F475308

General Info

Members Datasets Scaffolds Average Seq Length
688 256 1376 201

Family's Representative Sequence

Representative Sequence 3300005468|Ga0070707_100284546|Ga0070707_1002845462
Length 229
Sequence MTPDAKDVGSGFLTAEALAKAVSRTEGSGRTQGPAAIVKVSGRGLPLRGHDIDTDRIMPARFLVAVSFDGLEKHLFEDDRAADRAHPFNDPRYAGAAILIVNRNFGSGSSREHAPQGLARAGIRAVIGESFSEIFQGNSSILGVPCFAASHEMVEQLQTLVERAPGTVIEADVESGVVTAGALRGTASLPPALRDAFVSGQWNPTAMLLDRFEEVQAVAARLPYLSGFQ

Samples

Sample ID Description Type Environment
1 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
70 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
71 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
72 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
77 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
162 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
164 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
168 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
169 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
170 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
171 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
172 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
173 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
174 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
175 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
176 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
177 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
178 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
179 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
180 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
181 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
182 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
183 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
184 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
185 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
186 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
187 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
188 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
189 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
190 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
191 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
192 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
193 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
194 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
195 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
196 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
197 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
198 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
199 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
200 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
201 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
202 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
203 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
204 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
205 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
206 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
207 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
208 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
209 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
210 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
211 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
212 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
213 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
214 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
215 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
227 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
228 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
229 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
230 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
231 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
232 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
233 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
234 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
235 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
236 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
237 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
238 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
241 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
242 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
243 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
244 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
245 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
246 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
247 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
248 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
249 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
250 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
251 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
252 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
253 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
254 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
255 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
256 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.85
Metatranscriptomes 0.15
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.89
Nodule 0
Rhizoplane 1.89
Rhizosphere 96.08
Stem 0
Stem Tuber 0
Unclassified 1.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070707_100284546 3300005468 Bacteria 1606
2 Ga0065704_10001891 3300005289 Bacteria 9642
3 Ga0065712_10085069 3300005290 Bacteria 2721
4 Ga0065707_10002604 3300005295 Bacteria 9730
5 Ga0070658_10271015 3300005327 Bacteria 1444
6 Ga0070683_100387009 3300005329 Bacteria 1333
7 Ga0070690_100066422 3300005330 Bacteria 2335
8 Ga0070690_100158578 3300005330 Bacteria 1549
9 Ga0070690_100270116 3300005330 Bacteria 1209
10 Ga0070670_100085445 3300005331 Bacteria 2711
11 Ga0070670_100329125 3300005331 Bacteria 1340
12 Ga0070670_100557166 3300005331 Bacteria 1023
13 Ga0070670_100708123 3300005331 Archaea 906
14 Ga0068869_100210443 3300005334 Bacteria 1537
15 Ga0068869_100240703 3300005334 Bacteria 1442
16 Ga0068869_100484571 3300005334 Bacteria 1030
17 Ga0068869_100715768 3300005334 Bacteria 855
18 Ga0070666_10261139 3300005335 Bacteria 1228
19 Ga0070680_100086873 3300005336 Bacteria 2586
20 Ga0068868_100085948 3300005338 Bacteria 2528
21 Ga0068868_100215023 3300005338 Bacteria 1608
22 Ga0068868_100217867 3300005338 Bacteria 1597
23 Ga0068868_100252468 3300005338 Bacteria 1485
24 Ga0068868_100354057 3300005338 Bacteria 1258
25 Ga0070660_100004035 3300005339 Bacteria 10138
26 Ga0070689_100422810 3300005340 Bacteria 1130
27 Ga0070689_100677857 3300005340 Bacteria 899
28 Ga0070691_10116495 3300005341 Bacteria 1341
29 Ga0070687_100013393 3300005343 Bacteria 3655
30 Ga0070692_10123263 3300005345 Bacteria 1448
31 Ga0070692_10269342 3300005345 Bacteria 1028
32 Ga0070692_10375863 3300005345 Bacteria 890
33 Ga0070668_100026134 3300005347 Bacteria 4428
34 Ga0070668_100793924 3300005347 Bacteria 841
35 Ga0070668_100951093 3300005347 Bacteria 770
