga0yw44_239639_c1 | nmdc:mga0yw44_239639_c1_100_732 | 206 |
| 273 | 3300050495 | nmdc:mga04h51_116063_c1 | nmdc:mga04h51_116063_c1_230_862 | 206 |
| 274 | 3300050495 | nmdc:mga04h51_94602_c1 | nmdc:mga04h51_94602_c1_256_888 | 206 |
| 275 | 3300061734 | Ga0530510_0008061 | Ga0530510_0008061_2478_3125 | 206 |
| 276 | 3300005539 | Ga0068853_100795626 | Ga0068853_1007956262 | 207 |
| 277 | 3300042133 | Ga0450896_001669 | Ga0450896_001669_2053_2727 | 207 |
| 278 | 3300042134 | Ga0450898_001181 | Ga0450898_001181_178_852 | 207 |
| 279 | 3300042135 | Ga0450899_001338 | Ga0450899_001338_1538_2212 | 207 |
| 280 | 3300042145 | Ga0450906_001520 | Ga0450906_001520_1695_2369 | 207 |
| 281 | 3300046535 | Ga0495586_0127114 | Ga0495586_0127114_618_1253 | 207 |
| 282 | 3300049588 | Ga0501072_0070277 | Ga0501072_0070277_63_695 | 207 |
| 283 | 3300049592 | Ga0501076_0167165 | Ga0501076_0167165_720_1349 | 207 |
| 284 | 3300049741 | Ga0501079_0600061 | Ga0501079_0600061_18_650 | 207 |
| 285 | 3300049743 | Ga0501081_0462293 | Ga0501081_0462293_195_827 | 207 |
| 286 | 3300049824 | Ga0501045_0634028 | Ga0501045_0634028_111_743 | 207 |
| 287 | 3300061734 | Ga0530510_0009732 | Ga0530510_0009732_759_1391 | 207 |
| 288 | 3300005367 | Ga0070667_100560210 | Ga0070667_1005602102 | 208 |
| 289 | 3300006353 | Ga0075370_10046364 | Ga0075370_100463641 | 208 |
| 290 | 3300021388 | Ga0213875_10082824 | Ga0213875_100828242 | 208 |
| 291 | 3300025986 | Ga0207658_10117652 | Ga0207658_101176522 | 208 |
| 292 | 3300026118 | Ga0207675_100506869 | Ga0207675_1005068692 | 208 |
| 293 | 3300037853 | Ga0436364_1214371 | Ga0436364_1214371_555_1196 | 208 |
| 294 | 3300041413 | Ga0439465_0019987 | Ga0439465_0019987_1242_1895 | 208 |
| 295 | 3300041413 | Ga0439465_0063799 | Ga0439465_0063799_122_763 | 208 |
| 296 | 3300042004 | Ga0439445_0052336 | Ga0439445_0052336_224_877 | 208 |
| 297 | 3300042156 | Ga0439446_0130744 | Ga0439446_0130744_144_797 | 208 |
| 298 | 3300044901 | Ga0466960_0204768 | Ga0466960_0204768_153_779 | 208 |
| 299 | 3300050496 | nmdc:mga07m45_20544_c1 | nmdc:mga07m45_20544_c1_372_1025 | 208 |
| 300 | iso_pu_bacteria | 2818991472 | 2819743093 | 208 |
| 301 | 3300039438 | Ga0436360_1190046 | Ga0436360_1190046_120_764 | 209 |
| 302 | 3300046809 | Ga0495600_0577108 | Ga0495600_0577108_20_661 | 209 |
| 303 | 3300047673 | Ga0495593_0305302 | Ga0495593_0305302_111_752 | 209 |
| 304 | 3300053077 | Ga0495601_0187981 | Ga0495601_0187981_234_875 | 209 |
| 305 | iso_pu_bacteria | 2643221617 | 2644098584 | 209 |
| 306 | iso_pu_bacteria | 2643221620 | 2644114557 | 209 |
| 307 | iso_pu_bacteria | 2811994874 | 2812332555 | 209 |
| 308 | 3300025945 | Ga0207679_10064055 | Ga0207679_100640552 | 210 |
| 309 | iso_pu_bacteria | 2643221576 | 2643888809 | 210 |
| 310 | iso_pu_bacteria | 2643221590 | 2643957864 | 210 |
| 311 | iso_pu_bacteria | 2643221615 | 2644089310 | 210 |
| 312 | iso_pu_bacteria | 2643221641 | 2644229356 | 210 |
| 313 | iso_pu_bacteria | 2643221657 | 2644319155 | 210 |
| 314 | iso_pu_bacteria | 2643221961 | 2645721833 | 210 |
| 315 | iso_pu_bacteria | 2643221962 | 2645724222 | 210 |
| 316 | iso_pu_bacteria | 2738541305 | 2738869853 | 210 |
| 317 | 3300006048 | Ga0075363_100035613 | Ga0075363_1000356133 | 211 |
| 318 | 3300006048 | Ga0075363_100163817 | Ga0075363_1001638172 | 211 |
| 319 | 3300006178 | Ga0075367_10218629 | Ga0075367_102186292 | 211 |
| 320 | 3300006353 | Ga0075370_10021899 | Ga0075370_100218992 | 211 |
| 321 | 3300037471 | Ga0395905_0478543 | Ga0395905_0478543_89_739 | 211 |
| 322 | 3300049578 | Ga0501042_0361258 | Ga0501042_0361258_214_849 | 211 |
| 323 | 3300049581 | Ga0501047_0323976 | Ga0501047_0323976_289_945 | 211 |
| 324 | 3300049593 | Ga0501077_0036081 | Ga0501077_0036081_1285_1941 | 211 |
| 325 | 3300049823 | Ga0501044_0261735 | Ga0501044_0261735_113_769 | 211 |
| 326 | 3300049824 | Ga0501045_0358015 | Ga0501045_0358015_436_1071 | 211 |
| 327 | 3300050490 | nmdc:mga03n38_15323_c1 | nmdc:mga03n38_15323_c1_257_901 | 211 |
| 328 | 3300050491 | nmdc:mga00v17_73061_c1 | nmdc:mga00v17_73061_c1_1340_1984 | 211 |
