F475272

General Info

Members Datasets Scaffolds Average Seq Length
687 227 1374 160

Family's Representative Sequence

Representative Sequence 3300044658|Ga0466972_0073628|Ga0466972_0073628_236_793
Length 185
Sequence VSVAEAAHRPARTGRAAALWIAFLVVIAAGVGLAWAGAGALRPEVTSSGLQFRTIKAGKGEVIHQDDAAMIDYIGTLDDGTVFDTSQNHGGAQPFTMGAVFPGFAEAMARMQEGGRYRFTMPPRLAFGNKPPPQGFPANSNLTFEVQVQKVVRGGAALMGAGPAPQQPPQGDQSMPPEQMEQMAH

Samples

Sample ID Description Type Environment
1 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
87 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
135 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
136 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
137 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
138 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
139 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
140 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
141 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
142 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
143 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
144 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
145 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
146 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
147 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
148 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
149 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
150 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
151 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
152 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
153 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
154 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
155 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
156 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
157 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
158 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
159 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
160 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
161 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
162 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
163 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
164 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
165 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
166 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
167 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
168 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
169 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
170 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
171 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
172 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
173 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
174 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
175 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
176 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
177 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
178 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
179 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
180 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
181 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
182 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
183 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
184 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
185 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
186 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
187 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
188 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
189 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
190 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
191 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
192 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
193 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
194 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
195 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
196 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
197 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
198 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
199 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
200 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
201 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
202 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
203 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
204 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
205 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
206 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
207 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
208 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
209 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
210 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
211 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
212 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
213 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
214 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
215 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
216 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
217 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
218 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
219 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
220 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
221 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
224 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
225 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
226 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
227 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.4
Metatranscriptomes 1.6
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.15
Nodule 0
Rhizoplane 4.95
Rhizosphere 94.32
Stem 0
Stem Tuber 0
Unclassified 1.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466972_0073628 3300044658 Bacteria 1628
2 JGI24736J21556_1011162 3300001904 Bacteria 1464
3 JGI24740J21852_10011466 3300001979 Bacteria 3372
4 JGI24740J21852_10027078 3300001979 Bacteria 1912
5 JGI24740J21852_10032137 3300001979 Bacteria 1682
6 JGI24739J22299_10006645 3300001989 Bacteria 4354
7 JGI24737J22298_10005144 3300001990 Bacteria 4528
8 JGI24735J21928_10004145 3300002067 Bacteria 4895
9 JGI24735J21928_10018977 3300002067 Bacteria 2118
10 rootH2_10095679 3300003320 Bacteria 1437
11 rootH1_10146668 3300003323 Bacteria 1574
12 Ga0070658_10014069 3300005327 Bacteria 6425
13 Ga0070658_10095418 3300005327 Bacteria 2455
14 Ga0070658_10115125 3300005327 Bacteria 2230
15 Ga0070658_10190689 3300005327 Bacteria 1727
16 Ga0070658_10382658 3300005327 Bacteria 1207
17 Ga0070658_10453259 3300005327 Bacteria 1105
18 Ga0070658_10457148 3300005327 Bacteria 1100
19 Ga0070658_10475136 3300005327 Bacteria 1078
20 Ga0070658_10603367 3300005327 Bacteria 951
21 Ga0070676_10396100 3300005328 Bacteria 960
22 Ga0070683_100009832 3300005329 Bacteria 8195