36 Ga0070669_100006814 3300005353 Bacteria 8221
37 Ga0070669_100087484 3300005353 Bacteria 2330
38 Ga0070669_100172690 3300005353 Bacteria 1686
39 Ga0070669_100248439 3300005353 Bacteria 1416
40 Ga0070669_100326782 3300005353 Bacteria 1240
41 Ga0070675_100003305 3300005354 Bacteria 12230
42 Ga0070675_100005276 3300005354 Bacteria 9868
43 Ga0070675_100017494 3300005354 Bacteria 5696
44 Ga0070675_100076933 3300005354 Bacteria 2776
45 Ga0070675_100119971 3300005354 Bacteria 2234
46 Ga0070675_100251429 3300005354 Bacteria 1547
47 Ga0070675_100314614 3300005354 Bacteria 1382
48 Ga0070671_100019226 3300005355 Bacteria 5558
49 Ga0070671_100022846 3300005355 Bacteria 5110
50 Ga0070671_100159812 3300005355 Bacteria 1905
51 Ga0070671_100228470 3300005355 Bacteria 1579
52 Ga0070674_100008603 3300005356 Bacteria 6084
53 Ga0070674_100255240 3300005356 Bacteria 1379
54 Ga0070674_100257216 3300005356 Bacteria 1374
55 Ga0070674_100347431 3300005356 Bacteria 1197
56 Ga0070674_100350541 3300005356 Bacteria 1192
57 Ga0070674_100681641 3300005356 Bacteria 877
58 Ga0070673_100074777 3300005364 Bacteria 2731
59 Ga0070673_100133160 3300005364 Bacteria 2089
60 Ga0070673_100276750 3300005364 Bacteria 1471
61 Ga0070673_100298851 3300005364 Bacteria 1417
62 Ga0070673_100327664 3300005364 Bacteria 1354
63 Ga0070688_100040354 3300005365 Bacteria 2860
64 Ga0070688_100267197 3300005365 Bacteria 1224
65 Ga0070688_100762569 3300005365 Bacteria 754
66 Ga0070659_100069208 3300005366 Bacteria 2801
67 Ga0070659_100345884 3300005366 Bacteria 1247
68 Ga0070667_100010352 3300005367 Bacteria 7702
69 Ga0070667_100316458 3300005367 Bacteria 1408
70 Ga0070667_100621321 3300005367 Bacteria 996
71 Ga0070667_100657229 3300005367 Bacteria 968
72 Ga0070703_10056058 3300005406 Bacteria 1275
73 Ga0070709_10303554 3300005434 Bacteria 1166
74 Ga0070714_100003224 3300005435 Bacteria 12144
75 Ga0070701_10003430 3300005438 Bacteria 6268
76 Ga0070701_10020129 3300005438 Bacteria 3163
77 Ga0070701_10588905 3300005438 Bacteria 735
78 Ga0070705_100013006 3300005440 Bacteria 4247
79 Ga0070705_100106421 3300005440 Bacteria 1783
80 Ga0070705_100148857 3300005440 Bacteria 1550
81 Ga0070705_100186469 3300005440 Bacteria 1410
82 Ga0070700_100014503 3300005441 Bacteria 4451
83 Ga0070700_100060119 3300005441 Bacteria 2394
84 Ga0070700_100156857 3300005441 Bacteria 1563
85 Ga0070694_100029157 3300005444 Bacteria 3599
86 Ga0070694_100076316 3300005444 Bacteria 2320
87 Ga0070694_100112153 3300005444 Bacteria 1944
88 Ga0070694_100339940 3300005444 Bacteria 1160
89 Ga0070694_100432419 3300005444 Bacteria 1036
90 Ga0070694_100526454 3300005444 Bacteria 944
91 Ga0070708_100077457 3300005445 Bacteria 3005
92 Ga0070708_100737257 3300005445 Bacteria 927
93 Ga0070663_100058858 3300005455 Bacteria 2760
94 Ga0070663_100109157 3300005455 Bacteria 2077
95 Ga0070678_100390229 3300005456 Bacteria 1207
96 Ga0070678_100606139 3300005456 Bacteria 978
97 Ga0070678_101007219 3300005456 Bacteria 766
98 Ga0070662_100102022 3300005457 Bacteria 2173
99 Ga0070662_100177914 3300005457 Bacteria 1675
100 Ga0068867_100011834 3300005459 Bacteria 6162
101 Ga0068867_100065483 3300005459 Bacteria 2704
102 Ga0070685_10583374 3300005466 Bacteria 802
103 Ga0070706_100417913 3300005467 Bacteria 1248
104 Ga0070706_101064296 3300005467 Bacteria 745
105 Ga0070707_100095750 3300005468 Bacteria 2875
106 Ga0070707_100150518 3300005468 Bacteria 2266
107 Ga0070707_100157220 3300005468 Bacteria 2215
108 Ga0070707_100296676 3300005468 Bacteria 1571
109 Ga0070707_100392839 3300005468 Bacteria 1347
110 Ga0070698_100004643 3300005471 Bacteria 15102
111 Ga0070698_100837049 3300005471 Bacteria 865
112 Ga0070698_101092669 3300005471 Bacteria 746
113 Ga0070699_100001254 3300005518 Bacteria 23409
114 Ga0070699_100015512 3300005518 Bacteria 6549
115 Ga0070699_100052491 3300005518 Bacteria 3528
116 Ga0070699_100063173 3300005518 Bacteria 3210
117 Ga0070699_100178851 3300005518 Bacteria 1882
118 Ga0070699_100193784 3300005518 Bacteria 1806
119 Ga0070699_100198855 3300005518 Bacteria 1782
120 Ga0070699_100242745 3300005518 Bacteria 1608
121 Ga0070679_100014905 3300005530 Bacteria 7466
122 Ga0070679_100434509 3300005530 Bacteria 1258
123 Ga0070684_100039196 3300005535 Bacteria 4074
124 Ga0070684_100919785 3300005535 Bacteria 820
125 Ga0070697_100068616 3300005536 Bacteria 2903
126 Ga0070697_100236294 3300005536 Bacteria 1560
127 Ga0070697_100595064 3300005536 Bacteria 972
128 Ga0068853_100829999 3300005539 Bacteria 886
129 Ga0070672_100018677 3300005543 Bacteria 5019
130 Ga0070672_100067717 3300005543 Bacteria 2830
131 Ga0070672_100100566 3300005543 Bacteria 2345
132 Ga0070672_100371369 3300005543 Bacteria 1222
133 Ga0070672_100667755 3300005543 Bacteria 908
134 Ga0070686_100000457 3300005544 Bacteria 24945
135 Ga0070686_100280838 3300005544 Bacteria 1228
136 Ga0070695_100005156 3300005545 Bacteria 7706
137 Ga0070695_100775141 3300005545 Bacteria 767
138 Ga0070695_100789546 3300005545 Bacteria 760
139 Ga0070696_100009391 3300005546 Bacteria 6548
140 Ga0070696_100015538 3300005546 Bacteria 5112
141 Ga0070696_100016371 3300005546 Bacteria 4992
142 Ga0070696_100396220 3300005546 Archaea 1079
143 Ga0070665_100009073 3300005548 Bacteria 10073
144 Ga0070665_100032276 3300005548 Bacteria 5271
145 Ga0070704_100002987 3300005549 Bacteria 9615
146 Ga0070704_100020163 3300005549 Bacteria 4294
147 Ga0070704_100020587 3300005549 Bacteria 4257
148 Ga0070704_100096471 3300005549 Bacteria 2217
149 Ga0070704_100171289 3300005549 Bacteria 1727
150 Ga0070704_100204592 3300005549 Bacteria 1596
151 Ga0070704_100317091 3300005549 Bacteria 1305
152 Ga0070704_100358443 3300005549 Bacteria 1233
153 Ga0068855_100045666 3300005563 Bacteria 5181
154 Ga0068855_101456484 3300005563 Bacteria 704
155 Ga0070664_100178538 3300005564 Bacteria 1886
156 Ga0070664_100727911 3300005564 Bacteria 925
157 Ga0068857_100035369 3300005577 Bacteria 4424
158 Ga0068854_100031926 3300005578 Bacteria 3662
159 Ga0068854_100342094 3300005578 Bacteria 1222
160 Ga0070702_100004574 3300005615 Bacteria 6332
161 Ga0070702_100298059 3300005615 Bacteria 1114
162 Ga0070702_100518056 3300005615 Bacteria 879
163 Ga0068852_100488081 3300005616 Unclassified 1225
164 Ga0068852_100586387 3300005616 Bacteria 1118
165 Ga0068859_100054352 3300005617 Bacteria 4027
166 Ga0068859_100242019 3300005617 Bacteria 1894
167 Ga0068859_100361878 3300005617 Bacteria 1546
168 Ga0068859_101416173 3300005617 Bacteria 767
169 Ga0068859_101497190 3300005617 Bacteria 745
170 Ga0068859_101505329 3300005617 Bacteria 743
171 Ga0068864_100006272 3300005618 Bacteria 9755
172 Ga0068864_100019762 3300005618 Bacteria 5633
173 Ga0068864_100137526 3300005618 Bacteria 2201
174 Ga0068864_100212139 3300005618 Bacteria 1783
175 Ga0068864_100234314 3300005618 Bacteria 1699
176 Ga0068864_101053758 3300005618 Bacteria 808
177 Ga0068866_10089074 3300005718 Bacteria 1676
178 Ga0068866_10794771 3300005718 Bacteria 657
179 Ga0068861_100001795 3300005719 Bacteria 13815
180 Ga0068861_100014836 3300005719 Bacteria 5474
181 Ga0068861_100098951 3300005719 Bacteria 2316
182 Ga0068861_100170797 3300005719 Bacteria 1802
183 Ga0068861_100359146 3300005719 Bacteria 1280
184 Ga0068861_100477448 3300005719 Bacteria 1122