| 329 | 3300050492 | nmdc:mga0yw44_165465_c1 | nmdc:mga0yw44_165465_c1_482_1126 | 211 |
| 330 | 3300050492 | nmdc:mga0yw44_77431_c1 | nmdc:mga0yw44_77431_c1_1297_1941 | 211 |
| 331 | 3300053088 | Ga0500644_0000499 | Ga0500644_0000499_14139_14792 | 211 |
| 332 | 3300053133 | Ga0500655_025574 | Ga0500655_025574_142_795 | 211 |
| 333 | 3300049533 | Ga0501317_008506 | Ga0501317_008506_332_1057 | 212 |
| 334 | 3300037418 | Ga0395900_0073930 | Ga0395900_0073930_2011_2673 | 213 |
| 335 | 3300048912 | Ga0496109_0084261 | Ga0496109_0084261_1351_2007 | 213 |
| 336 | 3300048914 | Ga0496111_0314193 | Ga0496111_0314193_98_739 | 213 |
| 337 | 3300048915 | Ga0496112_0752438 | Ga0496112_0752438_31_678 | 213 |
| 338 | iso_pu_bacteria | 2984576629 | 2984580259 | 213 |
| 339 | iso_pu_bacteria | 2990256926 | 2990259109 | 213 |
| 340 | 3300001991 | JGI24743J22301_10027988 | JGI24743J22301_100279882 | 214 |
| 341 | 3300002075 | JGI24738J21930_10006398 | JGI24738J21930_100063983 | 214 |
| 342 | 3300002076 | JGI24749J21850_1008884 | JGI24749J21850_10088842 | 214 |
| 343 | 3300002077 | JGI24744J21845_10013945 | JGI24744J21845_100139452 | 214 |
| 344 | 3300005327 | Ga0070658_10234953 | Ga0070658_102349532 | 214 |
| 345 | 3300005329 | Ga0070683_100054908 | Ga0070683_1000549085 | 214 |
| 346 | 3300005329 | Ga0070683_100243511 | Ga0070683_1002435112 | 214 |
| 347 | 3300005329 | Ga0070683_100309553 | Ga0070683_1003095532 | 214 |
| 348 | 3300005329 | Ga0070683_100329228 | Ga0070683_1003292282 | 214 |
| 349 | 3300005330 | Ga0070690_100126953 | Ga0070690_1001269532 | 214 |
| 350 | 3300005331 | Ga0070670_100723733 | Ga0070670_1007237332 | 214 |
| 351 | 3300005334 | Ga0068869_100192843 | Ga0068869_1001928432 | 214 |
| 352 | 3300005334 | Ga0068869_100344200 | Ga0068869_1003442001 | 214 |
| 353 | 3300005336 | Ga0070680_100695111 | Ga0070680_1006951112 | 214 |
| 354 | 3300005337 | Ga0070682_100006463 | Ga0070682_1000064632 | 214 |
| 355 | 3300005339 | Ga0070660_100054582 | Ga0070660_1000545824 | 214 |
| 356 | 3300005341 | Ga0070691_10128702 | Ga0070691_101287022 | 214 |
| 357 | 3300005343 | Ga0070687_100030755 | Ga0070687_1000307552 | 214 |
| 358 | 3300005343 | Ga0070687_100078245 | Ga0070687_1000782452 | 214 |
| 359 | 3300005345 | Ga0070692_10007019 | Ga0070692_100070194 | 214 |
| 360 | 3300005354 | Ga0070675_100213314 | Ga0070675_1002133142 | 214 |
| 361 | 3300005356 | Ga0070674_100721707 | Ga0070674_1007217071 | 214 |
| 362 | 3300005365 | Ga0070688_100080592 | Ga0070688_1000805922 | 214 |
| 363 | 3300005366 | Ga0070659_100018976 | Ga0070659_1000189763 | 214 |
| 364 | 3300005366 | Ga0070659_100138654 | Ga0070659_1001386542 | 214 |
| 365 | 3300005366 | Ga0070659_100268611 | Ga0070659_1002686112 | 214 |
| 366 | 3300005367 | Ga0070667_100050973 | Ga0070667_1000509732 | 214 |
| 367 | 3300005367 | Ga0070667_100518333 | Ga0070667_1005183332 | 214 |
| 368 | 3300005438 | Ga0070701_10010297 | Ga0070701_100102975 | 214 |
| 369 | 3300005441 | Ga0070700_100016157 | Ga0070700_1000161572 | 214 |
| 370 | 3300005441 | Ga0070700_100439711 | Ga0070700_1004397111 | 214 |
| 371 | 3300005455 | Ga0070663_100192987 | Ga0070663_1001929872 | 214 |
| 372 | 3300005456 | Ga0070678_100502337 | Ga0070678_1005023372 | 214 |
| 373 | 3300005458 | Ga0070681_10543037 | Ga0070681_105430372 | 214 |
| 374 | 3300005459 | Ga0068867_100012515 | Ga0068867_1000125154 | 214 |
| 375 | 3300005466 | Ga0070685_10065114 | Ga0070685_100651142 | 214 |
| 376 | 3300005471 | Ga0070698_100005155 | Ga0070698_1000051555 | 214 |
| 377 | 3300005535 | Ga0070684_100003260 | Ga0070684_1000032603 | 214 |
| 378 | 3300005535 | Ga0070684_100100174 | Ga0070684_1001001742 | 214 |
| 379 | 3300005535 | Ga0070684_100183675 | Ga0070684_1001836752 | 214 |
| 380 | 3300005535 | Ga0070684_100948955 | Ga0070684_1009489552 | 214 |
| 381 | 3300005539 | Ga0068853_100232183 | Ga0068853_1002321832 | 214 |
| 382 | 3300005543 | Ga0070672_100043380 | Ga0070672_1000433802 | 214 |
| 383 | 3300005544 | Ga0070686_100024818 | Ga0070686_1000248182 | 214 |
| 384 | 3300005548 | Ga0070665_100002233 | Ga0070665_10000223312 | 214 |