23 Ga0070683_100014717 3300005329 Bacteria 6852
24 Ga0070683_100034868 3300005329 Bacteria 4599
25 Ga0070683_100093133 3300005329 Bacteria 2830
26 Ga0070683_100430693 3300005329 Bacteria 1258
27 Ga0070683_100788728 3300005329 Bacteria 911
28 Ga0070690_100208589 3300005330 Bacteria 1363
29 Ga0070690_100604591 3300005330 Bacteria 833
30 Ga0070670_100037964 3300005331 Bacteria 4142
31 Ga0070670_100140991 3300005331 Bacteria 2084
32 Ga0070670_100309142 3300005331 Bacteria 1383
33 Ga0070677_10359569 3300005333 Unclassified 756
34 Ga0068869_100646279 3300005334 Bacteria 897
35 Ga0070666_10002971 3300005335 Bacteria 10286
36 Ga0070666_10053690 3300005335 Bacteria 2718
37 Ga0070666_10241481 3300005335 Bacteria 1277
38 Ga0070680_100001257 3300005336 Bacteria 18304
39 Ga0070680_100145622 3300005336 Bacteria 1987
40 Ga0070680_100233016 3300005336 Bacteria 1555
41 Ga0070680_100341447 3300005336 Bacteria 1272
42 Ga0070682_100062528 3300005337 Bacteria 2358
43 Ga0070682_100240793 3300005337 Bacteria 1298
44 Ga0070682_100297181 3300005337 Bacteria 1183
45 Ga0070682_100590144 3300005337 Bacteria 875
46 Ga0070682_100676506 3300005337 Bacteria 825
47 Ga0068868_100012920 3300005338 Bacteria 6109
48 Ga0068868_100074382 3300005338 Bacteria 2713
49 Ga0068868_100335976 3300005338 Bacteria 1291
50 Ga0070660_100029369 3300005339 Bacteria 4120
51 Ga0070660_100036347 3300005339 Bacteria 3730
52 Ga0070660_100046930 3300005339 Bacteria 3312
53 Ga0070660_100057029 3300005339 Bacteria 3024
54 Ga0070660_100060814 3300005339 Bacteria 2932
55 Ga0070660_100082500 3300005339 Bacteria 2524
56 Ga0070660_100192238 3300005339 Bacteria 1653
57 Ga0070660_100599932 3300005339 Bacteria 921
58 Ga0070660_100777800 3300005339 Bacteria 804
59 Ga0070660_100860822 3300005339 Bacteria 763
60 Ga0070660_100864870 3300005339 Bacteria 762
61 Ga0070691_10003582 3300005341 Bacteria 7010
62 Ga0070661_100033437 3300005344 Bacteria 3724
63 Ga0070661_100057595 3300005344 Bacteria 2847
64 Ga0070661_100115944 3300005344 Bacteria 2003
65 Ga0070661_100119212 3300005344 Bacteria 1975
66 Ga0070661_100125604 3300005344 Bacteria 1924
67 Ga0070661_100132596 3300005344 Bacteria 1872
68 Ga0070661_100255546 3300005344 Bacteria 1353
69 Ga0070661_100425149 3300005344 Bacteria 1053
70 Ga0070661_100430133 3300005344 Bacteria 1047
71 Ga0070661_100663233 3300005344 Bacteria 847
72 Ga0070661_100765250 3300005344 Bacteria 790
73 Ga0070692_10006534 3300005345 Bacteria 5069
74 Ga0070692_10013273 3300005345 Bacteria 3836
75 Ga0070692_10072159 3300005345 Bacteria 1841
76 Ga0070692_10107622 3300005345 Bacteria 1537
77 Ga0070675_100222134 3300005354 Bacteria 1645
78 Ga0070675_100354570 3300005354 Bacteria 1301
79 Ga0070671_100024137 3300005355 Bacteria 4977
80 Ga0070671_100079772 3300005355 Bacteria 2736
81 Ga0070671_100223230 3300005355 Bacteria 1598
82 Ga0070671_100479706 3300005355 Bacteria 1068
83 Ga0070674_100198542 3300005356 Bacteria 1547
84 Ga0070674_100218520 3300005356 Bacteria 1481
85 Ga0070674_100263739 3300005356 Bacteria 1358
86 Ga0070674_100402675 3300005356 Bacteria 1118
87 Ga0070673_100000526 3300005364 Bacteria 20563
88 Ga0070673_100075965 3300005364 Bacteria 2711
89 Ga0070673_100230514 3300005364 Bacteria 1606
90 Ga0070673_100895869 3300005364 Bacteria 822
91 Ga0070659_100033445 3300005366 Bacteria 3993
92 Ga0070659_100033606 3300005366 Bacteria 3984
93 Ga0070659_100045336 3300005366 Bacteria 3444
94 Ga0070659_100083906 3300005366 Bacteria 2547
95 Ga0070659_100381841 3300005366 Bacteria 1187
96 Ga0070659_100420236 3300005366 Bacteria 1131
97 Ga0070659_100443303 3300005366 Bacteria 1100
98 Ga0070659_100475719 3300005366 Bacteria 1062
99 Ga0070659_100775901 3300005366 Bacteria 832
100 Ga0070659_100897391 3300005366 Bacteria 774
101 Ga0070667_100013712 3300005367 Bacteria 6698
102 Ga0070667_100053826 3300005367 Bacteria 3397
103 Ga0070667_100056858 3300005367 Bacteria 3305
104 Ga0070667_100405460 3300005367 Bacteria 1241
105 Ga0070714_100224928 3300005435 Bacteria 1726
106 Ga0070714_100450504 3300005435 Bacteria 1222
107 Ga0070714_100715804 3300005435 Bacteria 966
108 Ga0070714_100754447 3300005435 Bacteria 941
109 Ga0070714_101482018 3300005435 Bacteria 663
110 Ga0070713_100604964 3300005436 Unclassified 1042
111 Ga0070663_100025115 3300005455 Bacteria 4020
112 Ga0070663_100053289 3300005455 Bacteria 2887
113 Ga0070663_100078053 3300005455 Bacteria 2426
114 Ga0070663_100397770 3300005455 Bacteria 1125
115 Ga0070663_100720413 3300005455 Bacteria 849
116 Ga0070678_100026409 3300005456 Bacteria 3925
117 Ga0070678_100031044 3300005456 Bacteria 3680
118 Ga0070678_100185955 3300005456 Bacteria 1705
119 Ga0070662_100028447 3300005457 Bacteria 3889
120 Ga0070662_100031341 3300005457 Bacteria 3731
121 Ga0070662_100359996 3300005457 Bacteria 1193
122 Ga0070662_100689245 3300005457 Bacteria 864
123 Ga0070681_10074936 3300005458 Bacteria 3344
124 Ga0070681_10135295 3300005458 Bacteria 2395
125 Ga0070681_10190802 3300005458 Bacteria 1968
126 Ga0070681_10421602 3300005458 Bacteria 1246
127 Ga0070681_10956825 3300005458 Bacteria 775
128 Ga0068867_100173257 3300005459 Bacteria 1710
129 Ga0068867_100224100 3300005459 Bacteria 1517
130 Ga0070685_10175839 3300005466 Bacteria 1374
131 Ga0070679_100038807 3300005530 Bacteria 4735
132 Ga0070679_100089715 3300005530 Bacteria 3061
133 Ga0070679_100624713 3300005530 Bacteria 1020
134 Ga0070679_101081056 3300005530 Bacteria 747
135 Ga0070684_100002671 3300005535 Bacteria 13167
136 Ga0070684_100034298 3300005535 Bacteria 4338
137 Ga0070684_100043830 3300005535 Bacteria 3865
138 Ga0070684_100131444 3300005535 Bacteria 2258
139 Ga0070684_100958225 3300005535 Bacteria 802
140 Ga0068853_100041268 3300005539 Bacteria 3940
141 Ga0068853_100043066 3300005539 Bacteria 3862
142 Ga0068853_100136876 3300005539 Bacteria 2196
143 Ga0068853_100182314 3300005539 Bacteria 1904
144 Ga0068853_100430520 3300005539 Bacteria 1238
145 Ga0068853_100468473 3300005539 Bacteria 1186
146 Ga0068853_101021086 3300005539 Bacteria 796
147 Ga0070672_100047900 3300005543 Bacteria 3318
148 Ga0070672_100363492 3300005543 Bacteria 1235
149 Ga0070672_100387372 3300005543 Bacteria 1196
150 Ga0070672_100563974 3300005543 Bacteria 989
151 Ga0070672_101433130 3300005543 Bacteria 618
152 Ga0070686_100608762 3300005544 Bacteria 862
153 Ga0070686_100744368 3300005544 Bacteria 786
154 Ga0070665_100040150 3300005548 Bacteria 4704
155 Ga0070665_100659351 3300005548 Bacteria 1059
156 Ga0068855_100025356 3300005563 Bacteria 7095
157 Ga0068855_100112774 3300005563 Bacteria 3120
158 Ga0068855_100115015 3300005563 Bacteria 3084
159 Ga0068855_100136178 3300005563 Bacteria 2802
160 Ga0068855_100394981 3300005563 Bacteria 1516
161 Ga0068855_100725812 3300005563 Bacteria 1061
162 Ga0070664_100006591 3300005564 Bacteria 9361
163 Ga0070664_100055897 3300005564 Bacteria 3353
164 Ga0070664_100113509 3300005564 Bacteria 2366
165 Ga0070664_100336421 3300005564 Bacteria 1370
166 Ga0070664_100349063 3300005564 Bacteria 1345
167 Ga0070664_100816447 3300005564 Bacteria 872
168 Ga0070664_100821839 3300005564 Bacteria 869
169 Ga0070664_101036703 3300005564 Bacteria 771