185 Ga0068851_10049116 3300005834 Bacteria 2139
186 Ga0068851_10514975 3300005834 Bacteria 719
187 Ga0068870_10014558 3300005840 Bacteria 3717
188 Ga0068870_10119372 3300005840 Bacteria 1517
189 Ga0068870_10345025 3300005840 Bacteria 954
190 Ga0068870_10422897 3300005840 Bacteria 872
191 Ga0068863_100044397 3300005841 Bacteria 4219
192 Ga0068863_100685385 3300005841 Bacteria 1018
193 Ga0068863_100718643 3300005841 Unclassified 993
194 Ga0068858_100010580 3300005842 Bacteria 8738
195 Ga0068858_100023875 3300005842 Bacteria 5697
196 Ga0068858_100031034 3300005842 Bacteria 4963
197 Ga0068858_100137655 3300005842 Bacteria 2292
198 Ga0068860_100433145 3300005843 Bacteria 1305
199 Ga0068860_101115796 3300005843 Bacteria 808
200 Ga0068860_101118444 3300005843 Bacteria 807
201 Ga0068860_101175823 3300005843 Bacteria 787
202 Ga0068862_100043296 3300005844 Bacteria 3838
203 Ga0068862_100058133 3300005844 Bacteria 3317
204 Ga0068862_100110655 3300005844 Bacteria 2410
205 Ga0068862_100534379 3300005844 Bacteria 1118
206 Ga0068862_100641020 3300005844 Bacteria 1024
207 Ga0068862_100835184 3300005844 Bacteria 902
208 Ga0068862_101191849 3300005844 Bacteria 760
209 Ga0081455_10108513 3300005937 Bacteria 2210
210 Ga0075364_10406018 3300006051 Bacteria 930
211 Ga0075367_10017798 3300006178 Bacteria 3907
212 Ga0075367_10100378 3300006178 Bacteria 1768
213 Ga0075366_10007068 3300006195 Bacteria 6177
214 Ga0097621_100490976 3300006237 Bacteria 1111
215 Ga0068871_100018640 3300006358 Bacteria 5281
216 Ga0068871_100115933 3300006358 Bacteria 2258
217 Ga0068871_100181664 3300006358 Bacteria 1808
218 Ga0068871_100238307 3300006358 Bacteria 1581
219 Ga0068871_100305968 3300006358 Bacteria 1396
220 Ga0068871_100414971 3300006358 Bacteria 1201
221 Ga0068871_100825135 3300006358 Bacteria 856
222 Ga0075428_100155257 3300006844 Bacteria 2486
223 Ga0075430_100002671 3300006846 Bacteria 14882
224 Ga0075430_100387614 3300006846 Bacteria 1153
225 Ga0075431_100130976 3300006847 Bacteria 2587
226 Ga0075431_100159227 3300006847 Bacteria 2322
227 Ga0075431_100255626 3300006847 Bacteria 1779
228 Ga0075433_10065508 3300006852 Bacteria 3187
229 Ga0075433_10093758 3300006852 Bacteria 2657
230 Ga0075433_10112505 3300006852 Bacteria 2415
231 Ga0075433_10379167 3300006852 Bacteria 1248
232 Ga0075433_11001377 3300006852 Bacteria 728
233 Ga0075434_100010611 3300006871 Bacteria 8643
234 Ga0075434_100019263 3300006871 Bacteria 6602
235 Ga0075434_100021361 3300006871 Bacteria 6291
236 Ga0075434_100031445 3300006871 Bacteria 5233
237 Ga0075434_100044979 3300006871 Bacteria 4379
238 Ga0075434_100169417 3300006871 Bacteria 2204
239 Ga0075434_100360035 3300006871 Bacteria 1476
240 Ga0075434_100473131 3300006871 Bacteria 1274
241 Ga0075434_100724674 3300006871 Bacteria 1012
242 Ga0075434_100815634 3300006871 Bacteria 949
243 Ga0075429_100285304 3300006880 Bacteria 1446
244 Ga0075429_101269916 3300006880 Unclassified 642
245 Ga0068865_100001659 3300006881 Bacteria 13022
246 Ga0068865_100048103 3300006881 Bacteria 2934
247 Ga0075436_100000928 3300006914 Bacteria 19542
248 Ga0075436_100033743 3300006914 Bacteria 3528
249 Ga0075436_100143243 3300006914 Bacteria 1680
250 Ga0075436_100894035 3300006914 Bacteria 664
251 Ga0097620_100054349 3300006931 Bacteria 4027
252 Ga0097620_100242022 3300006931 Bacteria 1894
253 Ga0097620_100361885 3300006931 Bacteria 1546
254 Ga0097620_101416246 3300006931 Bacteria 767
255 Ga0097620_101497317 3300006931 Bacteria 745
256 Ga0097620_101505281 3300006931 Bacteria 743
257 Ga0075435_100000216 3300007076 Bacteria 35336
258 Ga0075435_100001206 3300007076 Bacteria 16546
259 Ga0075435_100012646 3300007076 Bacteria 6253
260 Ga0075435_100077783 3300007076 Bacteria 2720
261 Ga0075435_100079682 3300007076 Bacteria 2688
262 Ga0075435_100091465 3300007076 Bacteria 2511
263 Ga0075435_100148649 3300007076 Bacteria 1969
264 Ga0075435_100180464 3300007076 Bacteria 1784
265 Ga0075435_100184257 3300007076 Bacteria 1765
266 Ga0105240_10003280 3300009093 Bacteria 25304
267 Ga0105240_10271481 3300009093 Bacteria 1952
268 Ga0105240_10480408 3300009093 Bacteria 1385
269 Ga0105240_10637285 3300009093 Bacteria 1170
270 Ga0111539_10027424 3300009094 Bacteria 6957
271 Ga0111539_10028637 3300009094 Bacteria 6794
272 Ga0111539_10030533 3300009094 Bacteria 6549
273 Ga0111539_10046916 3300009094 Bacteria 5166
274 Ga0111539_10192247 3300009094 Bacteria 2381
275 Ga0111539_10437539 3300009094 Bacteria 1523
276 Ga0111539_11428261 3300009094 Bacteria 803
277 Ga0105245_10045308 3300009098 Bacteria 3928
278 Ga0105245_10056388 3300009098 Bacteria 3531
279 Ga0105245_10422837 3300009098 Bacteria 1336
280 Ga0105245_11084891 3300009098 Bacteria 847
281 Ga0105247_10034269 3300009101 Bacteria 3092
282 Ga0105247_10188537 3300009101 Bacteria 1380
283 Ga0114129_10000239 3300009147 Bacteria 61404
284 Ga0114129_10000872 3300009147 Bacteria 39245
285 Ga0114129_10011257 3300009147 Bacteria 12752
286 Ga0114129_10015890 3300009147 Bacteria 10706
287 Ga0114129_10019049 3300009147 Bacteria 9776
288 Ga0114129_10060458 3300009147 Bacteria 5297
289 Ga0114129_10062410 3300009147 Bacteria 5206
290 Ga0114129_10080783 3300009147 Bacteria 4519
291 Ga0114129_10092112 3300009147 Bacteria 4199
292 Ga0114129_10120596 3300009147 Bacteria 3610
293 Ga0114129_10185763 3300009147 Bacteria 2825
294 Ga0114129_10209986 3300009147 Bacteria 2632
295 Ga0114129_10585018 3300009147 Bacteria 1448
296 Ga0114129_10636859 3300009147 Bacteria 1377
297 Ga0114129_10796638 3300009147 Bacteria 1206
298 Ga0105243_10551602 3300009148 Bacteria 1101
299 Ga0105243_10743242 3300009148 Bacteria 961
300 Ga0105243_11333601 3300009148 Bacteria 736
301 Ga0105242_10029642 3300009176 Bacteria 4364
302 Ga0105242_10088187 3300009176 Bacteria 2606
303 Ga0105242_10153599 3300009176 Bacteria 2009
304 Ga0105242_10197269 3300009176 Bacteria 1786
305 Ga0105242_10202315 3300009176 Bacteria 1765
306 Ga0105242_10416581 3300009176 Bacteria 1258
307 Ga0105248_10001837 3300009177 Bacteria 23524
308 Ga0105248_10045761 3300009177 Bacteria 4906
309 Ga0105248_10050086 3300009177 Bacteria 4684
310 Ga0105248_10056333 3300009177 Bacteria 4411
311 Ga0105248_10095674 3300009177 Bacteria 3343
312 Ga0105248_10128864 3300009177 Bacteria 2855
313 Ga0105248_10130099 3300009177 Bacteria 2839
314 Ga0105248_10131717 3300009177 Bacteria 2821
315 Ga0105248_10392084 3300009177 Bacteria 1563
316 Ga0105248_10764337 3300009177 Bacteria 1090
317 Ga0105248_10998874 3300009177 Bacteria 945
318 Ga0105248_11071195 3300009177 Archaea 911
319 Ga0105238_10785070 3300009551 Bacteria 967
320 Ga0105249_10312007 3300009553 Bacteria 1581
321 Ga0105249_10334039 3300009553 Bacteria 1530
322 Ga0105249_10561964 3300009553 Bacteria 1193
323 Ga0105249_11020621 3300009553 Bacteria 896
324 Ga0157374_10010912 3300013296 Bacteria 7842
325 Ga0157378_10248979 3300013297 Bacteria 1700
326 Ga0163162_10064431 3300013306 Bacteria 3710
327 Ga0163162_10106836 3300013306 Bacteria 2894
328 Ga0163162_10192941 3300013306 Bacteria 2165
329 Ga0163162_10201383 3300013306 Bacteria 2120
330 Ga0163162_11399886 3300013306 Bacteria 796
331 Ga0157372_10408852 3300013307 Bacteria 1581
332 Ga0157375_10025774 3300013308 Bacteria 5470