| 385 | 3300005548 | Ga0070665_100135805 | Ga0070665_1001358052 | 214 |
| 386 | 3300005548 | Ga0070665_100642029 | Ga0070665_1006420292 | 214 |
| 387 | 3300005563 | Ga0068855_100137711 | Ga0068855_1001377112 | 214 |
| 388 | 3300005577 | Ga0068857_100035657 | Ga0068857_1000356572 | 214 |
| 389 | 3300005577 | Ga0068857_100395131 | Ga0068857_1003951312 | 214 |
| 390 | 3300005577 | Ga0068857_100855109 | Ga0068857_1008551092 | 214 |
| 391 | 3300005614 | Ga0068856_100013871 | Ga0068856_1000138715 | 214 |
| 392 | 3300005615 | Ga0070702_100003103 | Ga0070702_1000031035 | 214 |
| 393 | 3300005615 | Ga0070702_100200321 | Ga0070702_1002003212 | 214 |
| 394 | 3300005616 | Ga0068852_100029857 | Ga0068852_1000298572 | 214 |
| 395 | 3300005616 | Ga0068852_100776866 | Ga0068852_1007768662 | 214 |
| 396 | 3300005618 | Ga0068864_100531625 | Ga0068864_1005316251 | 214 |
| 397 | 3300005719 | Ga0068861_100025002 | Ga0068861_1000250022 | 214 |
| 398 | 3300005719 | Ga0068861_100343025 | Ga0068861_1003430252 | 214 |
| 399 | 3300005840 | Ga0068870_10059388 | Ga0068870_100593882 | 214 |
| 400 | 3300005842 | Ga0068858_100231778 | Ga0068858_1002317782 | 214 |
| 401 | 3300005937 | Ga0081455_10000174 | Ga0081455_1000017427 | 214 |
| 402 | 3300006038 | Ga0075365_10003456 | Ga0075365_100034562 | 214 |
| 403 | 3300006038 | Ga0075365_10007349 | Ga0075365_100073493 | 214 |
| 404 | 3300006038 | Ga0075365_10039837 | Ga0075365_100398373 | 214 |
| 405 | 3300006038 | Ga0075365_10139299 | Ga0075365_101392992 | 214 |
| 406 | 3300006038 | Ga0075365_10289082 | Ga0075365_102890822 | 214 |
| 407 | 3300006038 | Ga0075365_10433261 | Ga0075365_104332612 | 214 |
| 408 | 3300006048 | Ga0075363_100064460 | Ga0075363_1000644602 | 214 |
| 409 | 3300006051 | Ga0075364_10119465 | Ga0075364_101194652 | 214 |
| 410 | 3300006051 | Ga0075364_10154173 | Ga0075364_101541732 | 214 |
| 411 | 3300006051 | Ga0075364_10272466 | Ga0075364_102724662 | 214 |
| 412 | 3300006051 | Ga0075364_10371409 | Ga0075364_103714092 | 214 |
| 413 | 3300006177 | Ga0075362_10071379 | Ga0075362_100713792 | 214 |
| 414 | 3300006178 | Ga0075367_10000369 | Ga0075367_100003696 | 214 |
| 415 | 3300006178 | Ga0075367_10008834 | Ga0075367_100088344 | 214 |
| 416 | 3300006178 | Ga0075367_10581789 | Ga0075367_105817891 | 214 |
| 417 | 3300006353 | Ga0075370_10017918 | Ga0075370_100179184 | 214 |
| 418 | 3300006353 | Ga0075370_10216092 | Ga0075370_102160921 | 214 |
| 419 | 3300006358 | Ga0068871_100436141 | Ga0068871_1004361412 | 214 |
| 420 | 3300006881 | Ga0068865_100062735 | Ga0068865_1000627353 | 214 |
| 421 | 3300006881 | Ga0068865_100096430 | Ga0068865_1000964302 | 214 |
| 422 | 3300009094 | Ga0111539_11122315 | Ga0111539_111223152 | 214 |
| 423 | 3300009098 | Ga0105245_10005813 | Ga0105245_1000581311 | 214 |
| 424 | 3300009098 | Ga0105245_10049450 | Ga0105245_100494502 | 214 |
| 425 | 3300009098 | Ga0105245_10118657 | Ga0105245_101186573 | 214 |
| 426 | 3300009148 | Ga0105243_10034754 | Ga0105243_100347545 | 214 |
| 427 | 3300009148 | Ga0105243_10363985 | Ga0105243_103639851 | 214 |
| 428 | 3300009176 | Ga0105242_10142209 | Ga0105242_101422092 | 214 |
| 429 | 3300009176 | Ga0105242_10333462 | Ga0105242_103334622 | 214 |
| 430 | 3300009177 | Ga0105248_10024173 | Ga0105248_100241735 | 214 |
| 431 | 3300009545 | Ga0105237_10024005 | Ga0105237_100240052 | 214 |
| 432 | 3300009553 | Ga0105249_10247605 | Ga0105249_102476052 | 214 |
| 433 | 3300009553 | Ga0105249_11103153 | Ga0105249_111031531 | 214 |
| 434 | 3300010375 | Ga0105239_10005059 | Ga0105239_100050599 | 214 |
| 435 | 3300010375 | Ga0105239_10057126 | Ga0105239_100571263 | 214 |
| 436 | 3300010375 | Ga0105239_10375404 | Ga0105239_103754041 | 214 |
| 437 | 3300010375 | Ga0105239_10570938 | Ga0105239_105709382 | 214 |
| 438 | 3300013102 | Ga0157371_10318746 | Ga0157371_103187461 | 214 |
| 439 | 3300013105 | Ga0157369_10244425 | Ga0157369_102444252 | 214 |
| 440 | 3300013105 | Ga0157369_10868025 | Ga0157369_108680252 | 214 |
| 441 | 3300013307 | Ga0157372_10336115 | Ga0157372_103361152 | 214 |