170 Ga0068857_100031248 3300005577 Bacteria 4705
171 Ga0068857_100039427 3300005577 Bacteria 4184
172 Ga0068857_100200012 3300005577 Bacteria 1821
173 Ga0068857_101122619 3300005577 Bacteria 760
174 Ga0068854_100033977 3300005578 Bacteria 3558
175 Ga0068854_100083539 3300005578 Bacteria 2361
176 Ga0068854_100106600 3300005578 Bacteria 2108
177 Ga0068854_100557858 3300005578 Bacteria 972
178 Ga0068856_100008253 3300005614 Bacteria 10152
179 Ga0068856_100251514 3300005614 Bacteria 1782
180 Ga0068856_100274052 3300005614 Bacteria 1703
181 Ga0068856_100900673 3300005614 Archaea 903
182 Ga0068856_100976439 3300005614 Bacteria 865
183 Ga0068856_101130044 3300005614 Bacteria 800
184 Ga0068856_101393909 3300005614 Bacteria 715
185 Ga0068852_100013451 3300005616 Bacteria 6265
186 Ga0068852_100030542 3300005616 Bacteria 4437
187 Ga0068852_100031074 3300005616 Bacteria 4402
188 Ga0068852_100125836 3300005616 Bacteria 2353
189 Ga0068852_100187856 3300005616 Bacteria 1947
190 Ga0068852_100221775 3300005616 Bacteria 1798
191 Ga0068852_100244841 3300005616 Bacteria 1715
192 Ga0068852_100279679 3300005616 Bacteria 1608
193 Ga0068852_100445873 3300005616 Bacteria 1280
194 Ga0068852_100812574 3300005616 Bacteria 949
195 Ga0068852_101128342 3300005616 Bacteria 804
196 Ga0068852_101629976 3300005616 Bacteria 668
197 Ga0068859_100221584 3300005617 Bacteria 1979
198 Ga0068859_100437124 3300005617 Bacteria 1404
199 Ga0068859_100914628 3300005617 Bacteria 962
200 Ga0068864_100038826 3300005618 Bacteria 4067
201 Ga0068864_100758205 3300005618 Bacteria 951
202 Ga0068866_10061662 3300005718 Bacteria 1948
203 Ga0068851_10008280 3300005834 Bacteria 4802
204 Ga0068851_10013866 3300005834 Bacteria 3818
205 Ga0068851_10283083 3300005834 Bacteria 949
206 Ga0068851_10314946 3300005834 Bacteria 903
207 Ga0068851_10383426 3300005834 Bacteria 824
208 Ga0068863_100145598 3300005841 Bacteria 2266
209 Ga0068858_100013510 3300005842 Bacteria 7704
210 Ga0068858_100019414 3300005842 Bacteria 6356
211 Ga0068858_100069226 3300005842 Bacteria 3271
212 Ga0068858_101088491 3300005842 Bacteria 784
213 Ga0068860_100205460 3300005843 Bacteria 1910
214 Ga0068862_100028027 3300005844 Bacteria 4743
215 Ga0081539_10071515 3300005985 Bacteria 1857
216 Ga0097621_100174739 3300006237 Bacteria 1853
217 Ga0097621_100524608 3300006237 Bacteria 1075
218 Ga0097621_101112956 3300006237 Bacteria 742
219 Ga0068871_100716564 3300006358 Bacteria 917
220 Ga0068865_100124170 3300006881 Bacteria 1924
221 Ga0068865_101045468 3300006881 Bacteria 717
222 Ga0097620_100221567 3300006931 Bacteria 1979
223 Ga0097620_100437147 3300006931 Bacteria 1404
224 Ga0097620_100914616 3300006931 Bacteria 962
225 Ga0105250_10008228 3300009092 Bacteria 4440
226 Ga0105245_10611651 3300009098 Bacteria 1117
227 Ga0105247_10092011 3300009101 Bacteria 1927
228 Ga0105241_10503243 3300009174 Bacteria 1081
229 Ga0105248_10001135 3300009177 Bacteria 29633
230 Ga0105248_10019178 3300009177 Bacteria 7567
231 Ga0105248_10201147 3300009177 Bacteria 2244
232 Ga0105248_11141514 3300009177 Bacteria 881
233 Ga0105249_10089043 3300009553 Bacteria 2884
234 Ga0157373_10014974 3300013100 Bacteria 5675
235 Ga0157373_10438077 3300013100 Bacteria 939
236 Ga0157373_10518954 3300013100 Bacteria 862
237 Ga0157373_10748786 3300013100 Bacteria 718
238 Ga0157371_10078304 3300013102 Bacteria 2342
239 Ga0157370_10055585 3300013104 Bacteria 3770
240 Ga0157370_10114252 3300013104 Bacteria 2522
241 Ga0157370_10892455 3300013104 Bacteria 807
242 Ga0157369_10127638 3300013105 Bacteria 2696
243 Ga0157369_10175882 3300013105 Bacteria 2253
244 Ga0157369_10872117 3300013105 Bacteria 924
245 Ga0157369_10881274 3300013105 Bacteria 918
246 Ga0157374_10222841 3300013296 Bacteria 1851
247 Ga0157374_10947297 3300013296 Bacteria 879
248 Ga0157374_11024352 3300013296 Bacteria 845
249 Ga0163162_10089421 3300013306 Bacteria 3160
250 Ga0163162_11228716 3300013306 Bacteria 851
251 Ga0157372_10698367 3300013307 Bacteria 1181
252 Ga0157372_10886448 3300013307 Bacteria 1035
253 Ga0157372_11139254 3300013307 Bacteria 902
254 Ga0157372_11880512 3300013307 Bacteria 688
255 Ga0157375_11130288 3300013308 Bacteria 918
256 Ga0163163_10000735 3300014325 Bacteria 27886
257 Ga0157380_11236428 3300014326 Bacteria 792
258 Ga0182008_10538462 3300014497 Bacteria 647
259 Ga0157379_10012216 3300014968 Bacteria 7500
260 Ga0157379_10330763 3300014968 Bacteria 1392
261 Ga0157376_10338846 3300014969 Bacteria 1435
262 Ga0197907_11114687 3300020069 Bacteria 855
263 Ga0206352_10095400 3300020078 Bacteria 1198
264 Ga0206354_10226857 3300020081 Bacteria 1335
265 Ga0206354_11230177 3300020081 Bacteria 748
266 Ga0206353_11563947 3300020082 Bacteria 2096
267 Ga0213875_10011498 3300021388 Bacteria 4402
268 Ga0207697_10084026 3300025315 Bacteria 1343
269 Ga0207656_10008268 3300025321 Bacteria 3821
270 Ga0207656_10038801 3300025321 Bacteria 2011
271 Ga0207656_10239381 3300025321 Bacteria 886
272 Ga0207656_10302101 3300025321 Bacteria 792
273 Ga0207680_10008315 3300025903 Bacteria 5085
274 Ga0207680_10200759 3300025903 Bacteria 1359
275 Ga0207680_10284731 3300025903 Bacteria 1149
276 Ga0207680_10331744 3300025903 Bacteria 1065
277 Ga0207647_10010648 3300025904 Bacteria 6483
278 Ga0207647_10030159 3300025904 Bacteria 3502
279 Ga0207647_10108722 3300025904 Bacteria 1640
280 Ga0207647_10118329 3300025904 Bacteria 1563
281 Ga0207647_10218361 3300025904 Bacteria 1099
282 Ga0207645_10038053 3300025907 Bacteria 3086
283 Ga0207645_10216303 3300025907 Bacteria 1262
284 Ga0207705_10000493 3300025909 Bacteria 33656
285 Ga0207705_10004262 3300025909 Bacteria 10832
286 Ga0207705_10028284 3300025909 Bacteria 3996
287 Ga0207705_10057414 3300025909 Bacteria 2807
288 Ga0207705_10095986 3300025909 Bacteria 2176
289 Ga0207654_10442327 3300025911 Bacteria 910
290 Ga0207707_10017647 3300025912 Bacteria 6225
291 Ga0207707_10039480 3300025912 Bacteria 4125
292 Ga0207707_10606412 3300025912 Bacteria 926
293 Ga0207695_10154693 3300025913 Bacteria 2229
294 Ga0207671_10024193 3300025914 Bacteria 4570
295 Ga0207671_10028319 3300025914 Bacteria 4186
296 Ga0207660_10003208 3300025917 Bacteria 10700
297 Ga0207660_10045526 3300025917 Bacteria 3091
298 Ga0207660_10054697 3300025917 Bacteria 2849
299 Ga0207660_10189837 3300025917 Bacteria 1599
300 Ga0207657_10009734 3300025919 Bacteria 9638
301 Ga0207657_10015926 3300025919 Bacteria 7264
302 Ga0207657_10017883 3300025919 Bacteria 6784
303 Ga0207657_10039647 3300025919 Bacteria 4184
304 Ga0207657_10052428 3300025919 Bacteria 3540
305 Ga0207657_10072347 3300025919 Bacteria 2917
306 Ga0207657_10084906 3300025919 Bacteria 2653
307 Ga0207657_10091364 3300025919 Bacteria 2539
308 Ga0207657_10121371 3300025919 Bacteria 2150
309 Ga0207657_10174931 3300025919 Bacteria 1738
310 Ga0207657_10240584 3300025919 Bacteria 1445
311 Ga0207649_10012535 3300025920 Bacteria 4707
312 Ga0207649_10049759 3300025920 Bacteria 2590
313 Ga0207649_10054438 3300025920 Bacteria 2490
314 Ga0207649_10081183 3300025920 Bacteria 2099
315 Ga0207649_10189677 3300025920 Bacteria 1445
316 Ga0207649_10194158 3300025920 Bacteria 1430
317 Ga0207649_10224026 3300025920 Bacteria 1341