333 Ga0157375_10231824 3300013308 Bacteria 2005
334 Ga0157375_10401341 3300013308 Bacteria 1537
335 Ga0157375_10462713 3300013308 Bacteria 1434
336 Ga0157375_10508271 3300013308 Bacteria 1369
337 Ga0157375_11001293 3300013308 Bacteria 975
338 Ga0157375_11025535 3300013308 Bacteria 964
339 Ga0163163_10000833 3300014325 Bacteria 26251
340 Ga0163163_10162777 3300014325 Bacteria 2277
341 Ga0163163_10187607 3300014325 Bacteria 2115
342 Ga0163163_10210925 3300014325 Bacteria 1991
343 Ga0163163_10291461 3300014325 Bacteria 1684
344 Ga0163163_10677635 3300014325 Bacteria 1095
345 Ga0157380_10071890 3300014326 Bacteria 2800
346 Ga0157380_10389221 3300014326 Bacteria 1319
347 Ga0157380_10622263 3300014326 Bacteria 1072
348 Ga0157380_10672744 3300014326 Bacteria 1036
349 Ga0157377_10032358 3300014745 Bacteria 2848
350 Ga0157379_10008455 3300014968 Bacteria 8949
351 Ga0157379_10010598 3300014968 Bacteria 8034
352 Ga0157379_10023080 3300014968 Bacteria 5516
353 Ga0157379_10216925 3300014968 Bacteria 1733
354 Ga0157379_10469040 3300014968 Bacteria 1164
355 Ga0157379_11051912 3300014968 Bacteria 778
356 Ga0157376_10052324 3300014969 Bacteria 3395
357 Ga0157376_10172953 3300014969 Bacteria 1968
358 Ga0157376_10782328 3300014969 Bacteria 966
359 Ga0163161_10462060 3300017792 Bacteria 1028
360 Ga0163161_10579169 3300017792 Bacteria 923
361 Ga0163161_10593353 3300017792 Unclassified 912
362 Ga0163161_10866173 3300017792 Bacteria 763
363 Ga0206356_11728007 3300020070 Bacteria 2023
364 Ga0207653_10083691 3300025885 Bacteria 1108
365 Ga0207682_10021262 3300025893 Bacteria 2552
366 Ga0207642_10090825 3300025899 Bacteria 1508
367 Ga0207710_10017053 3300025900 Bacteria 3077
368 Ga0207710_10089417 3300025900 Bacteria 1439
369 Ga0207680_10006122 3300025903 Bacteria 5799
370 Ga0207699_10574623 3300025906 Bacteria 819
371 Ga0207645_10012309 3300025907 Bacteria 5806
372 Ga0207645_10076395 3300025907 Bacteria 2145
373 Ga0207645_10449531 3300025907 Archaea 870
374 Ga0207643_10004279 3300025908 Bacteria 7682
375 Ga0207643_10153781 3300025908 Bacteria 1380
376 Ga0207643_10252764 3300025908 Bacteria 1086
377 Ga0207643_10267542 3300025908 Bacteria 1057
378 Ga0207705_10174026 3300025909 Bacteria 1622
379 Ga0207684_10043213 3300025910 Bacteria 3820
380 Ga0207684_10335416 3300025910 Bacteria 1302
381 Ga0207654_10136257 3300025911 Bacteria 1560
382 Ga0207707_10055918 3300025912 Bacteria 3432
383 Ga0207695_10204766 3300025913 Bacteria 1886
384 Ga0207660_10109437 3300025917 Bacteria 2077
385 Ga0207662_10055598 3300025918 Bacteria 2362
386 Ga0207662_10174220 3300025918 Bacteria 1381
387 Ga0207657_10004944 3300025919 Bacteria 14023
388 Ga0207652_10336033 3300025921 Bacteria 1364
389 Ga0207646_10363188 3300025922 Bacteria 1308
390 Ga0207646_10369481 3300025922 Bacteria 1296
391 Ga0207681_10035783 3300025923 Bacteria 3273
392 Ga0207681_10039833 3300025923 Bacteria 3122
393 Ga0207681_10066214 3300025923 Bacteria 2500
394 Ga0207681_10305261 3300025923 Bacteria 1261
395 Ga0207681_10826465 3300025923 Bacteria 774
396 Ga0207694_10274675 3300025924 Bacteria 1383
397 Ga0207694_10791033 3300025924 Bacteria 801
398 Ga0207650_10119993 3300025925 Bacteria 2046
399 Ga0207650_10170138 3300025925 Bacteria 1731
400 Ga0207650_10400733 3300025925 Bacteria 1136
401 Ga0207650_10518288 3300025925 Bacteria 997
402 Ga0207659_10004251 3300025926 Bacteria 8657
403 Ga0207659_10014304 3300025926 Bacteria 5112
404 Ga0207659_10211763 3300025926 Bacteria 1554
405 Ga0207659_10451160 3300025926 Bacteria 1083
406 Ga0207687_10197398 3300025927 Bacteria 1570
407 Ga0207664_10031847 3300025929 Bacteria 4038
408 Ga0207644_10028862 3300025931 Bacteria 3845
409 Ga0207644_10079369 3300025931 Bacteria 2421
410 Ga0207644_10083519 3300025931 Bacteria 2365
411 Ga0207644_10110953 3300025931 Bacteria 2074
412 Ga0207706_10108998 3300025933 Bacteria 2437
413 Ga0207706_10353647 3300025933 Bacteria 1277
414 Ga0207686_10005798 3300025934 Bacteria 6625
415 Ga0207686_10080369 3300025934 Bacteria 2125
416 Ga0207709_10804767 3300025935 Bacteria 759
417 Ga0207670_10011613 3300025936 Bacteria 5121
418 Ga0207670_10491368 3300025936 Bacteria 995
419 Ga0207670_10679212 3300025936 Bacteria 851
420 Ga0207669_10008430 3300025937 Bacteria 4840
421 Ga0207669_10160228 3300025937 Archaea 1589
422 Ga0207669_10209430 3300025937 Bacteria 1422
423 Ga0207669_10228942 3300025937 Bacteria 1370
424 Ga0207669_10244165 3300025937 Bacteria 1333
425 Ga0207704_10580129 3300025938 Bacteria 915
426 Ga0207665_10055180 3300025939 Bacteria 2680
427 Ga0207665_10218415 3300025939 Bacteria 1396
428 Ga0207691_10008179 3300025940 Bacteria 10043
429 Ga0207691_10008807 3300025940 Bacteria 9679
430 Ga0207691_10031957 3300025940 Bacteria 4912
431 Ga0207691_10108122 3300025940 Bacteria 2475
432 Ga0207691_10109649 3300025940 Bacteria 2456
433 Ga0207691_10143772 3300025940 Bacteria 2101
434 Ga0207691_10257574 3300025940 Bacteria 1504
435 Ga0207711_10015666 3300025941 Bacteria 6287
436 Ga0207711_10024203 3300025941 Bacteria 5083
437 Ga0207711_10037003 3300025941 Bacteria 4142
438 Ga0207711_10069311 3300025941 Bacteria 3056
439 Ga0207711_10089852 3300025941 Bacteria 2699
440 Ga0207711_10179258 3300025941 Bacteria 1926
441 Ga0207711_10346430 3300025941 Bacteria 1375
442 Ga0207711_10413619 3300025941 Bacteria 1254
443 Ga0207689_10111827 3300025942 Bacteria 2245
444 Ga0207689_10379603 3300025942 Bacteria 1177
445 Ga0207689_10668166 3300025942 Bacteria 876
446 Ga0207679_10079940 3300025945 Bacteria 2495
447 Ga0207679_10186756 3300025945 Bacteria 1719
448 Ga0207667_11272537 3300025949 Bacteria 713
449 Ga0207651_10027193 3300025960 Bacteria 3589
450 Ga0207651_10105124 3300025960 Bacteria 2105
451 Ga0207712_10050712 3300025961 Bacteria 2899
452 Ga0207712_10136976 3300025961 Bacteria 1874
453 Ga0207712_10215023 3300025961 Bacteria 1533
454 Ga0207668_10112540 3300025972 Bacteria 2045
455 Ga0207668_10336159 3300025972 Bacteria 1258
456 Ga0207640_10009961 3300025981 Bacteria 5339
457 Ga0207640_10023205 3300025981 Bacteria 3726
458 Ga0207640_10292601 3300025981 Bacteria 1284
459 Ga0207658_10231975 3300025986 Bacteria 1559
460 Ga0207658_10745087 3300025986 Bacteria 887
461 Ga0207677_10049245 3300026023 Bacteria 2842
462 Ga0207677_10127401 3300026023 Bacteria 1926
463 Ga0207677_10210941 3300026023 Bacteria 1551
464 Ga0207677_10416669 3300026023 Bacteria 1143
465 Ga0207703_10015808 3300026035 Bacteria 5887
466 Ga0207703_10079618 3300026035 Bacteria 2727
467 Ga0207703_10196905 3300026035 Bacteria 1788
468 Ga0207639_10550777 3300026041 Bacteria 1059
469 Ga0207678_10107985 3300026067 Bacteria 2374
470 Ga0207678_10545597 3300026067 Bacteria 1014
471 Ga0207708_10027817 3300026075 Bacteria 4282
472 Ga0207708_10034860 3300026075 Bacteria 3828
473 Ga0207708_10152881 3300026075 Bacteria 1818
474 Ga0207708_10308828 3300026075 Bacteria 1288
475 Ga0207708_10341985 3300026075 Bacteria 1226
476 Ga0207708_10612142 3300026075 Bacteria 924
477 Ga0207641_10001800 3300026088 Bacteria 20614
478 Ga0207641_10224334 3300026088 Bacteria 1744
479 Ga0207648_10004951 3300026089 Bacteria 13553
480 Ga0207648_10210373 3300026089 Bacteria 1726
481 Ga0207648_10438823 3300026089 Bacteria 1187
482 Ga0207676_10006508 3300026095 Bacteria 8257
483 Ga0207676_10028248 3300026095 Bacteria 4189