| 442 | 3300013307 | Ga0157372_10453037 | Ga0157372_104530372 | 214 |
| 443 | 3300013308 | Ga0157375_10007170 | Ga0157375_100071707 | 214 |
| 444 | 3300013308 | Ga0157375_10170764 | Ga0157375_101707642 | 214 |
| 445 | 3300013308 | Ga0157375_11738631 | Ga0157375_117386311 | 214 |
| 446 | 3300014325 | Ga0163163_10036031 | Ga0163163_100360313 | 214 |
| 447 | 3300014325 | Ga0163163_10179740 | Ga0163163_101797402 | 214 |
| 448 | 3300014325 | Ga0163163_10802272 | Ga0163163_108022722 | 214 |
| 449 | 3300014326 | Ga0157380_10042357 | Ga0157380_100423572 | 214 |
| 450 | 3300014326 | Ga0157380_10192436 | Ga0157380_101924362 | 214 |
| 451 | 3300014326 | Ga0157380_10876349 | Ga0157380_108763491 | 214 |
| 452 | 3300014745 | Ga0157377_10030982 | Ga0157377_100309822 | 214 |
| 453 | 3300014969 | Ga0157376_10115402 | Ga0157376_101154021 | 214 |
| 454 | 3300017792 | Ga0163161_10439361 | Ga0163161_104393612 | 214 |
| 455 | 3300017792 | Ga0163161_10515782 | Ga0163161_105157822 | 214 |
| 456 | 3300020082 | Ga0206353_10819393 | Ga0206353_108193933 | 214 |
| 457 | 3300020082 | Ga0206353_10844963 | Ga0206353_108449632 | 214 |
| 458 | 3300025901 | Ga0207688_10006221 | Ga0207688_100062214 | 214 |
| 459 | 3300025901 | Ga0207688_10365722 | Ga0207688_103657222 | 214 |
| 460 | 3300025904 | Ga0207647_10055544 | Ga0207647_100555442 | 214 |
| 461 | 3300025904 | Ga0207647_10071719 | Ga0207647_100717192 | 214 |
| 462 | 3300025908 | Ga0207643_10005923 | Ga0207643_100059234 | 214 |
| 463 | 3300025908 | Ga0207643_10241858 | Ga0207643_102418582 | 214 |
| 464 | 3300025909 | Ga0207705_10024073 | Ga0207705_100240732 | 214 |
| 465 | 3300025917 | Ga0207660_10307178 | Ga0207660_103071782 | 214 |
| 466 | 3300025918 | Ga0207662_10044104 | Ga0207662_100441042 | 214 |
| 467 | 3300025919 | Ga0207657_10061364 | Ga0207657_100613642 | 214 |
| 468 | 3300025921 | Ga0207652_10114067 | Ga0207652_101140673 | 214 |
| 469 | 3300025921 | Ga0207652_10160546 | Ga0207652_101605462 | 214 |
| 470 | 3300025927 | Ga0207687_10032584 | Ga0207687_100325843 | 214 |
| 471 | 3300025927 | Ga0207687_10050619 | Ga0207687_100506192 | 214 |
| 472 | 3300025932 | Ga0207690_10010917 | Ga0207690_100109173 | 214 |
| 473 | 3300025932 | Ga0207690_10182349 | Ga0207690_101823492 | 214 |
| 474 | 3300025934 | Ga0207686_10242325 | Ga0207686_102423252 | 214 |
| 475 | 3300025934 | Ga0207686_10366478 | Ga0207686_103664782 | 214 |
| 476 | 3300025935 | Ga0207709_10011145 | Ga0207709_100111452 | 214 |
| 477 | 3300025936 | Ga0207670_10133163 | Ga0207670_101331632 | 214 |
| 478 | 3300025937 | Ga0207669_10481336 | Ga0207669_104813362 | 214 |
| 479 | 3300025938 | Ga0207704_10103639 | Ga0207704_101036392 | 214 |
| 480 | 3300025938 | Ga0207704_10433438 | Ga0207704_104334381 | 214 |
| 481 | 3300025940 | Ga0207691_10019859 | Ga0207691_100198594 | 214 |
| 482 | 3300025941 | Ga0207711_10316935 | Ga0207711_103169352 | 214 |
| 483 | 3300025941 | Ga0207711_10513266 | Ga0207711_105132662 | 214 |
| 484 | 3300025942 | Ga0207689_10052657 | Ga0207689_100526574 | 214 |
| 485 | 3300025944 | Ga0207661_10078143 | Ga0207661_100781433 | 214 |
| 486 | 3300025944 | Ga0207661_10416773 | Ga0207661_104167731 | 214 |
| 487 | 3300025944 | Ga0207661_10540064 | Ga0207661_105400642 | 214 |
| 488 | 3300025945 | Ga0207679_10447519 | Ga0207679_104475192 | 214 |
| 489 | 3300025949 | Ga0207667_10257811 | Ga0207667_102578112 | 214 |
| 490 | 3300025986 | Ga0207658_10274665 | Ga0207658_102746652 | 214 |
| 491 | 3300026023 | Ga0207677_10525243 | Ga0207677_105252432 | 214 |
| 492 | 3300026041 | Ga0207639_10276562 | Ga0207639_102765622 | 214 |
| 493 | 3300026067 | Ga0207678_10258548 | Ga0207678_102585482 | 214 |
| 494 | 3300026075 | Ga0207708_10002108 | Ga0207708_100021085 | 214 |
| 495 | 3300026075 | Ga0207708_10183758 | Ga0207708_101837582 | 214 |
| 496 | 3300026089 | Ga0207648_10028837 | Ga0207648_100288375 | 214 |
| 497 | 3300026095 | Ga0207676_10091364 | Ga0207676_100913642 | 214 |
| 498 | 3300026116 | Ga0207674_10006182 | Ga0207674_100061825 | 214 |
| 499 | 3300026116 | Ga0207674_10741718 | Ga0207674_107417181 | 214 |