318 Ga0207649_10227042 3300025920 Bacteria 1333
319 Ga0207649_10340610 3300025920 Bacteria 1107
320 Ga0207652_10000034 3300025921 Bacteria 138571
321 Ga0207652_10009794 3300025921 Bacteria 7714
322 Ga0207652_10579561 3300025921 Bacteria 1007
323 Ga0207694_10024170 3300025924 Bacteria 4614
324 Ga0207694_10569298 3300025924 Bacteria 952
325 Ga0207650_10005864 3300025925 Bacteria 8386
326 Ga0207650_10052898 3300025925 Bacteria 3009
327 Ga0207659_10163770 3300025926 Bacteria 1748
328 Ga0207687_10399981 3300025927 Bacteria 1129
329 Ga0207687_10406899 3300025927 Bacteria 1120
330 Ga0207700_11114265 3300025928 Bacteria 706
331 Ga0207700_11267147 3300025928 Unclassified 657
332 Ga0207664_10434529 3300025929 Bacteria 1170
333 Ga0207664_10647739 3300025929 Bacteria 949
334 Ga0207644_10000614 3300025931 Bacteria 22677
335 Ga0207644_10006207 3300025931 Bacteria 7793
336 Ga0207644_10017567 3300025931 Bacteria 4835
337 Ga0207644_10051182 3300025931 Bacteria 2964
338 Ga0207644_10092846 3300025931 Bacteria 2252
339 Ga0207644_10629129 3300025931 Bacteria 892
340 Ga0207690_10004475 3300025932 Bacteria 8254
341 Ga0207690_10029270 3300025932 Bacteria 3499
342 Ga0207690_10292984 3300025932 Bacteria 1271
343 Ga0207690_10678778 3300025932 Bacteria 846
344 Ga0207706_10068152 3300025933 Bacteria 3131
345 Ga0207706_10078243 3300025933 Bacteria 2908
346 Ga0207706_10078803 3300025933 Bacteria 2897
347 Ga0207706_10308681 3300025933 Bacteria 1378
348 Ga0207669_10145946 3300025937 Bacteria 1650
349 Ga0207669_10157753 3300025937 Bacteria 1598
350 Ga0207704_10535421 3300025938 Bacteria 950
351 Ga0207704_10566616 3300025938 Bacteria 925
352 Ga0207691_10021942 3300025940 Bacteria 6024
353 Ga0207691_10031381 3300025940 Bacteria 4960
354 Ga0207691_10200721 3300025940 Bacteria 1736
355 Ga0207691_10202556 3300025940 Bacteria 1727
356 Ga0207691_10301247 3300025940 Bacteria 1377
357 Ga0207711_10000617 3300025941 Bacteria 35805
358 Ga0207711_10006917 3300025941 Bacteria 9525
359 Ga0207711_10007240 3300025941 Bacteria 9299
360 Ga0207711_10011304 3300025941 Bacteria 7417
361 Ga0207711_10020622 3300025941 Bacteria 5500
362 Ga0207711_10033837 3300025941 Bacteria 4326
363 Ga0207711_10045504 3300025941 Bacteria 3750
364 Ga0207711_10062395 3300025941 Bacteria 3215
365 Ga0207711_10167201 3300025941 Bacteria 1994
366 Ga0207661_10009979 3300025944 Bacteria 6823
367 Ga0207661_10013875 3300025944 Bacteria 5888
368 Ga0207661_10074814 3300025944 Bacteria 2777
369 Ga0207661_10084310 3300025944 Bacteria 2631
370 Ga0207661_10223204 3300025944 Bacteria 1666
371 Ga0207661_10357131 3300025944 Bacteria 1319
372 Ga0207679_10197601 3300025945 Bacteria 1677
373 Ga0207667_10004710 3300025949 Bacteria 16697
374 Ga0207667_10049976 3300025949 Bacteria 4413
375 Ga0207667_10056357 3300025949 Bacteria 4129
376 Ga0207667_10087521 3300025949 Bacteria 3222
377 Ga0207667_10139171 3300025949 Bacteria 2499
378 Ga0207667_10151223 3300025949 Bacteria 2389
379 Ga0207651_10029038 3300025960 Bacteria 3498
380 Ga0207651_10070728 3300025960 Bacteria 2470
381 Ga0207651_10136569 3300025960 Bacteria 1887
382 Ga0207651_10501556 3300025960 Bacteria 1049
383 Ga0207651_10522805 3300025960 Bacteria 1028
384 Ga0207640_10109202 3300025981 Bacteria 1957
385 Ga0207640_10880080 3300025981 Bacteria 781
386 Ga0207640_11408518 3300025981 Unclassified 625
387 Ga0207658_10084342 3300025986 Bacteria 2444
388 Ga0207658_10392824 3300025986 Bacteria 1217
389 Ga0207658_10588695 3300025986 Bacteria 998
390 Ga0207677_10006373 3300026023 Bacteria 6471
391 Ga0207677_10371048 3300026023 Bacteria 1205
392 Ga0207677_10484598 3300026023 Bacteria 1066
393 Ga0207703_10249409 3300026035 Bacteria 1599
394 Ga0207639_10000923 3300026041 Bacteria 19909
395 Ga0207639_10001159 3300026041 Bacteria 17877
396 Ga0207639_10006431 3300026041 Bacteria 7988
397 Ga0207639_10049640 3300026041 Bacteria 3183
398 Ga0207639_10112941 3300026041 Bacteria 2218
399 Ga0207639_10278547 3300026041 Bacteria 1470
400 Ga0207639_10542721 3300026041 Bacteria 1067
401 Ga0207678_10001315 3300026067 Bacteria 22977
402 Ga0207678_10015007 3300026067 Bacteria 6816
403 Ga0207678_10017638 3300026067 Bacteria 6266
404 Ga0207702_10002063 3300026078 Bacteria 19455
405 Ga0207702_10037780 3300026078 Bacteria 4043
406 Ga0207702_10082186 3300026078 Bacteria 2800
407 Ga0207702_10207176 3300026078 Bacteria 1821
408 Ga0207702_10299371 3300026078 Bacteria 1526
409 Ga0207702_10896867 3300026078 Bacteria 878
410 Ga0207641_10003063 3300026088 Bacteria 15070
411 Ga0207648_10059945 3300026089 Bacteria 3319
412 Ga0207676_10001223 3300026095 Bacteria 19146
413 Ga0207674_10019569 3300026116 Bacteria 7331
414 Ga0207674_10095577 3300026116 Bacteria 2957
415 Ga0207674_10118695 3300026116 Bacteria 2615
416 Ga0207674_10137434 3300026116 Bacteria 2405
417 Ga0207674_10189915 3300026116 Bacteria 2004
418 Ga0207674_10609387 3300026116 Bacteria 1055
419 Ga0207683_10049845 3300026121 Bacteria 3666
420 Ga0207683_10473012 3300026121 Bacteria 1156
421 Ga0207683_10554350 3300026121 Bacteria 1063
422 Ga0207698_10000896 3300026142 Bacteria 17309
423 Ga0207698_10006766 3300026142 Bacteria 7163
424 Ga0207698_10008977 3300026142 Bacteria 6344
425 Ga0207698_10115877 3300026142 Bacteria 2257
426 Ga0207698_10325580 3300026142 Bacteria 1441
427 Ga0207698_10414127 3300026142 Bacteria 1291
428 Ga0207698_10490829 3300026142 Bacteria 1193
429 Ga0207698_11253623 3300026142 Bacteria 756
430 Ga0207698_12010683 3300026142 Unclassified 592
431 Ga0268266_10319165 3300028379 Bacteria 1453
432 Ga0268266_10744688 3300028379 Bacteria 945
433 Ga0268265_10179851 3300028380 Bacteria 1816
434 Ga0268264_10203575 3300028381 Bacteria 1812
435 Ga0307405_10347022 3300031731 Bacteria 1143
436 Ga0307413_10251110 3300031824 Bacteria 1312
437 Ga0307413_10501615 3300031824 Bacteria 974
438 Ga0307410_10102566 3300031852 Bacteria 2053
439 Ga0307410_10144957 3300031852 Bacteria 1761
440 Ga0307410_10158828 3300031852 Bacteria 1691
441 Ga0307406_10421097 3300031901 Bacteria 1064
442 Ga0307407_10015582 3300031903 Bacteria 3764
443 Ga0307407_10085950 3300031903 Bacteria 1915
444 Ga0307412_10061430 3300031911 Bacteria 2526
445 Ga0307412_10260600 3300031911 Bacteria 1351
446 Ga0307412_10696304 3300031911 Bacteria 871
447 Ga0307409_100031807 3300031995 Bacteria 3815
448 Ga0307409_100149142 3300031995 Bacteria 2028
449 Ga0307416_100004552 3300032002 Bacteria 8377
450 Ga0307416_100030216 3300032002 Bacteria 4062
451 Ga0307416_100276544 3300032002 Bacteria 1652
452 Ga0307416_101247515 3300032002 Bacteria 849
453 Ga0307414_10179571 3300032004 Bacteria 1701
454 Ga0307414_10209728 3300032004 Bacteria 1591
455 Ga0307414_10366977 3300032004 Bacteria 1240
456 Ga0307411_10026146 3300032005 Bacteria 3510
457 Ga0307411_10071637 3300032005 Bacteria 2350
458 Ga0307411_10158493 3300032005 Bacteria 1691
459 Ga0307411_10632101 3300032005 Bacteria 924
460 Ga0307415_100016305 3300032126 Bacteria 4426
461 Ga0307415_100159749 3300032126 Bacteria 1745
462 Ga0307415_100179507 3300032126 Bacteria 1659
463 Ga0307415_100784867 3300032126 Bacteria 868
464 Ga0373923_0027553 3300035111 Bacteria 2268