484 Ga0207676_10032365 3300026095 Bacteria 3940
485 Ga0207676_10082446 3300026095 Bacteria 2616
486 Ga0207676_10098525 3300026095 Bacteria 2417
487 Ga0207676_10522194 3300026095 Bacteria 1130
488 Ga0207674_10037288 3300026116 Bacteria 5058
489 Ga0207675_100000786 3300026118 Bacteria 31524
490 Ga0207675_100009659 3300026118 Bacteria 9028
491 Ga0207675_100070079 3300026118 Bacteria 3277
492 Ga0207675_100103944 3300026118 Bacteria 2677
493 Ga0207675_100151049 3300026118 Bacteria 2210
494 Ga0207675_100277321 3300026118 Bacteria 1628
495 Ga0207675_100521512 3300026118 Bacteria 1185
496 Ga0207683_10017403 3300026121 Bacteria 6126
497 Ga0207683_10064648 3300026121 Bacteria 3224
498 Ga0207683_10421177 3300026121 Bacteria 1230
499 Ga0207683_10755870 3300026121 Bacteria 902
500 Ga0207698_10346396 3300026142 Bacteria 1402
501 Ga0209813_10095263 3300027866 Bacteria 1005
502 Ga0209974_10183873 3300027876 Bacteria 766
503 Ga0207428_10001903 3300027907 Bacteria 21136
504 Ga0207428_10091737 3300027907 Bacteria 2358
505 Ga0207428_10093699 3300027907 Bacteria 2329
506 Ga0207428_10411491 3300027907 Bacteria 989
507 Ga0268266_10043425 3300028379 Bacteria 3841
508 Ga0268266_10176772 3300028379 Bacteria 1941
509 Ga0268266_10268380 3300028379 Bacteria 1583
510 Ga0268265_10007577 3300028380 Bacteria 7322
511 Ga0268265_10015736 3300028380 Bacteria 5181
512 Ga0268265_10036119 3300028380 Bacteria 3617
513 Ga0268264_10179220 3300028381 Bacteria 1923
514 Ga0268264_10295604 3300028381 Bacteria 1523
515 Ga0268264_10749167 3300028381 Bacteria 973
516 Ga0268264_10799006 3300028381 Bacteria 942
517 Ga0265332_10067789 3300031238 Bacteria 1521
518 Ga0265320_10009012 3300031240 Bacteria 6050
519 Ga0265320_10213025 3300031240 Bacteria 861
520 Ga0265313_10113645 3300031595 Bacteria 1188
521 Ga0307413_10072681 3300031824 Bacteria 2172
522 Ga0307413_10468731 3300031824 Bacteria 1004
523 Ga0307416_100267081 3300032002 Bacteria 1677
524 Ga0373941_0094116 3300035115 Unclassified 1033
525 Ga0373954_0174748 3300035118 Bacteria 1053
526 Ga0373927_0592632 3300035695 Bacteria 733
527 Ga0373925_0437610 3300037068 Bacteria 1070
528 Ga0395898_0777864 3300037466 Bacteria 898
529 Ga0451807_1776763 3300041486 Bacteria 885
530 Ga0451837_1484867 3300041494 Bacteria 1007
531 Ga0439445_0123846 3300042004 Bacteria 743
532 Ga0450894_004653 3300042131 Bacteria 1781
533 Ga0450907_021812 3300042146 Bacteria 1077
534 Ga0450908_011813 3300042184 Bacteria 1592
535 Ga0439434_0135276 3300042435 Bacteria 810
536 Ga0439435_0046019 3300042436 Bacteria 1235
537 Ga0439460_0147706 3300042461 Bacteria 783
538 Ga0451577_0161664 3300042876 Bacteria 2017
539 Ga0439440_0150482 3300042993 Bacteria 666
540 Ga0453684_0195986 3300044712 Bacteria 2359
541 Ga0453684_0818913 3300044712 Unclassified 1003
542 Ga0451576_0265235 3300045051 Bacteria 1795
543 Ga0451576_0285057 3300045051 Bacteria 1727
544 Ga0451576_0503419 3300045051 Bacteria 1272
545 Ga0451576_0675950 3300045051 Bacteria 1085
546 Ga0495603_0219723 3300046455 Bacteria 1096
547 Ga0495580_0038714 3300046472 Bacteria 3414
548 Ga0495580_0381715 3300046472 Bacteria 952
549 Ga0495584_0242294 3300046491 Bacteria 917
550 Ga0495594_0031989 3300046499 Bacteria 2854
551 Ga0495663_0009141 3300046525 Bacteria 2746
552 Ga0495663_0103679 3300046525 Archaea 939
553 Ga0495642_0088995 3300046528 Bacteria 1306
554 Ga0495640_0026904 3300046533 Bacteria 4152
555 Ga0495609_0046305 3300046538 Bacteria 1948
556 Ga0495609_0067578 3300046538 Bacteria 1574
557 Ga0495621_0006598 3300046539 Bacteria 3396
558 Ga0495621_0007821 3300046539 Bacteria 3178
559 Ga0495621_0076167 3300046539 Bacteria 1244
560 Ga0495633_0109948 3300046558 Bacteria 1277
561 Ga0495659_0005698 3300046664 Bacteria 3925
562 Ga0495659_0029814 3300046664 Bacteria 1896
563 Ga0495659_0072847 3300046664 Bacteria 1290
564 Ga0495588_0002370 3300046674 Bacteria 8059
565 Ga0495647_0105287 3300046681 Unclassified 1172
566 Ga0495658_0015668 3300046683 Bacteria 3892
567 Ga0495669_0034878 3300046684 Bacteria 2219
568 Ga0495669_0044001 3300046684 Bacteria 1988
569 Ga0495669_0052850 3300046684 Bacteria 1826
570 Ga0495669_0089537 3300046684 Bacteria 1420
571 Ga0495649_0056636 3300046694 Bacteria 2116
572 Ga0495636_0067397 3300047318 Bacteria 1523
573 Ga0495636_0220089 3300047318 Bacteria 871
574 Ga0496102_0282555 3300048905 Bacteria 1564
575 Ga0496104_0045852 3300048907 Bacteria 4113
576 Ga0496108_0003082 3300048911 Bacteria 13396
577 Ga0496108_0355713 3300048911 Bacteria 1278
578 Ga0496109_0157984 3300048912 Bacteria 2124
579 Ga0496110_0230438 3300048913 Bacteria 1685
580 Ga0496112_0031471 3300048915 Bacteria 5146
581 Ga0496112_0468013 3300048915 Bacteria 1198
582 Ga0496112_0571714 3300048915 Bacteria 1063
583 Ga0496113_0013239 3300048916 Bacteria 5580
584 Ga0496114_0048711 3300048917 Bacteria 3525
585 Ga0496114_0061518 3300048917 Bacteria 3141
586 Ga0501034_0506932 3300049571 Unclassified 1120
587 Ga0501036_0016915 3300049572 Bacteria 6092
588 Ga0501038_0129868 3300049574 Bacteria 2070
589 Ga0501039_0093061 3300049575 Bacteria 2349
590 Ga0501040_0003568 3300049576 Bacteria 10063
591 Ga0501041_0003802 3300049577 Bacteria 8691
592 Ga0501042_0002362 3300049578 Bacteria 11573
593 Ga0501042_0382701 3300049578 Bacteria 1019
594 Ga0501043_0066089 3300049579 Bacteria 2840
595 Ga0501046_0009939 3300049580 Bacteria 8197
596 Ga0501047_0061582 3300049581 Bacteria 3621
597 Ga0501047_0085294 3300049581 Bacteria 3034
598 Ga0501048_0068416 3300049582 Bacteria 2508
599 Ga0501068_0035607 3300049584 Bacteria 2972
600 Ga0501071_0007644 3300049587 Bacteria 7122
601 Ga0501072_0003788 3300049588 Bacteria 11420
602 Ga0501073_0144375 3300049589 Bacteria 1649
603 Ga0501073_0214513 3300049589 Bacteria 1330
604 Ga0501074_0026414 3300049590 Bacteria 4211
605 Ga0501075_0017617 3300049591 Bacteria 5158
606 Ga0501076_0018907 3300049592 Bacteria 5257
607 Ga0501077_0024484 3300049593 Bacteria 3834
608 Ga0501079_0045667 3300049741 Bacteria 3380
609 Ga0501079_0115576 3300049741 Bacteria 2086
610 Ga0501079_0727090 3300049741 Bacteria 781
611 Ga0501080_0444180 3300049742 Bacteria 1163
612 Ga0501081_0002753 3300049743 Bacteria 11146
613 Ga0501083_0114942 3300049744 Bacteria 1767
614 Ga0501035_0084901 3300049822 Bacteria 2792
615 Ga0501044_0016902 3300049823 Bacteria 7826
616 Ga0501045_0017898 3300049824 Bacteria 5032
617 Ga0501045_0088404 3300049824 Bacteria 2289
618 nmdc:mga00v17_22672_c1 3300050491 Bacteria 3626
619 nmdc:mga0k408_12187_c1 3300050493 Bacteria 4697
620 nmdc:mga0k408_60398_c1 3300050493 Bacteria 2203
621 nmdc:mga06z11_39588_c1 3300050494 Bacteria 2347
622 nmdc:mga06z11_58052_c1 3300050494 Bacteria 2007
623 nmdc:mga06z11_77624_c1 3300050494 Bacteria 1774
624 nmdc:mga06z11_84652_c1 3300050494 Bacteria 1709
625 nmdc:mga07m45_2212_c1 3300050496 Bacteria 9080
626 nmdc:mga05p37_121048_c1 3300050507 Bacteria 3215
627 nmdc:mga05p37_152195_c1 3300050507 Bacteria 2829
628 nmdc:mga05p37_184416_c1 3300050507 Bacteria 2538
629 nmdc:mga05p37_23674_c1 3300050507 Bacteria 7455
630 nmdc:mga05p37_260148_c1 3300050507 Bacteria 786
631 nmdc:mga05p37_298585_c1 3300050507 Bacteria 1915
632 nmdc:mga05p37_3175_c1 3300050507 Bacteria 19126
633 nmdc:mga05p37_35033_c1 3300050507 Bacteria 6154