| 500 | 3300026118 | Ga0207675_100008177 | Ga0207675_1000081779 | 214 |
| 501 | 3300026118 | Ga0207675_100120472 | Ga0207675_1001204722 | 214 |
| 502 | 3300026121 | Ga0207683_10091161 | Ga0207683_100911612 | 214 |
| 503 | 3300026142 | Ga0207698_10154448 | Ga0207698_101544482 | 214 |
| 504 | 3300026142 | Ga0207698_10387871 | Ga0207698_103878712 | 214 |
| 505 | 3300027866 | Ga0209813_10007573 | Ga0209813_100075732 | 214 |
| 506 | 3300028379 | Ga0268266_10032400 | Ga0268266_100324003 | 214 |
| 507 | 3300028379 | Ga0268266_10362948 | Ga0268266_103629481 | 214 |
| 508 | 3300028381 | Ga0268264_10000896 | Ga0268264_1000089618 | 214 |
| 509 | 3300031824 | Ga0307413_10072525 | Ga0307413_100725252 | 214 |
| 510 | 3300031824 | Ga0307413_10299002 | Ga0307413_102990022 | 214 |
| 511 | 3300031901 | Ga0307406_10428522 | Ga0307406_104285222 | 214 |
| 512 | 3300031903 | Ga0307407_10051531 | Ga0307407_100515312 | 214 |
| 513 | 3300031903 | Ga0307407_10450623 | Ga0307407_104506231 | 214 |
| 514 | 3300031995 | Ga0307409_100153320 | Ga0307409_1001533202 | 214 |
| 515 | 3300032002 | Ga0307416_100178344 | Ga0307416_1001783442 | 214 |
| 516 | 3300032002 | Ga0307416_101058257 | Ga0307416_1010582571 | 214 |
| 517 | 3300037312 | Ga0395899_0188287 | Ga0395899_0188287_638_1282 | 214 |
| 518 | 3300037466 | Ga0395898_0019357 | Ga0395898_0019357_1187_1831 | 214 |
| 519 | 3300038443 | Ga0395901_0077142 | Ga0395901_0077142_1205_1870 | 214 |
| 520 | 3300038443 | Ga0395901_0213896 | Ga0395901_0213896_1147_1791 | 214 |
| 521 | 3300041413 | Ga0439465_0100993 | Ga0439465_0100993_28_699 | 214 |
| 522 | 3300041452 | Ga0451793_1437933 | Ga0451793_1437933_145_789 | 214 |
| 523 | 3300041453 | Ga0451797_1225711 | Ga0451797_1225711_698_1345 | 214 |
| 524 | 3300041511 | Ga0451855_0291083 | Ga0451855_0291083_612_1256 | 214 |
| 525 | 3300041997 | Ga0439431_0017535 | Ga0439431_0017535_718_1389 | 214 |
| 526 | 3300042156 | Ga0439446_0019251 | Ga0439446_0019251_558_1229 | 214 |
| 527 | 3300042435 | Ga0439434_0012377 | Ga0439434_0012377_1355_2026 | 214 |
| 528 | 3300044656 | Ga0466969_0054372 | Ga0466969_0054372_707_1351 | 214 |
| 529 | 3300044658 | Ga0466972_0097871 | Ga0466972_0097871_718_1377 | 214 |
| 530 | 3300044683 | Ga0466965_0012980 | Ga0466965_0012980_1720_2379 | 214 |
| 531 | 3300044683 | Ga0466965_0015494 | Ga0466965_0015494_2206_2883 | 214 |
| 532 | 3300044683 | Ga0466965_0190861 | Ga0466965_0190861_197_841 | 214 |
| 533 | 3300044683 | Ga0466965_0345241 | Ga0466965_0345241_87_788 | 214 |
| 534 | 3300044684 | Ga0466966_0099234 | Ga0466966_0099234_801_1445 | 214 |
| 535 | 3300044693 | Ga0466961_0005909 | Ga0466961_0005909_4269_4913 | 214 |
| 536 | 3300044693 | Ga0466961_0055360 | Ga0466961_0055360_122_781 | 214 |
| 537 | 3300044693 | Ga0466961_0056489 | Ga0466961_0056489_1339_1983 | 214 |
| 538 | 3300044693 | Ga0466961_0142759 | Ga0466961_0142759_606_1250 | 214 |
| 539 | 3300044694 | Ga0466963_0026729 | Ga0466963_0026729_725_1369 | 214 |
| 540 | 3300044694 | Ga0466963_0042027 | Ga0466963_0042027_2013_2663 | 214 |
| 541 | 3300044694 | Ga0466963_0063523 | Ga0466963_0063523_1554_2198 | 214 |
| 542 | 3300044694 | Ga0466963_0077425 | Ga0466963_0077425_1195_1854 | 214 |
| 543 | 3300044694 | Ga0466963_0216703 | Ga0466963_0216703_462_1106 | 214 |
| 544 | 3300044706 | Ga0466964_0013333 | Ga0466964_0013333_1751_2410 | 214 |
| 545 | 3300044706 | Ga0466964_0039340 | Ga0466964_0039340_281_925 | 214 |
| 546 | 3300044719 | Ga0466971_0039421 | Ga0466971_0039421_255_899 | 214 |
| 547 | 3300044719 | Ga0466971_0059969 | Ga0466971_0059969_45_704 | 214 |
| 548 | 3300044765 | Ga0466970_0179342 | Ga0466970_0179342_293_937 | 214 |
| 549 | 3300044842 | Ga0466957_0016152 | Ga0466957_0016152_607_1251 | 214 |
| 550 | 3300044842 | Ga0466957_0102272 | Ga0466957_0102272_854_1498 | 214 |
| 551 | 3300044842 | Ga0466957_0161881 | Ga0466957_0161881_496_1149 | 214 |
| 552 | 3300044901 | Ga0466960_0002698 | Ga0466960_0002698_2968_3627 | 214 |
| 553 | 3300044901 | Ga0466960_0015309 | Ga0466960_0015309_2001_2645 | 214 |
| 554 | 3300044901 | Ga0466960_0129024 | Ga0466960_0129024_536_1183 | 214 |