465 Ga0373923_0330748 3300035111 Bacteria 725
466 Ga0373936_0353480 3300035113 Unclassified 669
467 Ga0373941_0173760 3300035115 Bacteria 804
468 Ga0373954_0033151 3300035118 Bacteria 2389
469 Ga0373943_0016672 3300035170 Bacteria 3353
470 Ga0373943_0148768 3300035170 Bacteria 1267
471 Ga0373946_0066336 3300035171 Bacteria 1547
472 Ga0373955_0002727 3300035172 Bacteria 7737
473 Ga0373931_1027412 3300035691 Unclassified 559
474 Ga0373935_0018058 3300035692 Bacteria 4288
475 Ga0373927_0093144 3300035695 Bacteria 1957
476 Ga0373947_0316112 3300035725 Bacteria 1043
477 Ga0373937_0010753 3300036401 Bacteria 8007
478 Ga0373937_0222036 3300036401 Bacteria 1779
479 Ga0373925_0010397 3300037068 Bacteria 6751
480 Ga0373925_0332683 3300037068 Bacteria 1231
481 Ga0395899_0014277 3300037312 Bacteria 6064
482 Ga0395899_0072949 3300037312 Bacteria 2511
483 Ga0395899_0084671 3300037312 Bacteria 2305
484 Ga0395899_0118898 3300037312 Bacteria 1895
485 Ga0395899_0130064 3300037312 Bacteria 1798
486 Ga0395899_0139822 3300037312 Unclassified 1723
487 Ga0395899_0147116 3300037312 Bacteria 1672
488 Ga0395899_0306411 3300037312 Bacteria 1073
489 Ga0395899_0375049 3300037312 Bacteria 946
490 Ga0395899_0403037 3300037312 Bacteria 904
491 Ga0395899_0411002 3300037312 Bacteria 893
492 Ga0395899_0434941 3300037312 Bacteria 862
493 Ga0395899_0660779 3300037312 Bacteria 659
494 Ga0395900_0001779 3300037418 Bacteria 24718
495 Ga0395900_0003085 3300037418 Bacteria 18103
496 Ga0395900_0009276 3300037418 Bacteria 10089
497 Ga0395900_0010484 3300037418 Bacteria 9479
498 Ga0395900_0033740 3300037418 Bacteria 5267
499 Ga0395900_0040236 3300037418 Bacteria 4817
500 Ga0395900_0041814 3300037418 Bacteria 4723
501 Ga0395900_0060815 3300037418 Bacteria 3885
502 Ga0395900_0073712 3300037418 Bacteria 3510
503 Ga0395900_0149524 3300037418 Bacteria 2386
504 Ga0395900_0198322 3300037418 Bacteria 2032
505 Ga0395900_0265514 3300037418 Bacteria 1712
506 Ga0395900_0546719 3300037418 Bacteria 1103
507 Ga0395900_0675836 3300037418 Bacteria 967
508 Ga0395900_0679881 3300037418 Bacteria 964
509 Ga0395900_0754379 3300037418 Bacteria 903
510 Ga0395900_0778836 3300037418 Bacteria 885
511 Ga0395900_1468576 3300037418 Unclassified 594
512 Ga0395898_0011721 3300037466 Bacteria 9089
513 Ga0395898_0021270 3300037466 Bacteria 6579
514 Ga0395898_0052037 3300037466 Bacteria 4002
515 Ga0395898_0142823 3300037466 Bacteria 2292
516 Ga0395898_0154726 3300037466 Bacteria 2193
517 Ga0395898_0277996 3300037466 Bacteria 1597
518 Ga0395898_0379279 3300037466 Bacteria 1348
519 Ga0395898_0500232 3300037466 Bacteria 1156
520 Ga0395898_0986595 3300037466 Bacteria 778
521 Ga0395905_0000104 3300037471 Bacteria 141965
522 Ga0395905_0004102 3300037471 Bacteria 15259
523 Ga0395905_0008256 3300037471 Bacteria 10285
524 Ga0395905_0023579 3300037471 Bacteria 5813
525 Ga0395905_0029447 3300037471 Bacteria 5172
526 Ga0395905_0034571 3300037471 Bacteria 4746
527 Ga0395905_0036894 3300037471 Bacteria 4591
528 Ga0395905_0037718 3300037471 Bacteria 4535
529 Ga0395905_0045504 3300037471 Bacteria 4116
530 Ga0395905_0085043 3300037471 Bacteria 2964
531 Ga0395905_0086007 3300037471 Bacteria 2946
532 Ga0395905_0094163 3300037471 Bacteria 2810
533 Ga0395905_0208860 3300037471 Bacteria 1830
534 Ga0395905_0244205 3300037471 Bacteria 1677
535 Ga0395905_0282967 3300037471 Bacteria 1544
536 Ga0395905_0423000 3300037471 Bacteria 1228
537 Ga0395905_0478805 3300037471 Bacteria 1144
538 Ga0395905_0517012 3300037471 Bacteria 1094
539 Ga0395905_0569978 3300037471 Bacteria 1033
540 Ga0395905_0647674 3300037471 Bacteria 958
541 Ga0395905_0700970 3300037471 Bacteria 915
542 Ga0395905_0729105 3300037471 Bacteria 893
543 Ga0395905_1142279 3300037471 Bacteria 682
544 Ga0436364_1387927 3300037853 Bacteria 27679
545 Ga0395901_0000589 3300038443 Bacteria 42319
546 Ga0395901_0000782 3300038443 Bacteria 35570
547 Ga0395901_0103175 3300038443 Bacteria 2992
548 Ga0395901_0113729 3300038443 Bacteria 2842
549 Ga0395901_0131734 3300038443 Bacteria 2627
550 Ga0395901_0247424 3300038443 Bacteria 1858
551 Ga0395901_0262712 3300038443 Bacteria 1796
552 Ga0395901_0296008 3300038443 Bacteria 1678
553 Ga0395901_0358393 3300038443 Bacteria 1504
554 Ga0395901_0492497 3300038443 Bacteria 1249
555 Ga0395901_0514093 3300038443 Bacteria 1217
556 Ga0395901_0827968 3300038443 Bacteria 912
557 Ga0395901_0905836 3300038443 Bacteria 863
558 Ga0439465_0022888 3300041413 Bacteria 1964
559 Ga0439432_024907 3300042006 Bacteria 1965
560 Ga0439449_0043119 3300042007 Bacteria 1675
561 Ga0439458_0000590 3300042157 Bacteria 9358
562 Ga0466972_0005975 3300044658 Bacteria 6113
563 Ga0466972_0057561 3300044658 Bacteria 1867
564 Ga0466972_0316434 3300044658 Bacteria 729
565 Ga0466965_0156053 3300044683 Bacteria 1195
566 Ga0466961_0149153 3300044693 Bacteria 1461
567 Ga0466961_0307191 3300044693 Bacteria 968
568 Ga0466961_0329009 3300044693 Bacteria 931
569 Ga0466961_0490775 3300044693 Bacteria 742
570 Ga0466963_0010178 3300044694 Bacteria 5686
571 Ga0466963_0010200 3300044694 Bacteria 5681
572 Ga0466963_0073140 3300044694 Bacteria 2310
573 Ga0466963_0246625 3300044694 Bacteria 1253
574 Ga0466963_0304119 3300044694 Bacteria 1122
575 Ga0466963_0422153 3300044694 Bacteria 940
576 Ga0466963_0581271 3300044694 Bacteria 791
577 Ga0466964_0151035 3300044706 Bacteria 1077
578 Ga0466964_0155698 3300044706 Bacteria 1063
579 Ga0466971_0018356 3300044719 Bacteria 3098
580 Ga0466971_0213122 3300044719 Bacteria 914
581 Ga0466971_0310596 3300044719 Bacteria 758
582 Ga0466968_0246394 3300044735 Bacteria 848
583 Ga0466957_0039900 3300044842 Bacteria 2834
584 Ga0466957_0113584 3300044842 Bacteria 1720
585 Ga0466957_0184562 3300044842 Bacteria 1363
586 Ga0466957_0274535 3300044842 Bacteria 1126
587 Ga0466957_0346149 3300044842 Bacteria 1007
588 Ga0466957_0390324 3300044842 Bacteria 950
589 Ga0466957_0588571 3300044842 Bacteria 778
590 Ga0466957_0653508 3300044842 Bacteria 739
591 Ga0466960_0047367 3300044901 Bacteria 2061
592 Ga0466959_0219829 3300045049 Bacteria 1318
593 Ga0466959_0480705 3300045049 Bacteria 841
594 Ga0466958_0014825 3300045836 Bacteria 4456
595 Ga0466958_0028552 3300045836 Bacteria 3308
596 Ga0466958_0032340 3300045836 Bacteria 3112
597 Ga0466958_0202812 3300045836 Bacteria 1262
598 Ga0466958_0217883 3300045836 Bacteria 1217
599 Ga0466958_0282868 3300045836 Bacteria 1063
600 Ga0466967_0006997 3300045976 Bacteria 8072
601 Ga0466967_0020005 3300045976 Bacteria 5398
602 Ga0466967_0088576 3300045976 Bacteria 2809
603 Ga0466967_0096507 3300045976 Bacteria 2696
604 Ga0466967_0131886 3300045976 Bacteria 2320
605 Ga0466967_0210613 3300045976 Bacteria 1843
606 Ga0466967_0247910 3300045976 Bacteria 1700
607 Ga0466967_0249305 3300045976 Bacteria 1696
608 Ga0466967_0263869 3300045976 Bacteria 1648
609 Ga0466967_0297358 3300045976 Bacteria 1552
610 Ga0466967_0813755 3300045976 Bacteria 928
611 Ga0466967_0820870 3300045976 Bacteria 923
612 Ga0466967_0893570 3300045976 Bacteria 883
613 Ga0466967_1531166 3300045976 Bacteria 664
614 Ga0495650_0152204 3300046471 Bacteria 830
615 Ga0495631_0230384 3300046518 Unclassified 790
616 Ga0495663_0011260 3300046525 Bacteria 2490