634 nmdc:mga05p37_51551_c1 3300050507 Bacteria 5060
635 nmdc:mga05p37_546085_c1 3300050507 Bacteria 1320
636 nmdc:mga05p37_86336_c1 3300050507 Bacteria 3867
637 nmdc:mga09592_101363_c1 3300050508 Bacteria 2466
638 nmdc:mga09592_173223_c1 3300050508 Bacteria 1866
639 nmdc:mga0qj67_24280_c1 3300050509 Bacteria 4673
640 nmdc:mga06r32_18974_c1 3300050510 Bacteria 6305
641 nmdc:mga06r32_69637_c1 3300050510 Bacteria 3400
642 nmdc:mga06r32_84753_c1 3300050510 Bacteria 3089
643 nmdc:mga08y16_20990_c1 3300050511 Bacteria 6895
644 nmdc:mga08y16_7834_c1 3300050511 Bacteria 11189
645 nmdc:mga08y16_892347_c1 3300050511 Bacteria 876
646 nmdc:mga08y16_912275_c1 3300050511 Unclassified 864
647 nmdc:mga08y16_9202_c1 3300050511 Bacteria 10366
648 nmdc:mga08y16_9303_c1 3300050511 Bacteria 10306
649 nmdc:mga0n895_16894_c1 3300050512 Bacteria 6711
650 nmdc:mga0n895_241934_c1 3300050512 Bacteria 1832
651 nmdc:mga0n895_37454_c1 3300050512 Bacteria 4692
652 nmdc:mga0n895_42766_c1 3300050512 Bacteria 4410
653 nmdc:mga0n895_439931_c1 3300050512 Bacteria 1317
654 nmdc:mga0n895_4698_c1 3300050512 Bacteria 11269
655 nmdc:mga0n895_681868_c1 3300050512 Bacteria 1025
656 nmdc:mga0n895_80610_c1 3300050512 Bacteria 3243
657 nmdc:mga0n895_865994_c1 3300050512 Bacteria 890
658 nmdc:mga0n895_905011_c1 3300050512 Bacteria 868
659 nmdc:mga0rr50_128954_c1 3300050513 Bacteria 2023
660 nmdc:mga0rr50_14_c1 3300050513 Bacteria 196574
661 nmdc:mga0rr50_163169_c1 3300050513 Bacteria 1810
662 nmdc:mga0rr50_309279_c1 3300050513 Archaea 1323
663 nmdc:mga0rr50_331972_c1 3300050513 Bacteria 1277
664 nmdc:mga0rr50_501203_c1 3300050513 Bacteria 1032
665 nmdc:mga0rr50_534856_c1 3300050513 Bacteria 998
666 nmdc:mga0rr50_61508_c1 3300050513 Bacteria 2829
667 nmdc:mga08x19_101555_c1 3300050514 Bacteria 1909
668 nmdc:mga08x19_151515_c1 3300050514 Bacteria 1571
669 nmdc:mga08x19_235_c1 3300050514 Bacteria 42307
670 nmdc:mga08x19_423253_c1 3300050514 Bacteria 935
671 nmdc:mga08x19_5341_c1 3300050514 Bacteria 7594
672 nmdc:mga08x19_61757_c1 3300050514 Bacteria 2429
673 nmdc:mga08x19_88635_c1 3300050514 Bacteria 2040
674 nmdc:mga0a205_110337_c1 3300050515 Bacteria 2650
675 nmdc:mga0a205_143272_c1 3300050515 Bacteria 2290
676 nmdc:mga0a205_163999_c1 3300050515 Bacteria 1807
677 nmdc:mga0a205_254933_c1 3300050515 Bacteria 1633
678 nmdc:mga0a205_26262_c1 3300050515 Bacteria 5550
679 nmdc:mga0a205_298604_c1 3300050515 Bacteria 1484
680 nmdc:mga0a205_7254_c1 3300050515 Bacteria 10025
681 nmdc:mga0a205_766874_c1 3300050515 Bacteria 813
682 Ga0501084_0024796 3300054114 Bacteria 5005
683 Ga0501082_0004795 3300060353 Bacteria 11797
684 Ga0501082_0121830 3300060353 Bacteria 2261
685 Ga0501082_0640988 3300060353 Bacteria 930
686 Ga0501082_0837465 3300060353 Bacteria 805
687 Ga0530510_0001681 3300061734 Bacteria 14973
688 Ga0530510_0241533 3300061734 Bacteria 1345
689 Ga0070707_100284546
690 Ga0065704_10001891
691 Ga0065712_10085069
692 Ga0065707_10002604
693 Ga0070658_10271015
694 Ga0070683_100387009
695 Ga0070690_100066422
696 Ga0070690_100158578
697 Ga0070690_100270116
698 Ga0070670_100085445
699 Ga0070670_100329125
700 Ga0070670_100557166
701 Ga0070670_100708123
702 Ga0068869_100210443
703 Ga0068869_100240703
704 Ga0068869_100484571
705 Ga0068869_100715768
706 Ga0070666_10261139
707 Ga0070680_100086873
708 Ga0068868_100085948
709 Ga0068868_100215023
710 Ga0068868_100217867
711 Ga0068868_100252468
712 Ga0068868_100354057
713 Ga0070660_100004035
714 Ga0070689_100422810
715 Ga0070689_100677857
716 Ga0070691_10116495
717 Ga0070687_100013393
718 Ga0070692_10123263
719 Ga0070692_10269342
720 Ga0070692_10375863
721 Ga0070668_100026134
722 Ga0070668_100793924
723 Ga0070668_100951093
724 Ga0070669_100006814
725 Ga0070669_100087484
726 Ga0070669_100172690
727 Ga0070669_100248439
728 Ga0070669_100326782
729 Ga0070675_100003305
730 Ga0070675_100005276
731 Ga0070675_100017494
732 Ga0070675_100076933
733 Ga0070675_100119971
734 Ga0070675_100251429
735 Ga0070675_100314614
736 Ga0070671_100019226
737 Ga0070671_100022846
738 Ga0070671_100159812
739 Ga0070671_100228470
740 Ga0070674_100008603
741 Ga0070674_100255240
742 Ga0070674_100257216
743 Ga0070674_100347431
744 Ga0070674_100350541
745 Ga0070674_100681641
746 Ga0070673_100074777
747 Ga0070673_100133160
748 Ga0070673_100276750
749 Ga0070673_100298851
750 Ga0070673_100327664
751 Ga0070688_100040354
752 Ga0070688_100267197
753 Ga0070688_100762569
754 Ga0070659_100069208
755 Ga0070659_100345884
756 Ga0070667_100010352
757 Ga0070667_100316458
758 Ga0070667_100621321
759 Ga0070667_100657229
760 Ga0070703_10056058
761 Ga0070709_10303554
762 Ga0070714_100003224
763 Ga0070701_10003430
764 Ga0070701_10020129
765 Ga0070701_10588905
766 Ga0070705_100013006
767 Ga0070705_100106421
768 Ga0070705_100148857
769 Ga0070705_100186469
770 Ga0070700_100014503
771 Ga0070700_100060119
772 Ga0070700_100156857
773 Ga0070694_100029157
774 Ga0070694_100076316
775 Ga0070694_100112153
776 Ga0070694_100339940
777 Ga0070694_100432419
778 Ga0070694_100526454
779 Ga0070708_100077457
780 Ga0070708_100737257
781 Ga0070663_100058858
782 Ga0070663_100109157
783 Ga0070678_100390229
784 Ga0070678_100606139
785 Ga0070678_101007219
786 Ga0070662_100102022
787 Ga0070662_100177914
788 Ga0068867_100011834
789 Ga0068867_100065483
790 Ga0070685_10583374
791 Ga0070706_100417913
792 Ga0070706_101064296
793 Ga0070707_100095750
794 Ga0070707_100150518
795 Ga0070707_100157220
796 Ga0070707_100296676
797 Ga0070707_100392839
798 Ga0070698_100004643
799 Ga0070698_100837049
800 Ga0070698_101092669
801 Ga0070699_100001254
802 Ga0070699_100015512
803 Ga0070699_100052491
804 Ga0070699_100063173
805 Ga0070699_100178851
806 Ga0070699_100193784
807 Ga0070699_100198855
808 Ga0070699_100242745
809 Ga0070679_100014905
810 Ga0070679_100434509
811 Ga0070684_100039196
812 Ga0070684_100919785
813 Ga0070697_100068616
814 Ga0070697_100236294
815 Ga0070697_100595064
816 Ga0068853_100829999
817 Ga0070672_100018677
818 Ga0070672_100067717
819 Ga0070672_100100566
820 Ga0070672_100371369
821 Ga0070672_100667755
822 Ga0070686_100000457
823 Ga0070686_100280838
824 Ga0070695_100005156
825 Ga0070695_100775141
826 Ga0070695_100789546
827 Ga0070696_100009391
828 Ga0070696_100015538
829 Ga0070696_100016371
830 Ga0070696_100396220
831 Ga0070665_100009073
832 Ga0070665_100032276
833 Ga0070704_100002987
834 Ga0070704_100020163
835 Ga0070704_100020587
836 Ga0070704_100096471
837 Ga0070704_100171289
838 Ga0070704_100204592
839 Ga0070704_100317091
840 Ga0070704_100358443
841 Ga0068855_100045666
842 Ga0068855_101456484
843 Ga0070664_100178538
844 Ga0070664_100727911
845 Ga0068857_100035369
846 Ga0068854_100031926
847 Ga0068854_100342094
848 Ga0070702_100004574
849 Ga0070702_100298059
850 Ga0070702_100518056
851 Ga0068852_100488081
852 Ga0068852_100586387
853 Ga0068859_100054352
854 Ga0068859_100242019
855 Ga0068859_100361878
856 Ga0068859_101416173
857 Ga0068859_101497190
858 Ga0068859_101505329
859 Ga0068864_100006272
860 Ga0068864_100019762
861 Ga0068864_100137526
862 Ga0068864_100212139
863 Ga0068864_100234314
864 Ga0068864_101053758
865 Ga0068866_10089074
866 Ga0068866_10794771
867 Ga0068861_100001795
868 Ga0068861_100014836
869 Ga0068861_100098951