| 555 | 3300044901 | Ga0466960_0214232 | Ga0466960_0214232_228_887 | 214 |
| 556 | 3300045049 | Ga0466959_0149862 | Ga0466959_0149862_852_1496 | 214 |
| 557 | 3300045049 | Ga0466959_0348898 | Ga0466959_0348898_342_986 | 214 |
| 558 | 3300045051 | Ga0451576_0243910 | Ga0451576_0243910_878_1534 | 214 |
| 559 | 3300045836 | Ga0466958_0043742 | Ga0466958_0043742_1572_2216 | 214 |
| 560 | 3300045836 | Ga0466958_0103935 | Ga0466958_0103935_980_1624 | 214 |
| 561 | 3300045836 | Ga0466958_0416943 | Ga0466958_0416943_29_673 | 214 |
| 562 | 3300045976 | Ga0466967_0026909 | Ga0466967_0026909_2357_3007 | 214 |
| 563 | 3300045976 | Ga0466967_0068255 | Ga0466967_0068255_2216_2866 | 214 |
| 564 | 3300045976 | Ga0466967_0189037 | Ga0466967_0189037_728_1387 | 214 |
| 565 | 3300045976 | Ga0466967_0195215 | Ga0466967_0195215_1102_1761 | 214 |
| 566 | 3300045976 | Ga0466967_0204158 | Ga0466967_0204158_141_785 | 214 |
| 567 | 3300045976 | Ga0466967_0317977 | Ga0466967_0317977_50_700 | 214 |
| 568 | 3300045976 | Ga0466967_1404095 | Ga0466967_1404095_10_660 | 214 |
| 569 | 3300046461 | Ga0495641_0062686 | Ga0495641_0062686_209_859 | 214 |
| 570 | 3300046461 | Ga0495641_0065041 | Ga0495641_0065041_410_1060 | 214 |
| 571 | 3300046517 | Ga0495630_0492233 | Ga0495630_0492233_71_730 | 214 |
| 572 | 3300048903 | Ga0496100_0225892 | Ga0496100_0225892_191_853 | 214 |
| 573 | 3300048904 | Ga0496101_0051661 | Ga0496101_0051661_2164_2823 | 214 |
| 574 | 3300048905 | Ga0496102_0026620 | Ga0496102_0026620_4294_4950 | 214 |
| 575 | 3300048906 | Ga0496103_0029286 | Ga0496103_0029286_1037_1696 | 214 |
| 576 | 3300048907 | Ga0496104_0007957 | Ga0496104_0007957_6611_7270 | 214 |
| 577 | 3300048907 | Ga0496104_0281643 | Ga0496104_0281643_453_1115 | 214 |
| 578 | 3300048908 | Ga0496105_0000120 | Ga0496105_0000120_53188_53847 | 214 |
| 579 | 3300048908 | Ga0496105_0275514 | Ga0496105_0275514_247_918 | 214 |
| 580 | 3300048909 | Ga0496106_0014173 | Ga0496106_0014173_2326_2985 | 214 |
| 581 | 3300048909 | Ga0496106_0196199 | Ga0496106_0196199_409_1068 | 214 |
| 582 | 3300048910 | Ga0496107_0051409 | Ga0496107_0051409_2165_2824 | 214 |
| 583 | 3300048911 | Ga0496108_0083123 | Ga0496108_0083123_917_1573 | 214 |
| 584 | 3300048911 | Ga0496108_0110529 | Ga0496108_0110529_1415_2059 | 214 |
| 585 | 3300048911 | Ga0496108_0458313 | Ga0496108_0458313_308_979 | 214 |
| 586 | 3300048912 | Ga0496109_0050712 | Ga0496109_0050712_668_1327 | 214 |
| 587 | 3300048912 | Ga0496109_0110142 | Ga0496109_0110142_83_742 | 214 |
| 588 | 3300048913 | Ga0496110_0016080 | Ga0496110_0016080_3004_3660 | 214 |
| 589 | 3300048913 | Ga0496110_0340901 | Ga0496110_0340901_671_1330 | 214 |
| 590 | 3300048913 | Ga0496110_0344089 | Ga0496110_0344089_32_703 | 214 |
| 591 | 3300048913 | Ga0496110_0833567 | Ga0496110_0833567_45_689 | 214 |
| 592 | 3300048914 | Ga0496111_0202049 | Ga0496111_0202049_176_835 | 214 |
| 593 | 3300048917 | Ga0496114_0063023 | Ga0496114_0063023_815_1474 | 214 |
| 594 | 3300048917 | Ga0496114_0068261 | Ga0496114_0068261_211_870 | 214 |
| 595 | 3300048917 | Ga0496114_0154463 | Ga0496114_0154463_869_1516 | 214 |
| 596 | 3300048917 | Ga0496114_0161437 | Ga0496114_0161437_1047_1691 | 214 |
| 597 | 3300048918 | Ga0496115_0194966 | Ga0496115_0194966_1002_1661 | 214 |
| 598 | 3300048929 | Ga0496126_0191536 | Ga0496126_0191536_731_1375 | 214 |
| 599 | 3300049534 | Ga0501318_009274 | Ga0501318_009274_393_1037 | 214 |
| 600 | 3300049568 | Ga0501031_0227220 | Ga0501031_0227220_32_676 | 214 |
| 601 | 3300049569 | Ga0501032_0084460 | Ga0501032_0084460_704_1357 | 214 |
| 602 | 3300049571 | Ga0501034_0011800 | Ga0501034_0011800_7931_8581 | 214 |
| 603 | 3300049571 | Ga0501034_0046611 | Ga0501034_0046611_463_1113 | 214 |
| 604 | 3300049571 | Ga0501034_0108296 | Ga0501034_0108296_653_1297 | 214 |
| 605 | 3300049574 | Ga0501038_0158231 | Ga0501038_0158231_108_761 | 214 |
| 606 | 3300049575 | Ga0501039_0124681 | Ga0501039_0124681_23_667 | 214 |
| 607 | 3300049576 | Ga0501040_0093802 | Ga0501040_0093802_369_1022 | 214 |