617 Ga0495663_0031760 3300046525 Bacteria 1570
618 Ga0495621_0000972 3300046539 Bacteria 7305
619 Ga0495633_0113394 3300046558 Bacteria 1257
620 Ga0495668_0011856 3300046616 Bacteria 5196
621 Ga0495623_0019538 3300046679 Bacteria 4378
622 Ga0495647_0348113 3300046681 Bacteria 674
623 Ga0495669_0057703 3300046684 Bacteria 1752
624 Ga0495669_0387596 3300046684 Bacteria 676
625 Ga0495670_0000071 3300046691 Bacteria 45180
626 Ga0495677_0087929 3300047445 Bacteria 1169
627 Ga0495602_0091257 3300048088 Bacteria 2527
628 Ga0496101_0010849 3300048904 Bacteria 6027
629 Ga0496101_0457142 3300048904 Bacteria 1007
630 Ga0496102_0346638 3300048905 Bacteria 1398
631 Ga0496102_0366584 3300048905 Bacteria 1356
632 Ga0496104_0137509 3300048907 Bacteria 2347
633 Ga0496105_0182962 3300048908 Bacteria 1715
634 Ga0496106_0082568 3300048909 Bacteria 2470
635 Ga0496106_0130672 3300048909 Bacteria 1969
636 Ga0496107_0002900 3300048910 Bacteria 11331
637 Ga0496107_0011494 3300048910 Bacteria 6167
638 Ga0496107_0131555 3300048910 Bacteria 1847
639 Ga0496108_0045905 3300048911 Bacteria 3649
640 Ga0496108_0515020 3300048911 Bacteria 1044
641 Ga0496109_0046481 3300048912 Bacteria 3943
642 Ga0496109_0061186 3300048912 Bacteria 3441
643 Ga0496109_0068968 3300048912 Bacteria 3241
644 Ga0496109_0467267 3300048912 Bacteria 1191
645 Ga0496109_0794783 3300048912 Bacteria 884
646 Ga0496110_0025175 3300048913 Bacteria 5083
647 Ga0496110_0033905 3300048913 Bacteria 4418
648 Ga0496110_0042482 3300048913 Bacteria 3968
649 Ga0496110_0184234 3300048913 Bacteria 1896
650 Ga0496110_0881018 3300048913 Bacteria 801
651 Ga0496111_0002376 3300048914 Bacteria 11340
652 Ga0496111_0029259 3300048914 Bacteria 3911
653 Ga0496112_0040418 3300048915 Bacteria 4559
654 Ga0496112_0068145 3300048915 Bacteria 3514
655 Ga0496112_0143489 3300048915 Bacteria 2356
656 Ga0496112_0443531 3300048915 Bacteria 1236
657 Ga0496113_0010921 3300048916 Bacteria 6028
658 Ga0496113_0011965 3300048916 Bacteria 5816
659 Ga0496113_0054432 3300048916 Bacteria 2996
660 Ga0496114_0058951 3300048917 Bacteria 3206
661 Ga0496115_0088057 3300048918 Bacteria 2534
662 Ga0501202_058311 3300049652 Bacteria 868
663 Ga0501207_019395 3300049654 Bacteria 1078
664 Ga0501217_067111 3300049661 Bacteria 969
665 Ga0501223_035357 3300049663 Bacteria 972
666 Ga0501233_005985 3300049668 Bacteria 2272
667 Ga0501235_008407 3300049669 Bacteria 2252
668 Ga0501239_006071 3300049672 Bacteria 1232
669 Ga0501247_027531 3300049677 Bacteria 763
670 Ga0501249_018314 3300049679 Bacteria 1514
671 Ga0501258_004127 3300049687 Bacteria 1362
672 Ga0501221_009102 3300049704 Bacteria 1738
673 Ga0501229_020960 3300049706 Bacteria 866
674 Ga0501268_000532 3300049765 Bacteria 4191
675 Ga0501272_001757 3300049769 Bacteria 2098
676 Ga0501273_010041 3300049770 Bacteria 1158
677 Ga0500658_0000036 3300053134 Bacteria 85304
678 Ga0587066_046458 3300059490 Bacteria 838
679 Ga0587080_010228 3300059503 Bacteria 1380
680 Ga0587090_010448 3300059510 Unclassified 1287
681 Ga0587128_026224 3300059630 Bacteria 933
682 Ga0587075_016693 3300059644 Bacteria 1047
683 Ga0587079_075714 3300059647 Bacteria 760
684 Ga0466962_0006344 3300061719 Bacteria 5677
685 Ga0466962_0015820 3300061719 Bacteria 3640
686 Ga0466962_0120036 3300061719 Bacteria 1268
687 Ga0466962_0330471 3300061719 Unclassified 757
688 Ga0466972_0073628
689 JGI24736J21556_1011162
690 JGI24740J21852_10011466
691 JGI24740J21852_10027078
692 JGI24740J21852_10032137
693 JGI24739J22299_10006645
694 JGI24737J22298_10005144
695 JGI24735J21928_10004145
696 JGI24735J21928_10018977
697 rootH2_10095679
698 rootH1_10146668
699 Ga0070658_10014069
700 Ga0070658_10095418
701 Ga0070658_10115125
702 Ga0070658_10190689
703 Ga0070658_10382658
704 Ga0070658_10453259
705 Ga0070658_10457148
706 Ga0070658_10475136
707 Ga0070658_10603367
708 Ga0070676_10396100
709 Ga0070683_100009832
710 Ga0070683_100014717
711 Ga0070683_100034868
712 Ga0070683_100093133
713 Ga0070683_100430693
714 Ga0070683_100788728
715 Ga0070690_100208589
716 Ga0070690_100604591
717 Ga0070670_100037964
718 Ga0070670_100140991
719 Ga0070670_100309142
720 Ga0070677_10359569
721 Ga0068869_100646279
722 Ga0070666_10002971
723 Ga0070666_10053690
724 Ga0070666_10241481
725 Ga0070680_100001257
726 Ga0070680_100145622
727 Ga0070680_100233016
728 Ga0070680_100341447
729 Ga0070682_100062528
730 Ga0070682_100240793
731 Ga0070682_100297181
732 Ga0070682_100590144
733 Ga0070682_100676506
734 Ga0068868_100012920
735 Ga0068868_100074382
736 Ga0068868_100335976
737 Ga0070660_100029369
738 Ga0070660_100036347
739 Ga0070660_100046930
740 Ga0070660_100057029
741 Ga0070660_100060814
742 Ga0070660_100082500
743 Ga0070660_100192238
744 Ga0070660_100599932
745 Ga0070660_100777800
746 Ga0070660_100860822
747 Ga0070660_100864870
748 Ga0070691_10003582
749 Ga0070661_100033437
750 Ga0070661_100057595
751 Ga0070661_100115944
752 Ga0070661_100119212
753 Ga0070661_100125604
754 Ga0070661_100132596
755 Ga0070661_100255546
756 Ga0070661_100425149
757 Ga0070661_100430133
758 Ga0070661_100663233
759 Ga0070661_100765250
760 Ga0070692_10006534
761 Ga0070692_10013273
762 Ga0070692_10072159
763 Ga0070692_10107622
764 Ga0070675_100222134
765 Ga0070675_100354570
766 Ga0070671_100024137
767 Ga0070671_100079772
768 Ga0070671_100223230
769 Ga0070671_100479706
770 Ga0070674_100198542
771 Ga0070674_100218520
772 Ga0070674_100263739
773 Ga0070674_100402675
774 Ga0070673_100000526
775 Ga0070673_100075965
776 Ga0070673_100230514
777 Ga0070673_100895869
778 Ga0070659_100033445
779 Ga0070659_100033606
780 Ga0070659_100045336
781 Ga0070659_100083906
782 Ga0070659_100381841
783 Ga0070659_100420236
784 Ga0070659_100443303
785 Ga0070659_100475719
786 Ga0070659_100775901
787 Ga0070659_100897391
788 Ga0070667_100013712
789 Ga0070667_100053826
790 Ga0070667_100056858
791 Ga0070667_100405460
792 Ga0070714_100224928
793 Ga0070714_100450504
794 Ga0070714_100715804
795 Ga0070714_100754447
796 Ga0070714_101482018
797 Ga0070713_100604964
798 Ga0070663_100025115
799 Ga0070663_100053289
800 Ga0070663_100078053
801 Ga0070663_100397770
802 Ga0070663_100720413
803 Ga0070678_100026409
804 Ga0070678_100031044
805 Ga0070678_100185955
806 Ga0070662_100028447
807 Ga0070662_100031341
808 Ga0070662_100359996
809 Ga0070662_100689245
810 Ga0070681_10074936
811 Ga0070681_10135295
812 Ga0070681_10190802
813 Ga0070681_10421602
814 Ga0070681_10956825
815 Ga0068867_100173257
816 Ga0068867_100224100
817 Ga0070685_10175839
818 Ga0070679_100038807
819 Ga0070679_100089715
820 Ga0070679_100624713
821 Ga0070679_101081056
822 Ga0070684_100002671
823 Ga0070684_100034298
824 Ga0070684_100043830
825 Ga0070684_100131444
826 Ga0070684_100958225
827 Ga0068853_100041268
828 Ga0068853_100043066
829 Ga0068853_100136876
830 Ga0068853_100182314
831 Ga0068853_100430520
832 Ga0068853_100468473
833 Ga0068853_101021086
834 Ga0070672_100047900
835 Ga0070672_100363492
836 Ga0070672_100387372
837 Ga0070672_100563974
838 Ga0070672_101433130
839 Ga0070686_100608762
840 Ga0070686_100744368
841 Ga0070665_100040150
842 Ga0070665_100659351
843 Ga0068855_100025356
844 Ga0068855_100112774