870 Ga0068861_100170797
871 Ga0068861_100359146
872 Ga0068861_100477448
873 Ga0068851_10049116
874 Ga0068851_10514975
875 Ga0068870_10014558
876 Ga0068870_10119372
877 Ga0068870_10345025
878 Ga0068870_10422897
879 Ga0068863_100044397
880 Ga0068863_100685385
881 Ga0068863_100718643
882 Ga0068858_100010580
883 Ga0068858_100023875
884 Ga0068858_100031034
885 Ga0068858_100137655
886 Ga0068860_100433145
887 Ga0068860_101115796
888 Ga0068860_101118444
889 Ga0068860_101175823
890 Ga0068862_100043296
891 Ga0068862_100058133
892 Ga0068862_100110655
893 Ga0068862_100534379
894 Ga0068862_100641020
895 Ga0068862_100835184
896 Ga0068862_101191849
897 Ga0081455_10108513
898 Ga0075364_10406018
899 Ga0075367_10017798
900 Ga0075367_10100378
901 Ga0075366_10007068
902 Ga0097621_100490976
903 Ga0068871_100018640
904 Ga0068871_100115933
905 Ga0068871_100181664
906 Ga0068871_100238307
907 Ga0068871_100305968
908 Ga0068871_100414971
909 Ga0068871_100825135
910 Ga0075428_100155257
911 Ga0075430_100002671
912 Ga0075430_100387614
913 Ga0075431_100130976
914 Ga0075431_100159227
915 Ga0075431_100255626
916 Ga0075433_10065508
917 Ga0075433_10093758
918 Ga0075433_10112505
919 Ga0075433_10379167
920 Ga0075433_11001377
921 Ga0075434_100010611
922 Ga0075434_100019263
923 Ga0075434_100021361
924 Ga0075434_100031445
925 Ga0075434_100044979
926 Ga0075434_100169417
927 Ga0075434_100360035
928 Ga0075434_100473131
929 Ga0075434_100724674
930 Ga0075434_100815634
931 Ga0075429_100285304
932 Ga0075429_101269916
933 Ga0068865_100001659
934 Ga0068865_100048103
935 Ga0075436_100000928
936 Ga0075436_100033743
937 Ga0075436_100143243
938 Ga0075436_100894035
939 Ga0097620_100054349
940 Ga0097620_100242022
941 Ga0097620_100361885
942 Ga0097620_101416246
943 Ga0097620_101497317
944 Ga0097620_101505281
945 Ga0075435_100000216
946 Ga0075435_100001206
947 Ga0075435_100012646
948 Ga0075435_100077783
949 Ga0075435_100079682
950 Ga0075435_100091465
951 Ga0075435_100148649
952 Ga0075435_100180464
953 Ga0075435_100184257
954 Ga0105240_10003280
955 Ga0105240_10271481
956 Ga0105240_10480408
957 Ga0105240_10637285
958 Ga0111539_10027424
959 Ga0111539_10028637
960 Ga0111539_10030533
961 Ga0111539_10046916
962 Ga0111539_10192247
963 Ga0111539_10437539
964 Ga0111539_11428261
965 Ga0105245_10045308
966 Ga0105245_10056388
967 Ga0105245_10422837
968 Ga0105245_11084891
969 Ga0105247_10034269
970 Ga0105247_10188537
971 Ga0114129_10000239
972 Ga0114129_10000872
973 Ga0114129_10011257
974 Ga0114129_10015890
975 Ga0114129_10019049
976 Ga0114129_10060458
977 Ga0114129_10062410
978 Ga0114129_10080783
979 Ga0114129_10092112
980 Ga0114129_10120596
981 Ga0114129_10185763
982 Ga0114129_10209986
983 Ga0114129_10585018
984 Ga0114129_10636859
985 Ga0114129_10796638
986 Ga0105243_10551602
987 Ga0105243_10743242
988 Ga0105243_11333601
989 Ga0105242_10029642
990 Ga0105242_10088187
991 Ga0105242_10153599
992 Ga0105242_10197269
993 Ga0105242_10202315
994 Ga0105242_10416581
995 Ga0105248_10001837
996 Ga0105248_10045761
997 Ga0105248_10050086
998 Ga0105248_10056333
999 Ga0105248_10095674
1000 Ga0105248_10128864
1001 Ga0105248_10130099
1002 Ga0105248_10131717
1003 Ga0105248_10392084
1004 Ga0105248_10764337
1005 Ga0105248_10998874
1006 Ga0105248_11071195
1007 Ga0105238_10785070
1008 Ga0105249_10312007
1009 Ga0105249_10334039
1010 Ga0105249_10561964
1011 Ga0105249_11020621
1012 Ga0157374_10010912
1013 Ga0157378_10248979
1014 Ga0163162_10064431
1015 Ga0163162_10106836
1016 Ga0163162_10192941
1017 Ga0163162_10201383
1018 Ga0163162_11399886
1019 Ga0157372_10408852
1020 Ga0157375_10025774
1021 Ga0157375_10231824
1022 Ga0157375_10401341
1023 Ga0157375_10462713
1024 Ga0157375_10508271
1025 Ga0157375_11001293
1026 Ga0157375_11025535
1027 Ga0163163_10000833
1028 Ga0163163_10162777
1029 Ga0163163_10187607
1030 Ga0163163_10210925
1031 Ga0163163_10291461
1032 Ga0163163_10677635
1033 Ga0157380_10071890
1034 Ga0157380_10389221
1035 Ga0157380_10622263
1036 Ga0157380_10672744
1037 Ga0157377_10032358
1038 Ga0157379_10008455
1039 Ga0157379_10010598
1040 Ga0157379_10023080
1041 Ga0157379_10216925
1042 Ga0157379_10469040
1043 Ga0157379_11051912
1044 Ga0157376_10052324
1045 Ga0157376_10172953
1046 Ga0157376_10782328
1047 Ga0163161_10462060
1048 Ga0163161_10579169
1049 Ga0163161_10593353
1050 Ga0163161_10866173
1051 Ga0206356_11728007
1052 Ga0207653_10083691
1053 Ga0207682_10021262
1054 Ga0207642_10090825
1055 Ga0207710_10017053
1056 Ga0207710_10089417
1057 Ga0207680_10006122
1058 Ga0207699_10574623
1059 Ga0207645_10012309
1060 Ga0207645_10076395
1061 Ga0207645_10449531
1062 Ga0207643_10004279
1063 Ga0207643_10153781
1064 Ga0207643_10252764
1065 Ga0207643_10267542
1066 Ga0207705_10174026
1067 Ga0207684_10043213
1068 Ga0207684_10335416
1069 Ga0207654_10136257
1070 Ga0207707_10055918
1071 Ga0207695_10204766
1072 Ga0207660_10109437
1073 Ga0207662_10055598
1074 Ga0207662_10174220
1075 Ga0207657_10004944
1076 Ga0207652_10336033
1077 Ga0207646_10363188
1078 Ga0207646_10369481
1079 Ga0207681_10035783
1080 Ga0207681_10039833
1081 Ga0207681_10066214
1082 Ga0207681_10305261
1083 Ga0207681_10826465
1084 Ga0207694_10274675
1085 Ga0207694_10791033
1086 Ga0207650_10119993
1087 Ga0207650_10170138
1088 Ga0207650_10400733
1089 Ga0207650_10518288
1090 Ga0207659_10004251
1091 Ga0207659_10014304
1092 Ga0207659_10211763
1093 Ga0207659_10451160
1094 Ga0207687_10197398
1095 Ga0207664_10031847
1096 Ga0207644_10028862
1097 Ga0207644_10079369
1098 Ga0207644_10083519
1099 Ga0207644_10110953
1100 Ga0207706_10108998
1101 Ga0207706_10353647
1102 Ga0207686_10005798
1103 Ga0207686_10080369
1104 Ga0207709_10804767
1105 Ga0207670_10011613
1106 Ga0207670_10491368
1107 Ga0207670_10679212
1108 Ga0207669_10008430
1109 Ga0207669_10160228
1110 Ga0207669_10209430
1111 Ga0207669_10228942
1112 Ga0207669_10244165
1113 Ga0207704_10580129
1114 Ga0207665_10055180
1115 Ga0207665_10218415
1116 Ga0207691_10008179
1117 Ga0207691_10008807
1118 Ga0207691_10031957
1119 Ga0207691_10108122
1120 Ga0207691_10109649
1121 Ga0207691_10143772
1122 Ga0207691_10257574
1123 Ga0207711_10015666
1124 Ga0207711_10024203
1125 Ga0207711_10037003
1126 Ga0207711_10069311
1127 Ga0207711_10089852
1128 Ga0207711_10179258
1129 Ga0207711_10346430
1130 Ga0207711_10413619
1131 Ga0207689_10111827
1132 Ga0207689_10379603
1133 Ga0207689_10668166
1134 Ga0207679_10079940
1135 Ga0207679_10186756
1136 Ga0207667_11272537
1137 Ga0207651_10027193
1138 Ga0207651_10105124
1139 Ga0207712_10050712
1140 Ga0207712_10136976
1141 Ga0207712_10215023
1142 Ga0207668_10112540
1143 Ga0207668_10336159
1144 Ga0207640_10009961
1145 Ga0207640_10023205
1146 Ga0207640_10292601
1147 Ga0207658_10231975
1148 Ga0207658_10745087
1149 Ga0207677_10049245
1150 Ga0207677_10127401
1151 Ga0207677_10210941
1152 Ga0207677_10416669
1153 Ga0207703_10015808
1154 Ga0207703_10079618
1155 Ga0207703_10196905
1156 Ga0207639_10550777
1157 Ga0207678_10107985
1158 Ga0207678_10545597
1159 Ga0207708_10027817
1160 Ga0207708_10034860
1161 Ga0207708_10152881
1162 Ga0207708_10308828
1163 Ga0207708_10341985
1164 Ga0207708_10612142
1165 Ga0207641_10001800
1166 Ga0207641_10224334
1167 Ga0207648_10004951
1168 Ga0207648_10210373
1169 Ga0207648_10438823
1170 Ga0207676_10006508
1171 Ga0207676_10028248