| 608 | 3300049577 | Ga0501041_0317354 | Ga0501041_0317354_223_873 | 214 |
| 609 | 3300049578 | Ga0501042_0004438 | Ga0501042_0004438_7021_7665 | 214 |
| 610 | 3300049578 | Ga0501042_0115683 | Ga0501042_0115683_471_1124 | 214 |
| 611 | 3300049581 | Ga0501047_0341545 | Ga0501047_0341545_449_1099 | 214 |
| 612 | 3300049583 | Ga0501067_0002053 | Ga0501067_0002053_1333_1983 | 214 |
| 613 | 3300049583 | Ga0501067_0013627 | Ga0501067_0013627_3543_4193 | 214 |
| 614 | 3300049583 | Ga0501067_0070232 | Ga0501067_0070232_871_1515 | 214 |
| 615 | 3300049584 | Ga0501068_0020200 | Ga0501068_0020200_199_849 | 214 |
| 616 | 3300049584 | Ga0501068_0111959 | Ga0501068_0111959_705_1361 | 214 |
| 617 | 3300049585 | Ga0501069_0003304 | Ga0501069_0003304_5826_6476 | 214 |
| 618 | 3300049586 | Ga0501070_0003699 | Ga0501070_0003699_10755_11405 | 214 |
| 619 | 3300049586 | Ga0501070_0010553 | Ga0501070_0010553_6661_7311 | 214 |
| 620 | 3300049586 | Ga0501070_0012740 | Ga0501070_0012740_918_1568 | 214 |
| 621 | 3300049586 | Ga0501070_0235703 | Ga0501070_0235703_807_1463 | 214 |
| 622 | 3300049587 | Ga0501071_0003221 | Ga0501071_0003221_56_700 | 214 |
| 623 | 3300049587 | Ga0501071_0010142 | Ga0501071_0010142_2033_2683 | 214 |
| 624 | 3300049587 | Ga0501071_0041074 | Ga0501071_0041074_2434_3078 | 214 |
| 625 | 3300049587 | Ga0501071_0046239 | Ga0501071_0046239_225_875 | 214 |
| 626 | 3300049587 | Ga0501071_0139948 | Ga0501071_0139948_909_1562 | 214 |
| 627 | 3300049588 | Ga0501072_0015013 | Ga0501072_0015013_5146_5796 | 214 |
| 628 | 3300049588 | Ga0501072_0135730 | Ga0501072_0135730_81_731 | 214 |
| 629 | 3300049588 | Ga0501072_0298741 | Ga0501072_0298741_401_1045 | 214 |
| 630 | 3300049589 | Ga0501073_0004316 | Ga0501073_0004316_9682_10332 | 214 |
| 631 | 3300049589 | Ga0501073_0041947 | Ga0501073_0041947_452_1102 | 214 |
| 632 | 3300049589 | Ga0501073_0238625 | Ga0501073_0238625_564_1208 | 214 |
| 633 | 3300049590 | Ga0501074_0000999 | Ga0501074_0000999_10813_11463 | 214 |
| 634 | 3300049590 | Ga0501074_0014355 | Ga0501074_0014355_4237_4887 | 214 |
| 635 | 3300049590 | Ga0501074_0142338 | Ga0501074_0142338_917_1567 | 214 |
| 636 | 3300049590 | Ga0501074_0167082 | Ga0501074_0167082_173_826 | 214 |
| 637 | 3300049590 | Ga0501074_0176845 | Ga0501074_0176845_229_882 | 214 |
| 638 | 3300049590 | Ga0501074_0186762 | Ga0501074_0186762_549_1214 | 214 |
| 639 | 3300049591 | Ga0501075_0102658 | Ga0501075_0102658_108_752 | 214 |
| 640 | 3300049591 | Ga0501075_0142624 | Ga0501075_0142624_535_1200 | 214 |
| 641 | 3300049591 | Ga0501075_0198127 | Ga0501075_0198127_370_1020 | 214 |
| 642 | 3300049591 | Ga0501075_0297838 | Ga0501075_0297838_520_1173 | 214 |
| 643 | 3300049593 | Ga0501077_0004798 | Ga0501077_0004798_3418_4068 | 214 |
| 644 | 3300049593 | Ga0501077_0061143 | Ga0501077_0061143_1570_2220 | 214 |
| 645 | 3300049741 | Ga0501079_0004880 | Ga0501079_0004880_4851_5501 | 214 |
| 646 | 3300049741 | Ga0501079_0071192 | Ga0501079_0071192_1158_1802 | 214 |
| 647 | 3300049742 | Ga0501080_0006490 | Ga0501080_0006490_900_1550 | 214 |
| 648 | 3300049742 | Ga0501080_0010183 | Ga0501080_0010183_5443_6093 | 214 |
| 649 | 3300049742 | Ga0501080_0046390 | Ga0501080_0046390_251_901 | 214 |
| 650 | 3300049742 | Ga0501080_0085067 | Ga0501080_0085067_2182_2826 | 214 |
| 651 | 3300049743 | Ga0501081_0222144 | Ga0501081_0222144_57_710 | 214 |
| 652 | 3300049744 | Ga0501083_0005954 | Ga0501083_0005954_7910_8560 | 214 |
| 653 | 3300049744 | Ga0501083_0153823 | Ga0501083_0153823_394_1044 | 214 |
| 654 | 3300049824 | Ga0501045_0053014 | Ga0501045_0053014_1886_2539 | 214 |
| 655 | 3300050490 | nmdc:mga03n38_110028_c1 | nmdc:mga03n38_110028_c1_516_1160 | 214 |
| 656 | 3300050490 | nmdc:mga03n38_208628_c1 | nmdc:mga03n38_208628_c1_259_915 | 214 |
| 657 | 3300050491 | nmdc:mga00v17_16636_c1 | nmdc:mga00v17_16636_c1_2104_2748 | 214 |
| 658 | 3300050492 | nmdc:mga0yw44_110306_c1 | nmdc:mga0yw44_110306_c1_45_689 | 214 |
| 659 | 3300050492 | nmdc:mga0yw44_11576_c1 | nmdc:mga0yw44_11576_c1_175_831 | 214 |
| 660 | 3300050492 | nmdc:mga0yw44_211258_c1 | nmdc:mga0yw44_211258_c1_299_943 | 214 |