845 Ga0068855_100115015
846 Ga0068855_100136178
847 Ga0068855_100394981
848 Ga0068855_100725812
849 Ga0070664_100006591
850 Ga0070664_100055897
851 Ga0070664_100113509
852 Ga0070664_100336421
853 Ga0070664_100349063
854 Ga0070664_100816447
855 Ga0070664_100821839
856 Ga0070664_101036703
857 Ga0068857_100031248
858 Ga0068857_100039427
859 Ga0068857_100200012
860 Ga0068857_101122619
861 Ga0068854_100033977
862 Ga0068854_100083539
863 Ga0068854_100106600
864 Ga0068854_100557858
865 Ga0068856_100008253
866 Ga0068856_100251514
867 Ga0068856_100274052
868 Ga0068856_100900673
869 Ga0068856_100976439
870 Ga0068856_101130044
871 Ga0068856_101393909
872 Ga0068852_100013451
873 Ga0068852_100030542
874 Ga0068852_100031074
875 Ga0068852_100125836
876 Ga0068852_100187856
877 Ga0068852_100221775
878 Ga0068852_100244841
879 Ga0068852_100279679
880 Ga0068852_100445873
881 Ga0068852_100812574
882 Ga0068852_101128342
883 Ga0068852_101629976
884 Ga0068859_100221584
885 Ga0068859_100437124
886 Ga0068859_100914628
887 Ga0068864_100038826
888 Ga0068864_100758205
889 Ga0068866_10061662
890 Ga0068851_10008280
891 Ga0068851_10013866
892 Ga0068851_10283083
893 Ga0068851_10314946
894 Ga0068851_10383426
895 Ga0068863_100145598
896 Ga0068858_100013510
897 Ga0068858_100019414
898 Ga0068858_100069226
899 Ga0068858_101088491
900 Ga0068860_100205460
901 Ga0068862_100028027
902 Ga0081539_10071515
903 Ga0097621_100174739
904 Ga0097621_100524608
905 Ga0097621_101112956
906 Ga0068871_100716564
907 Ga0068865_100124170
908 Ga0068865_101045468
909 Ga0097620_100221567
910 Ga0097620_100437147
911 Ga0097620_100914616
912 Ga0105250_10008228
913 Ga0105245_10611651
914 Ga0105247_10092011
915 Ga0105241_10503243
916 Ga0105248_10001135
917 Ga0105248_10019178
918 Ga0105248_10201147
919 Ga0105248_11141514
920 Ga0105249_10089043
921 Ga0157373_10014974
922 Ga0157373_10438077
923 Ga0157373_10518954
924 Ga0157373_10748786
925 Ga0157371_10078304
926 Ga0157370_10055585
927 Ga0157370_10114252
928 Ga0157370_10892455
929 Ga0157369_10127638
930 Ga0157369_10175882
931 Ga0157369_10872117
932 Ga0157369_10881274
933 Ga0157374_10222841
934 Ga0157374_10947297
935 Ga0157374_11024352
936 Ga0163162_10089421
937 Ga0163162_11228716
938 Ga0157372_10698367
939 Ga0157372_10886448
940 Ga0157372_11139254
941 Ga0157372_11880512
942 Ga0157375_11130288
943 Ga0163163_10000735
944 Ga0157380_11236428
945 Ga0182008_10538462
946 Ga0157379_10012216
947 Ga0157379_10330763
948 Ga0157376_10338846
949 Ga0197907_11114687
950 Ga0206352_10095400
951 Ga0206354_10226857
952 Ga0206354_11230177
953 Ga0206353_11563947
954 Ga0213875_10011498
955 Ga0207697_10084026
956 Ga0207656_10008268
957 Ga0207656_10038801
958 Ga0207656_10239381
959 Ga0207656_10302101
960 Ga0207680_10008315
961 Ga0207680_10200759
962 Ga0207680_10284731
963 Ga0207680_10331744
964 Ga0207647_10010648
965 Ga0207647_10030159
966 Ga0207647_10108722
967 Ga0207647_10118329
968 Ga0207647_10218361
969 Ga0207645_10038053
970 Ga0207645_10216303
971 Ga0207705_10000493
972 Ga0207705_10004262
973 Ga0207705_10028284
974 Ga0207705_10057414
975 Ga0207705_10095986
976 Ga0207654_10442327
977 Ga0207707_10017647
978 Ga0207707_10039480
979 Ga0207707_10606412
980 Ga0207695_10154693
981 Ga0207671_10024193
982 Ga0207671_10028319
983 Ga0207660_10003208
984 Ga0207660_10045526
985 Ga0207660_10054697
986 Ga0207660_10189837
987 Ga0207657_10009734
988 Ga0207657_10015926
989 Ga0207657_10017883
990 Ga0207657_10039647
991 Ga0207657_10052428
992 Ga0207657_10072347
993 Ga0207657_10084906
994 Ga0207657_10091364
995 Ga0207657_10121371
996 Ga0207657_10174931
997 Ga0207657_10240584
998 Ga0207649_10012535
999 Ga0207649_10049759
1000 Ga0207649_10054438
1001 Ga0207649_10081183
1002 Ga0207649_10189677
1003 Ga0207649_10194158
1004 Ga0207649_10224026
1005 Ga0207649_10227042
1006 Ga0207649_10340610
1007 Ga0207652_10000034
1008 Ga0207652_10009794
1009 Ga0207652_10579561
1010 Ga0207694_10024170
1011 Ga0207694_10569298
1012 Ga0207650_10005864
1013 Ga0207650_10052898
1014 Ga0207659_10163770
1015 Ga0207687_10399981
1016 Ga0207687_10406899
1017 Ga0207700_11114265
1018 Ga0207700_11267147
1019 Ga0207664_10434529
1020 Ga0207664_10647739
1021 Ga0207644_10000614
1022 Ga0207644_10006207
1023 Ga0207644_10017567
1024 Ga0207644_10051182
1025 Ga0207644_10092846
1026 Ga0207644_10629129
1027 Ga0207690_10004475
1028 Ga0207690_10029270
1029 Ga0207690_10292984
1030 Ga0207690_10678778
1031 Ga0207706_10068152
1032 Ga0207706_10078243
1033 Ga0207706_10078803
1034 Ga0207706_10308681
1035 Ga0207669_10145946
1036 Ga0207669_10157753
1037 Ga0207704_10535421
1038 Ga0207704_10566616
1039 Ga0207691_10021942
1040 Ga0207691_10031381
1041 Ga0207691_10200721
1042 Ga0207691_10202556
1043 Ga0207691_10301247
1044 Ga0207711_10000617
1045 Ga0207711_10006917
1046 Ga0207711_10007240
1047 Ga0207711_10011304
1048 Ga0207711_10020622
1049 Ga0207711_10033837
1050 Ga0207711_10045504
1051 Ga0207711_10062395
1052 Ga0207711_10167201
1053 Ga0207661_10009979
1054 Ga0207661_10013875
1055 Ga0207661_10074814
1056 Ga0207661_10084310
1057 Ga0207661_10223204
1058 Ga0207661_10357131
1059 Ga0207679_10197601
1060 Ga0207667_10004710
1061 Ga0207667_10049976
1062 Ga0207667_10056357
1063 Ga0207667_10087521
1064 Ga0207667_10139171
1065 Ga0207667_10151223
1066 Ga0207651_10029038
1067 Ga0207651_10070728
1068 Ga0207651_10136569
1069 Ga0207651_10501556
1070 Ga0207651_10522805
1071 Ga0207640_10109202
1072 Ga0207640_10880080
1073 Ga0207640_11408518
1074 Ga0207658_10084342
1075 Ga0207658_10392824
1076 Ga0207658_10588695
1077 Ga0207677_10006373
1078 Ga0207677_10371048
1079 Ga0207677_10484598
1080 Ga0207703_10249409
1081 Ga0207639_10000923
1082 Ga0207639_10001159
1083 Ga0207639_10006431
1084 Ga0207639_10049640
1085 Ga0207639_10112941
1086 Ga0207639_10278547
1087 Ga0207639_10542721
1088 Ga0207678_10001315
1089 Ga0207678_10015007
1090 Ga0207678_10017638
1091 Ga0207702_10002063
1092 Ga0207702_10037780
1093 Ga0207702_10082186
1094 Ga0207702_10207176
1095 Ga0207702_10299371
1096 Ga0207702_10896867
1097 Ga0207641_10003063
1098 Ga0207648_10059945
1099 Ga0207676_10001223
1100 Ga0207674_10019569
1101 Ga0207674_10095577
1102 Ga0207674_10118695
1103 Ga0207674_10137434
1104 Ga0207674_10189915
1105 Ga0207674_10609387
1106 Ga0207683_10049845
1107 Ga0207683_10473012
1108 Ga0207683_10554350
1109 Ga0207698_10000896
1110 Ga0207698_10006766
1111 Ga0207698_10008977
1112 Ga0207698_10115877
1113 Ga0207698_10325580
1114 Ga0207698_10414127
1115 Ga0207698_10490829
1116 Ga0207698_11253623
1117 Ga0207698_12010683
1118 Ga0268266_10319165
1119 Ga0268266_10744688
1120 Ga0268265_10179851
1121 Ga0268264_10203575
1122 Ga0307405_10347022
1123 Ga0307413_10251110
1124 Ga0307413_10501615
1125 Ga0307410_10102566
1126 Ga0307410_10144957
1127 Ga0307410_10158828
1128 Ga0307406_10421097
1129 Ga0307407_10015582
1130 Ga0307407_10085950
1131 Ga0307412_10061430
1132 Ga0307412_10260600
1133 Ga0307412_10696304
1134 Ga0307409_100031807
1135 Ga0307409_100149142
1136 Ga0307416_100004552
1137 Ga0307416_100030216
1138 Ga0307416_100276544
1139 Ga0307416_101247515
1140 Ga0307414_10179571
1141 Ga0307414_10209728
1142 Ga0307414_10366977
1143 Ga0307411_10026146
1144 Ga0307411_10071637
1145 Ga0307411_10158493
1146 Ga0307411_10632101
1147 Ga0307415_100016305
1148 Ga0307415_100159749
1149 Ga0307415_100179507
1150 Ga0307415_100784867
1151 Ga0373923_0027553
1152 Ga0373923_0330748
1153 Ga0373936_0353480
1154 Ga0373941_0173760
1155 Ga0373954_0033151
1156 Ga0373943_0016672
1157 Ga0373943_0148768
1158 Ga0373946_0066336
1159 Ga0373955_0002727
1160 Ga0373931_1027412
1161 Ga0373935_0018058
1162 Ga0373927_0093144
1163 Ga0373947_0316112
1164 Ga0373937_0010753
1165 Ga0373937_0222036
1166 Ga0373925_0010397
1167 Ga0373925_0332683
1168 Ga0395899_0014277
1169 Ga0395899_0072949
1170 Ga0395899_0084671
1171 Ga0395899_0118898
1172 Ga0395899_0130064
1173 Ga0395899_0139822
1174 Ga0395899_0147116
1175 Ga0395899_0306411
1176 Ga0395899_0375049
1177 Ga0395899_0403037
1178 Ga0395899_0411002
1179 Ga0395899_0434941
1180 Ga0395899_0660779
1181 Ga0395900_0001779
1182 Ga0395900_0003085
1183 Ga0395900_0009276
1184 Ga0395900_0010484
1185 Ga0395900_0033740
1186 Ga0395900_0040236
1187 Ga0395900_0041814
1188 Ga0395900_0060815
1189 Ga0395900_0073712
1190 Ga0395900_0149524
1191 Ga0395900_0198322
1192 Ga0395900_0265514
1193 Ga0395900_0546719
1194 Ga0395900_0675836
1195 Ga0395900_0679881
1196 Ga0395900_0754379
1197 Ga0395900_0778836
1198 Ga0395900_1468576
1199 Ga0395898_0011721
1200 Ga0395898_0021270
1201 Ga0395898_0052037
1202 Ga0395898_0142823
1203 Ga0395898_0154726
1204 Ga0395898_0277996
1205 Ga0395898_0379279
1206 Ga0395898_0500232
1207 Ga0395898_0986595
1208 Ga0395905_0000104
1209 Ga0395905_0004102
1210 Ga0395905_0008256
1211 Ga0395905_0023579
1212 Ga0395905_0029447
1213 Ga0395905_0034571
1214 Ga0395905_0036894
1215 Ga0395905_0037718
1216 Ga0395905_0045504
1217 Ga0395905_0085043
1218 Ga0395905_0086007
1219 Ga0395905_0094163
1220 Ga0395905_0208860
1221 Ga0395905_0244205
1222 Ga0395905_0282967
1223 Ga0395905_0423000
1224 Ga0395905_0478805
1225 Ga0395905_0517012
1226 Ga0395905_0569978
1227 Ga0395905_0647674
1228 Ga0395905_0700970
1229 Ga0395905_0729105
1230 Ga0395905_1142279
1231 Ga0436364_1387927
1232 Ga0395901_0000589
1233 Ga0395901_0000782
1234 Ga0395901_0103175
1235 Ga0395901_0113729
1236 Ga0395901_0131734
1237 Ga0395901_0247424
1238 Ga0395901_0262712
1239 Ga0395901_0296008
1240 Ga0395901_0358393
1241 Ga0395901_0492497
1242 Ga0395901_0514093
1243 Ga0395901_0827968
1244 Ga0395901_0905836
1245 Ga0439465_0022888
1246 Ga0439432_024907
1247 Ga0439449_0043119
1248 Ga0439458_0000590
1249 Ga0466972_0005975
1250 Ga0466972_0057561
1251 Ga0466972_0316434
1252 Ga0466965_0156053
1253 Ga0466961_0149153
1254 Ga0466961_0307191
1255 Ga0466961_0329009
1256 Ga0466961_0490775
1257 Ga0466963_0010178
1258 Ga0466963_0010200
1259 Ga0466963_0073140
1260 Ga0466963_0246625
1261 Ga0466963_0304119
1262 Ga0466963_0422153
1263 Ga0466963_0581271
1264 Ga0466964_0151035
1265 Ga0466964_0155698
1266 Ga0466971_0018356
1267 Ga0466971_0213122
1268 Ga0466971_0310596
1269 Ga0466968_0246394
1270 Ga0466957_0039900
1271 Ga0466957_0113584
1272 Ga0466957_0184562
1273 Ga0466957_0274535
1274 Ga0466957_0346149
1275 Ga0466957_0390324
1276 Ga0466957_0588571
1277 Ga0466957_0653508
1278 Ga0466960_0047367
1279 Ga0466959_0219829
1280 Ga0466959_0480705
1281 Ga0466958_0014825
1282 Ga0466958_0028552
1283 Ga0466958_0032340
1284 Ga0466958_0202812
1285 Ga0466958_0217883
1286 Ga0466958_0282868
1287 Ga0466967_0006997
1288 Ga0466967_0020005
1289 Ga0466967_0088576
1290 Ga0466967_0096507
1291 Ga0466967_0131886
1292 Ga0466967_0210613
1293 Ga0466967_0247910
1294 Ga0466967_0249305
1295 Ga0466967_0263869
1296 Ga0466967_0297358
1297 Ga0466967_0813755
1298 Ga0466967_0820870
1299 Ga0466967_0893570
1300 Ga0466967_1531166
1301 Ga0495650_0152204
1302 Ga0495631_0230384
1303 Ga0495663_0011260
1304 Ga0495663_0031760
1305 Ga0495621_0000972
1306 Ga0495633_0113394
1307 Ga0495668_0011856
1308 Ga0495623_0019538
1309 Ga0495647_0348113
1310 Ga0495669_0057703
1311 Ga0495669_0387596
1312 Ga0495670_0000071
1313 Ga0495677_0087929
1314 Ga0495602_0091257
1315 Ga0496101_0010849
1316 Ga0496101_0457142
1317 Ga0496102_0346638
1318 Ga0496102_0366584
1319 Ga0496104_0137509
1320 Ga0496105_0182962
1321 Ga0496106_0082568
1322 Ga0496106_0130672
1323 Ga0496107_0002900
1324 Ga0496107_0011494
1325 Ga0496107_0131555
1326 Ga0496108_0045905
1327 Ga0496108_0515020
1328 Ga0496109_0046481
1329 Ga0496109_0061186
1330 Ga0496109_0068968
1331 Ga0496109_0467267
1332 Ga0496109_0794783
1333 Ga0496110_0025175
1334 Ga0496110_0033905
1335 Ga0496110_0042482
1336 Ga0496110_0184234
1337 Ga0496110_0881018
1338 Ga0496111_0002376
1339 Ga0496111_0029259
1340 Ga0496112_0040418
1341 Ga0496112_0068145
1342 Ga0496112_0143489
1343 Ga0496112_0443531
1344 Ga0496113_0010921
1345 Ga0496113_0011965
1346 Ga0496113_0054432
1347 Ga0496114_0058951
1348 Ga0496115_0088057
1349 Ga0501202_058311
1350 Ga0501207_019395
1351 Ga0501217_067111
1352 Ga0501223_035357
1353 Ga0501233_005985
1354 Ga0501235_008407
1355 Ga0501239_006071
1356 Ga0501247_027531
1357 Ga0501249_018314
1358 Ga0501258_004127
1359 Ga0501221_009102
1360 Ga0501229_020960
1361 Ga0501268_000532
1362 Ga0501272_001757
1363 Ga0501273_010041
1364 Ga0500658_0000036
1365 Ga0587066_046458
1366 Ga0587080_010228
1367 Ga0587090_010448
1368 Ga0587128_026224
1369 Ga0587075_016693
1370 Ga0587079_075714
1371 Ga0466962_0006344
1372 Ga0466962_0015820
1373 Ga0466962_0120036
1374 Ga0466962_0330471

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00254

FKBP_C

FKBP-type peptidyl-prolyl cis-trans isomerase

59

149

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2l2s-assembly1.cif.gz_A solution structure of peptidyl-prolyl cis-trans isomerase from burkholderia pseudomallei complexed with 1-{[(4-methylphenyl)thio]acetyl}piperidine 0.8723 46 149
3vaw-assembly1.cif.gz_A crystal structure of a smt fusion peptidyl-prolyl cis-trans isomerase with surface mutation v3i from burkholderia pseudomallei complexed with fk506 0.8477 44 150
7dki-assembly2.cif.gz_B silk worm fkbp, isoform-1 0.847 49 151
4ipx-assembly1.cif.gz_A analyzing the visible conformational substates of the fk506 binding protein fkbp12 0.8468 49 151
5klx-assembly2.cif.gz_B crystal structure of smt fusion peptidyl-prolyl cis-trans isomerase from burkholderia pseudomallei complexed with sf110 0.844 41 150
ID Description Score Start End Superfamily
af_Q8I4E5_192_283_3.10.50.40 Alpha Beta;Roll;Chitinase A; domain 3; 0.8951 49 119 3.10.50.40
1q6uA02 Alpha Beta;Roll;Chitinase A; domain 3; 0.8441 49 153 3.10.50.40
af_Q95Q60_176_299_3.10.50.40 Alpha Beta;Roll;Chitinase A; domain 3; 0.8427 46 154 3.10.50.40
5xb0A02 Alpha Beta;Roll;Chitinase A; domain 3; 0.8396 49 153 3.10.50.40
4bf8A00 Alpha Beta;Roll;Chitinase A; domain 3; 0.8384 46 151 3.10.50.40
ID Description Score Start End GO Terms
AF-A0A2G8CLM2-F1-model_v4 deleted 0.8665 46 151
AF-A0A447LS44-F1-model_v4 deleted 0.8648 46 154
AF-A0A7X3V2A0-F1-model_v4 Peptidyl-prolyl cis-trans isomerase (EC 5.2.1.8) 0.8574 45 154 GO:0003755
AF-A0A7S1VTK7-F1-model_v4 peptidylprolyl isomerase (EC 5.2.1.8) 0.8572 48 154 GO:0003755
GO:0005783
GO:0061077
AF-A0A2V5LIT3-F1-model_v4 Peptidyl-prolyl cis-trans isomerase (EC 5.2.1.8) 0.8527 46 153 GO:0006457
GO:0140839
GO:0140840

Map