1172 Ga0207676_10032365
1173 Ga0207676_10082446
1174 Ga0207676_10098525
1175 Ga0207676_10522194
1176 Ga0207674_10037288
1177 Ga0207675_100000786
1178 Ga0207675_100009659
1179 Ga0207675_100070079
1180 Ga0207675_100103944
1181 Ga0207675_100151049
1182 Ga0207675_100277321
1183 Ga0207675_100521512
1184 Ga0207683_10017403
1185 Ga0207683_10064648
1186 Ga0207683_10421177
1187 Ga0207683_10755870
1188 Ga0207698_10346396
1189 Ga0209813_10095263
1190 Ga0209974_10183873
1191 Ga0207428_10001903
1192 Ga0207428_10091737
1193 Ga0207428_10093699
1194 Ga0207428_10411491
1195 Ga0268266_10043425
1196 Ga0268266_10176772
1197 Ga0268266_10268380
1198 Ga0268265_10007577
1199 Ga0268265_10015736
1200 Ga0268265_10036119
1201 Ga0268264_10179220
1202 Ga0268264_10295604
1203 Ga0268264_10749167
1204 Ga0268264_10799006
1205 Ga0265332_10067789
1206 Ga0265320_10009012
1207 Ga0265320_10213025
1208 Ga0265313_10113645
1209 Ga0307413_10072681
1210 Ga0307413_10468731
1211 Ga0307416_100267081
1212 Ga0373941_0094116
1213 Ga0373954_0174748
1214 Ga0373927_0592632
1215 Ga0373925_0437610
1216 Ga0395898_0777864
1217 Ga0451807_1776763
1218 Ga0451837_1484867
1219 Ga0439445_0123846
1220 Ga0450894_004653
1221 Ga0450907_021812
1222 Ga0450908_011813
1223 Ga0439434_0135276
1224 Ga0439435_0046019
1225 Ga0439460_0147706
1226 Ga0451577_0161664
1227 Ga0439440_0150482
1228 Ga0453684_0195986
1229 Ga0453684_0818913
1230 Ga0451576_0265235
1231 Ga0451576_0285057
1232 Ga0451576_0503419
1233 Ga0451576_0675950
1234 Ga0495603_0219723
1235 Ga0495580_0038714
1236 Ga0495580_0381715
1237 Ga0495584_0242294
1238 Ga0495594_0031989
1239 Ga0495663_0009141
1240 Ga0495663_0103679
1241 Ga0495642_0088995
1242 Ga0495640_0026904
1243 Ga0495609_0046305
1244 Ga0495609_0067578
1245 Ga0495621_0006598
1246 Ga0495621_0007821
1247 Ga0495621_0076167
1248 Ga0495633_0109948
1249 Ga0495659_0005698
1250 Ga0495659_0029814
1251 Ga0495659_0072847
1252 Ga0495588_0002370
1253 Ga0495647_0105287
1254 Ga0495658_0015668
1255 Ga0495669_0034878
1256 Ga0495669_0044001
1257 Ga0495669_0052850
1258 Ga0495669_0089537
1259 Ga0495649_0056636
1260 Ga0495636_0067397
1261 Ga0495636_0220089
1262 Ga0496102_0282555
1263 Ga0496104_0045852
1264 Ga0496108_0003082
1265 Ga0496108_0355713
1266 Ga0496109_0157984
1267 Ga0496110_0230438
1268 Ga0496112_0031471
1269 Ga0496112_0468013
1270 Ga0496112_0571714
1271 Ga0496113_0013239
1272 Ga0496114_0048711
1273 Ga0496114_0061518
1274 Ga0501034_0506932
1275 Ga0501036_0016915
1276 Ga0501038_0129868
1277 Ga0501039_0093061
1278 Ga0501040_0003568
1279 Ga0501041_0003802
1280 Ga0501042_0002362
1281 Ga0501042_0382701
1282 Ga0501043_0066089
1283 Ga0501046_0009939
1284 Ga0501047_0061582
1285 Ga0501047_0085294
1286 Ga0501048_0068416
1287 Ga0501068_0035607
1288 Ga0501071_0007644
1289 Ga0501072_0003788
1290 Ga0501073_0144375
1291 Ga0501073_0214513
1292 Ga0501074_0026414
1293 Ga0501075_0017617
1294 Ga0501076_0018907
1295 Ga0501077_0024484
1296 Ga0501079_0045667
1297 Ga0501079_0115576
1298 Ga0501079_0727090
1299 Ga0501080_0444180
1300 Ga0501081_0002753
1301 Ga0501083_0114942
1302 Ga0501035_0084901
1303 Ga0501044_0016902
1304 Ga0501045_0017898
1305 Ga0501045_0088404
1306 nmdc:mga00v17_22672_c1
1307 nmdc:mga0k408_12187_c1
1308 nmdc:mga0k408_60398_c1
1309 nmdc:mga06z11_39588_c1
1310 nmdc:mga06z11_58052_c1
1311 nmdc:mga06z11_77624_c1
1312 nmdc:mga06z11_84652_c1
1313 nmdc:mga07m45_2212_c1
1314 nmdc:mga05p37_121048_c1
1315 nmdc:mga05p37_152195_c1
1316 nmdc:mga05p37_184416_c1
1317 nmdc:mga05p37_23674_c1
1318 nmdc:mga05p37_260148_c1
1319 nmdc:mga05p37_298585_c1
1320 nmdc:mga05p37_3175_c1
1321 nmdc:mga05p37_35033_c1
1322 nmdc:mga05p37_51551_c1
1323 nmdc:mga05p37_546085_c1
1324 nmdc:mga05p37_86336_c1
1325 nmdc:mga09592_101363_c1
1326 nmdc:mga09592_173223_c1
1327 nmdc:mga0qj67_24280_c1
1328 nmdc:mga06r32_18974_c1
1329 nmdc:mga06r32_69637_c1
1330 nmdc:mga06r32_84753_c1
1331 nmdc:mga08y16_20990_c1
1332 nmdc:mga08y16_7834_c1
1333 nmdc:mga08y16_892347_c1
1334 nmdc:mga08y16_912275_c1
1335 nmdc:mga08y16_9202_c1
1336 nmdc:mga08y16_9303_c1
1337 nmdc:mga0n895_16894_c1
1338 nmdc:mga0n895_241934_c1
1339 nmdc:mga0n895_37454_c1
1340 nmdc:mga0n895_42766_c1
1341 nmdc:mga0n895_439931_c1
1342 nmdc:mga0n895_4698_c1
1343 nmdc:mga0n895_681868_c1
1344 nmdc:mga0n895_80610_c1
1345 nmdc:mga0n895_865994_c1
1346 nmdc:mga0n895_905011_c1
1347 nmdc:mga0rr50_128954_c1
1348 nmdc:mga0rr50_14_c1
1349 nmdc:mga0rr50_163169_c1
1350 nmdc:mga0rr50_309279_c1
1351 nmdc:mga0rr50_331972_c1
1352 nmdc:mga0rr50_501203_c1
1353 nmdc:mga0rr50_534856_c1
1354 nmdc:mga0rr50_61508_c1
1355 nmdc:mga08x19_101555_c1
1356 nmdc:mga08x19_151515_c1
1357 nmdc:mga08x19_235_c1
1358 nmdc:mga08x19_423253_c1
1359 nmdc:mga08x19_5341_c1
1360 nmdc:mga08x19_61757_c1
1361 nmdc:mga08x19_88635_c1
1362 nmdc:mga0a205_110337_c1
1363 nmdc:mga0a205_143272_c1
1364 nmdc:mga0a205_163999_c1
1365 nmdc:mga0a205_254933_c1
1366 nmdc:mga0a205_26262_c1
1367 nmdc:mga0a205_298604_c1
1368 nmdc:mga0a205_7254_c1
1369 nmdc:mga0a205_766874_c1
1370 Ga0501084_0024796
1371 Ga0501082_0004795
1372 Ga0501082_0121830
1373 Ga0501082_0640988
1374 Ga0501082_0837465
1375 Ga0530510_0001681
1376 Ga0530510_0241533

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00694

Aconitase_C

Aconitase C-terminal domain

35

145

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3h5e-assembly2.cif.gz_B leud_1-156 small subunit of isopropylmalate isomerase (rv2987c) from mycobacterium tuberculosis 0.939 6 162
3h5e-assembly2.cif.gz_B leud_1-156 small subunit of isopropylmalate isomerase (rv2987c) from mycobacterium tuberculosis 0.9331 6 162
3h5j-assembly1.cif.gz_A leud_1-168 small subunit of isopropylmalate isomerase (rv2987c) from mycobacterium tuberculosis 0.9044 3 173
2hcu-assembly1.cif.gz_A crystal structure of smu.1381 (or leud) from streptococcus mutans 0.8903 2 173
3q3w-assembly1.cif.gz_A isopropylmalate isomerase small subunit from campylobacter jejuni. 0.89 2 173
ID Description Score Start End Superfamily
3h5jA00 Alpha Beta;Alpha-Beta Barrel;Aconitase; domain 4;Aconitase, domain 4 0.9044 3 173 3.20.19.10
3h5jA00 Alpha Beta;Alpha-Beta Barrel;Aconitase; domain 4;Aconitase, domain 4 0.8891 3 173 3.20.19.10
3q3wA00 Alpha Beta;Alpha-Beta Barrel;Aconitase; domain 4;Aconitase, domain 4 0.8862 3 173 3.20.19.10
af_Q2FWK0_1_171_3.20.19.10 Alpha Beta;Alpha-Beta Barrel;Aconitase; domain 4;Aconitase, domain 4 0.8857 3 173 3.20.19.10
af_O14289_535_712_3.20.19.10 Alpha Beta;Alpha-Beta Barrel;Aconitase; domain 4;Aconitase, domain 4 0.8805 1 173 3.20.19.10
ID Description Score Start End GO Terms
AF-A0A521T9Y2-F1-model_v4 3-isopropylmalate dehydratase (EC 4.2.1.33) 0.9859 1 197 GO:0003861
GO:0009098
GO:0009316
AF-A0A2M8PKQ9-F1-model_v4 3-isopropylmalate dehydratase (EC 4.2.1.33) 0.9852 9 167 GO:0009098
GO:0016829
GO:0016853
AF-A0A2V6TEP6-F1-model_v4 3-isopropylmalate dehydratase (EC 4.2.1.33) 0.9846 11 139 GO:0009098
GO:0016829
GO:0016853
AF-A0A1Z4QYL1-F1-model_v4 3-isopropylmalate dehydratase small subunit (EC 4.2.1.33) (Alpha-IPM isomerase) (IPMI) (Isopropylmalate isomerase) 0.9816 5 200 GO:0003861
GO:0009098
GO:0009316
GO:0016853
AF-A0A383BKD3-F1-model_v4 Aconitase A/isopropylmalate dehydratase small subunit swivel domain-containing protein 0.9814 1 145 GO:0008652
GO:0016829

Map