| 661 | 3300050492 | nmdc:mga0yw44_266828_c1 | nmdc:mga0yw44_266828_c1_307_954 | 214 |
| 662 | 3300050492 | nmdc:mga0yw44_301517_c1 | nmdc:mga0yw44_301517_c1_111_758 | 214 |
| 663 | 3300050492 | nmdc:mga0yw44_3056_c1 | nmdc:mga0yw44_3056_c1_774_1418 | 214 |
| 664 | 3300050492 | nmdc:mga0yw44_329861_c1 | nmdc:mga0yw44_329861_c1_121_765 | 214 |
| 665 | 3300050492 | nmdc:mga0yw44_386124_c1 | nmdc:mga0yw44_386124_c1_194_838 | 214 |
| 666 | 3300050492 | nmdc:mga0yw44_435_c1 | nmdc:mga0yw44_435_c1_5338_5982 | 214 |
| 667 | 3300050494 | nmdc:mga06z11_195442_c1 | nmdc:mga06z11_195442_c1_412_1059 | 214 |
| 668 | 3300050494 | nmdc:mga06z11_23480_c1 | nmdc:mga06z11_23480_c1_621_1265 | 214 |
| 669 | 3300050494 | nmdc:mga06z11_4639_c1 | nmdc:mga06z11_4639_c1_3450_4106 | 214 |
| 670 | 3300050494 | nmdc:mga06z11_499533_c1 | nmdc:mga06z11_499533_c1_75_719 | 214 |
| 671 | 3300050495 | nmdc:mga04h51_4724_c1 | nmdc:mga04h51_4724_c1_19_666 | 214 |
| 672 | 3300053085 | Ga0495619_0501477 | Ga0495619_0501477_172_816 | 214 |
| 673 | 3300053088 | Ga0500644_0096558 | Ga0500644_0096558_91_738 | 214 |
| 674 | 3300053096 | Ga0500641_0001880 | Ga0500641_0001880_5514_6158 | 214 |
| 675 | 3300053096 | Ga0500641_0034811 | Ga0500641_0034811_1324_1968 | 214 |
| 676 | 3300053104 | Ga0500556_0000985 | Ga0500556_0000985_12542_13201 | 214 |
| 677 | 3300053117 | Ga0500593_001205 | Ga0500593_001205_1784_2443 | 214 |
| 678 | 3300053140 | Ga0500573_0007551 | Ga0500573_0007551_877_1521 | 214 |
| 679 | 3300053140 | Ga0500573_0073995 | Ga0500573_0073995_516_1172 | 214 |
| 680 | 3300054114 | Ga0501084_0011106 | Ga0501084_0011106_6545_7195 | 214 |
| 681 | 3300054114 | Ga0501084_0729665 | Ga0501084_0729665_26_682 | 214 |
| 682 | 3300054114 | Ga0501084_0732665 | Ga0501084_0732665_110_754 | 214 |
| 683 | 3300060353 | Ga0501082_0001956 | Ga0501082_0001956_3759_4409 | 214 |
| 684 | 3300060353 | Ga0501082_0871621 | Ga0501082_0871621_29_673 | 214 |
| 685 | 3300061719 | Ga0466962_0086962 | Ga0466962_0086962_555_1199 | 214 |
| 686 | 3300061734 | Ga0530510_0358346 | Ga0530510_0358346_438_1082 | 214 |
| 687 | iso_pu_bacteria | 2855386786 | 2855387000 | 214 |
| 688 | iso_pu_bacteria | 2857481737 | 2857482240 | 214 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6g7d-assembly1.cif.gz_A | structure of met1 from mycobacterium hassiacum in complex with sam and glycerol. | 0.9642 | 3 | 213 |
| 6g80-assembly1.cif.gz_A | structure of mycobacterium hassiacum met1 from orthorhombic crystals. | 0.9515 | 3 | 213 |
| 6g7d-assembly1.cif.gz_A | structure of met1 from mycobacterium hassiacum in complex with sam and glycerol. | 0.951 | 3 | 213 |
| 2gpy-assembly1.cif.gz_A | crystal structure of putative o-methyltransferase from bacillus halodurans | 0.8016 | 21 | 206 |
| 4xvz-assembly2.cif.gz_D | mycf mycinamicin iii 3'-o-methyltransferase in complex with mg | 0.7943 | 11 | 206 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_K7N0B7_9_135_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8477 | 14 | 146 | 3.40.50.150 |
| af_F4HS78_116_300_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.7907 | 13 | 200 | 3.40.50.150 |
| af_F4HS78_116_300_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.7791 | 13 | 200 | 3.40.50.150 |
| af_A1Y9I9_44_257_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.7749 | 16 | 207 | 3.40.50.150 |
| af_K8ERZ6_162_450_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.7705 | 19 | 163 | 3.40.50.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A849AA15-F1-model_v4 | deleted | 0.9785 | 1 | 204 |
|
| AF-A0A6L6ANL0-F1-model_v4 | deleted | 0.976 | 16 | 212 |
|
| AF-H5XA09-F1-model_v4 | Putative O-methyltransferase | 0.9751 | 1 | 213 |
GO:0005886
GO:0008168 GO:0030206 GO:0032259 GO:0071770 |
| AF-A0A399R0Y4-F1-model_v4 | Class I SAM-dependent methyltransferase | 0.9751 | 9 | 206 |
GO:0005886
GO:0008168 GO:0030206 GO:0032259 GO:0071770 |
| AF-C7QHP1-F1-model_v4 | Secreted protein | 0.9719 | 1 | 205 |
GO:0005886
GO:0030206 GO:0071770 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar