F475268

General Info

Members Datasets Scaffolds Average Seq Length
687 292 1374 195

Family's Representative Sequence

Representative Sequence 3300037466|Ga0395898_0473217|Ga0395898_0473217_48_743
Length 231
Sequence LPGRERIRPTPDTRDTVEEGRQAKVLDAVGGGGYSRREMRIAIAVFDGAEELDFAGPWEVLAAWRFLYPDDVEVVLVGENSEPVTCAKGMRVLPETCWDQLGDVDVLVYPGGRGTRAQLGDETIRTRLRALKERGTLMTSVCTGALVYADAGLLDGQPATTYWSAFDELLPLGRDIDPQPDERFVDNGDVVTAAGVSAGIDMALHLVGRLGTPDKAREVRRYIQYDPQPPY

Samples

Sample ID Description Type Environment
1 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
66 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
67 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
68 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
69 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
70 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
71 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
97 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
109 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
162 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
164 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
165 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
166 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
167 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
168 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
169 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
170 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
172 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
173 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
174 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
175 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
176 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
177 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
178 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
179 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
180 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
181 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
182 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
183 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
184 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
185 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
186 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
187 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
188 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
189 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
190 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
191 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
192 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
193 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
194 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
195 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
196 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
197 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
198 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
199 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
200 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
201 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
202 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
203 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
204 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
205 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
206 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
207 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
208 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
209 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
210 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
211 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
212 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
213 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
214 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
215 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
216 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
217 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
218 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
219 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
220 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
221 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
222 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
223 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
224 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
225 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
226 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
227 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
228 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
229 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
230 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
231 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
232 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
233 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
234 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
235 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
236 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
237 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
253 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
254 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
255 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
256 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
257 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
258 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
259 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
260 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
261 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
262 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
263 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
264 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
265 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
266 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
267 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
270 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
271 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
272 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
273 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
274 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
275 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
276 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
277 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
278 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
279 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
280 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
281 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
282 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
283 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
284 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
285 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
286 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
287 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
288 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
289 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
290 2837183177 Egibacter rhizosphaerae EGI 80759 Isolate Unclassified
291 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
292 2887443736 Ruania rhizosphaerae LNNU 22110 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.27
Metatranscriptomes 0.15
Isolates 0.58

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.73
Nodule 0
Rhizoplane 5.68
Rhizosphere 92.87
Stem 0
Stem Tuber 0
Unclassified 1.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395898_0473217 3300037466 Bacteria 1192
2 JGI24738J21930_10060445 3300002075 Bacteria 778
3 Ga0070658_10206543 3300005327 Bacteria 1658
4 Ga0070676_10135349 3300005328 Bacteria 1563
5 Ga0070676_10342472 3300005328 Bacteria 1026
6 Ga0070683_100077501 3300005329 Bacteria 3108
7 Ga0070683_100187044 3300005329 Bacteria 1966
8 Ga0070683_100327467 3300005329 Bacteria 1458
9 Ga0070670_100063272 3300005331 Bacteria 3175
10 Ga0070677_10145722 3300005333 Bacteria 1097
11 Ga0068869_100019121 3300005334 Bacteria 4674
12 Ga0068869_100096132 3300005334 Bacteria 2235
13 Ga0068869_100351337 3300005334 Bacteria 1202
14 Ga0070680_100016373 3300005336 Bacteria 5834
15 Ga0070680_100114983 3300005336 Bacteria 2241
16 Ga0070680_100415505 3300005336 Bacteria 1147
17 Ga0070682_100082652 3300005337 Bacteria 2082
18 Ga0070682_100125919 3300005337 Bacteria 1727
19 Ga0070682_100491835 3300005337 Bacteria 948
20 Ga0068868_100028222 3300005338 Bacteria 4288
21 Ga0068868_100090551 3300005338 Bacteria 2463
22 Ga0070660_100016163 3300005339 Bacteria 5411
23 Ga0070660_100091830 3300005339 Bacteria 2395
24 Ga0070689_100073756 3300005340 Bacteria 2670
25 Ga0070691_10356591 3300005341 Bacteria 813
26 Ga0070687_100189327 3300005343 Bacteria 1239
27 Ga0070661_100010361 3300005344 Bacteria 6481
28 Ga0070692_10032565 3300005345 Bacteria 2622
29 Ga0070668_100359247 3300005347 Bacteria 1235
30 Ga0070668_100739428 3300005347 Bacteria 870
31 Ga0070669_100455963 3300005353 Bacteria 1055
32 Ga0070675_100074888 3300005354 Bacteria 2813
33 Ga0070675_100458718 3300005354 Bacteria 1144
34 Ga0070671_100023590 3300005355 Bacteria 5036
35 Ga0070674_100040161 3300005356 Bacteria 3164
36 Ga0070674_100050130 3300005356 Bacteria 2873
37 Ga0070673_100003902 3300005364 Bacteria 9369
38 Ga0070673_100054318 3300005364 Bacteria 3151
39 Ga0070688_100005344 3300005365 Bacteria 6754
40 Ga0070659_100012939 3300005366 Bacteria 6202
41 Ga0070659_100034109 3300005366 Bacteria 3958
42 Ga0070659_100396529 3300005366 Bacteria 1164
43 Ga0070659_100405207 3300005366 Bacteria 1152
44 Ga0070713_100416564 3300005436 Bacteria 1257
45 Ga0070710_10320110 3300005437 Bacteria 1018
46 Ga0070701_10002004 3300005438 Bacteria 7716
47 Ga0070705_100010348 3300005440 Bacteria 4667
48 Ga0070700_100044711 3300005441 Bacteria 2729
49 Ga0070700_100214907 3300005441 Bacteria 1359
50 Ga0070694_100004756 3300005444 Bacteria 8178
51 Ga0070694_100188761 3300005444 Bacteria 1529
52 Ga0070708_100453248 3300005445 Bacteria 1210
53 Ga0070663_100034524 3300005455 Bacteria 3504
54 Ga0070663_100062852 3300005455 Bacteria 2678
55 Ga0070678_100587408 3300005456 Bacteria 993
56 Ga0070678_100845318 3300005456 Bacteria 834
57 Ga0070662_100092208 3300005457 Bacteria 2276
58 Ga0070662_100206938 3300005457 Bacteria 1559
59 Ga0070662_100596098 3300005457 Bacteria 929
60 Ga0070681_10006226 3300005458 Bacteria 11599
61 Ga0068867_100223929 3300005459 Bacteria 1517
62 Ga0070685_10007298 3300005466 Bacteria 5653
63 Ga0070685_10183740 3300005466 Bacteria 1348
64 Ga0070706_100125536 3300005467 Bacteria 2393
65 Ga0070706_100819378 3300005467 Bacteria 861
66 Ga0070698_100382223 3300005471 Bacteria 1341
67 Ga0070699_100861058 3300005518 Bacteria 830
68 Ga0070679_100496328 3300005530 Bacteria 1165
69 Ga0070684_100078363 3300005535 Bacteria 2920
70 Ga0070684_100099165 3300005535 Bacteria 2599
71 Ga0070684_100137660 3300005535 Bacteria 2206
72 Ga0070684_100430981 3300005535 Bacteria 1218
73 Ga0070684_100445335 3300005535 Bacteria 1197
74 Ga0070684_100469642 3300005535 Bacteria 1164
75 Ga0068853_100112902 3300005539 Bacteria 2415
76 Ga0068853_100300500 3300005539 Bacteria 1484
77 Ga0070672_100046252 3300005543 Bacteria 3371
78 Ga0070672_100047016 3300005543 Bacteria 3347
79 Ga0070672_100114591 3300005543 Bacteria 2200
80 Ga0070696_100032752 3300005546 Bacteria 3567
81 Ga0070696_100118561 3300005546 Bacteria 1913
82 Ga0070693_100019895 3300005547 Bacteria 3530
83 Ga0070693_100587885 3300005547 Unclassified 802
84 Ga0070704_100036650 3300005549 Bacteria 3344
85 Ga0070704_100249678 3300005549 Bacteria 1456
86 Ga0070704_100608671 3300005549 Bacteria 961
87 Ga0068855_100049089 3300005563 Bacteria 4979
88 Ga0068855_100100851 3300005563 Bacteria 3323
89 Ga0068855_100552650 3300005563 Bacteria 1246
90 Ga0070664_100016336 3300005564 Bacteria 6085
91 Ga0070664_100019654 3300005564 Bacteria 5558
92 Ga0070664_100077414 3300005564 Bacteria 2860
93 Ga0070664_100135686 3300005564 Bacteria 2163
94 Ga0068857_100038725 3300005577 Bacteria 4221
95 Ga0068857_100071372 3300005577 Bacteria 3093
96 Ga0068857_100499320 3300005577 Bacteria 1142
97 Ga0068854_100028107 3300005578 Bacteria 3882
98 Ga0068856_100042451 3300005614 Bacteria 4473
99 Ga0070702_100040524 3300005615 Bacteria 2606
100 Ga0070702_100457159 3300005615 Bacteria 928
101 Ga0068852_100078629 3300005616 Bacteria 2918
102 Ga0068852_100335025 3300005616 Bacteria 1473
103 Ga0068859_100039855 3300005617 Bacteria 4714
104 Ga0068859_100165139 3300005617 Bacteria 2294
105 Ga0068866_10027253 3300005718 Bacteria 2707
106 Ga0068866_10254698 3300005718 Bacteria 1076
107 Ga0068861_100054598 3300005719 Bacteria 3044
108 Ga0068861_100384044 3300005719 Bacteria 1242
109 Ga0068861_100633703 3300005719 Bacteria 985
110 Ga0068851_10378432 3300005834 Bacteria 829
111 Ga0068870_10116412 3300005840 Bacteria 1533
112 Ga0068870_10416842 3300005840 Bacteria 878
113 Ga0068863_100118827 3300005841 Bacteria 2520
114 Ga0068858_100053718 3300005842 Bacteria 3726
115 Ga0068860_100440073 3300005843 Bacteria 1295
116 Ga0068862_100424084 3300005844 Bacteria 1249
117 Ga0068862_100623529 3300005844 Bacteria 1038
118 Ga0081455_10003333 3300005937 Bacteria 18522
119 Ga0081455_10022485 3300005937 Bacteria 5892
120 Ga0081455_10076777 3300005937 Bacteria 2750
121 Ga0081455_10221106 3300005937 Bacteria 1403
122 Ga0081455_10529404 3300005937 Bacteria 784
123 Ga0081539_10214060 3300005985 Bacteria 881
124 Ga0070717_10001304 3300006028 Bacteria 17056
125 Ga0070717_10087031 3300006028 Bacteria 2631
126 Ga0075365_10028119 3300006038 Bacteria 3584
127 Ga0075432_10000929 3300006058 Bacteria 9228
128 Ga0075432_10030392 3300006058 Bacteria 1867
129 Ga0070712_100173254 3300006175 Bacteria 1676
130 Ga0075367_10104336 3300006178 Bacteria 1735
131 Ga0097621_100597205 3300006237 Bacteria 1009
132 Ga0068871_100238972 3300006358 Bacteria 1579
133 Ga0068871_101051625 3300006358 Bacteria 760
134 Ga0075428_100006251 3300006844 Bacteria 13240
135 Ga0075428_100080165 3300006844 Bacteria 3563
136 Ga0075428_100288118 3300006844 Bacteria 1767
137 Ga0075431_100064877 3300006847 Bacteria 3771
138 Ga0075433_10013818 3300006852 Bacteria 6581
139 Ga0075433_10310903 3300006852 Bacteria 1395
140 Ga0075433_10798134 3300006852 Bacteria 825
141 Ga0075429_100133301 3300006880 Bacteria 2173
142 Ga0068865_100030440 3300006881 Bacteria 3590
143 Ga0068865_100391038 3300006881 Bacteria 1137
144 Ga0075436_100009637 3300006914 Bacteria 6610
145 Ga0097620_100039852 3300006931 Bacteria 4714
146 Ga0097620_100165151 3300006931 Bacteria 2294
147 Ga0075435_100012166 3300007076 Bacteria 6363
148 Ga0105244_10107625 3300009036 Bacteria 1359
149 Ga0111539_10028144 3300009094 Bacteria 6861
150 Ga0111539_10032436 3300009094 Bacteria 6342
151 Ga0111539_10035531 3300009094 Bacteria 6032
152 Ga0111539_10179353 3300009094 Bacteria 2474
153 Ga0111539_10578771 3300009094 Bacteria 1308
154 Ga0111539_11094732 3300009094 Bacteria 926
155 Ga0111539_11787765 3300009094 Bacteria 713
156 Ga0105245_10086000 3300009098 Bacteria 2883
157 Ga0105245_10125667 3300009098 Bacteria 2401
158 Ga0105245_10137635 3300009098 Bacteria 2296
159 Ga0105245_10209120 3300009098 Bacteria 1877
160 Ga0105245_10429123 3300009098 Bacteria 1326
161 Ga0105247_10045120 3300009101 Bacteria 2704
162 Ga0114129_10004191 3300009147 Bacteria 20370
163 Ga0114129_10247503 3300009147 Bacteria 2394
164 Ga0114129_10571226 3300009147 Bacteria 1468
165 Ga0114129_11421556 3300009147 Bacteria 855
166 Ga0105243_10020037 3300009148 Bacteria 5071
167 Ga0105243_10052626 3300009148 Bacteria 3226
168 Ga0105243_10491815 3300009148 Bacteria 1160
169 Ga0105243_10779490 3300009148 Bacteria 940
170 Ga0105241_11277086 3300009174 Bacteria 698
171 Ga0105242_10315411 3300009176 Bacteria 1432
172 Ga0105242_10628589 3300009176 Bacteria 1041
173 Ga0105242_10891265 3300009176 Bacteria 889
174 Ga0105248_10039751 3300009177 Bacteria 5272
175 Ga0105248_10332724 3300009177 Bacteria 1710
176 Ga0105237_10845819 3300009545 Bacteria 922
177 Ga0105237_10973442 3300009545 Bacteria 855
178 Ga0105238_10024588 3300009551 Bacteria 6140
179 Ga0105249_10043015 3300009553 Bacteria 4109
180 Ga0105249_10194093 3300009553 Bacteria 1983
181 Ga0105239_10165729 3300010375 Bacteria 2471
182 Ga0105239_10231198 3300010375 Bacteria 2074
183 Ga0105239_10340688 3300010375 Bacteria 1692
184 Ga0105239_11659479 3300010375 Bacteria 739
185 Ga0105246_10025040 3300011119 Bacteria 3887
186 Ga0105246_10236776 3300011119 Bacteria 1441
187 Ga0105246_10494538 3300011119 Bacteria 1037
188 Ga0157373_10127595 3300013100 Bacteria 1789
189 Ga0157371_10012169 3300013102 Bacteria 6589
190 Ga0157371_10294410 3300013102 Unclassified 1174
191 Ga0157369_10064718 3300013105 Bacteria 3937
192 Ga0157369_10679626 3300013105 Bacteria 1061
193 Ga0157374_10224755 3300013296 Bacteria 1843
194 Ga0157374_10833202 3300013296 Bacteria 939
195 Ga0163162_10255285 3300013306 Bacteria 1885
196 Ga0163162_11174172 3300013306 Bacteria 871
197 Ga0157372_10145993 3300013307 Bacteria 2728
198 Ga0157372_10152544 3300013307 Bacteria 2667
199 Ga0157375_10218857 3300013308 Bacteria 2062
200 Ga0157375_11274991 3300013308 Bacteria 863
201 Ga0163163_10019989 3300014325 Bacteria 6300
202 Ga0157380_10020125 3300014326 Bacteria 4984
203 Ga0157380_10030641 3300014326 Bacteria 4122
204 Ga0157380_10058906 3300014326 Bacteria 3063
205 Ga0157380_12125027 3300014326 Bacteria 625
206 Ga0157377_10035697 3300014745 Bacteria 2729
207 Ga0157377_10057187 3300014745 Bacteria 2217
208 Ga0157377_10148802 3300014745 Bacteria 1446
209 Ga0157377_10369759 3300014745 Bacteria 967
210 Ga0157379_10065279 3300014968 Bacteria 3254
211 Ga0157376_10429966 3300014969 Bacteria 1283
212 Ga0157376_10478123 3300014969 Bacteria 1220
213 Ga0163161_10099723 3300017792 Bacteria 2160
214 Ga0206356_11084160 3300020070 Bacteria 1910
215 Ga0207682_10059027 3300025893 Bacteria 1602
216 Ga0207682_10187697 3300025893 Bacteria 946
217 Ga0207688_10038561 3300025901 Bacteria 2652
218 Ga0207688_10052185 3300025901 Bacteria 2291
219 Ga0207688_10343319 3300025901 Bacteria 919
220 Ga0207645_10166122 3300025907 Bacteria 1445
221 Ga0207645_10258636 3300025907 Bacteria 1153
222 Ga0207643_10008161 3300025908 Bacteria 5619
223 Ga0207643_10054447 3300025908 Bacteria 2274
224 Ga0207705_10083568 3300025909 Bacteria 2329
225 Ga0207705_10432922 3300025909 Bacteria 1019
226 Ga0207684_10600652 3300025910 Bacteria 940
227 Ga0207707_10067192 3300025912 Bacteria 3123
228 Ga0207707_10288841 3300025912 Bacteria 1419
229 Ga0207693_10068471 3300025915 Bacteria 2778
230 Ga0207660_10227267 3300025917 Bacteria 1466
231 Ga0207662_10009181 3300025918 Bacteria 5436
232 Ga0207657_10024404 3300025919 Bacteria 5599
233 Ga0207657_10131199 3300025919 Bacteria 2053
234 Ga0207657_10210592 3300025919 Bacteria 1560
235 Ga0207649_10034371 3300025920 Bacteria 3037
236 Ga0207652_10905182 3300025921 Bacteria 779
237 Ga0207681_10059121 3300025923 Bacteria 2627
238 Ga0207694_10539692 3300025924 Bacteria 978
239 Ga0207650_10065206 3300025925 Bacteria 2728
240 Ga0207659_10360852 3300025926 Bacteria 1208
241 Ga0207659_10396740 3300025926 Bacteria 1153
242 Ga0207659_10531468 3300025926 Bacteria 998
243 Ga0207687_10059219 3300025927 Bacteria 2697
244 Ga0207687_10076044 3300025927 Bacteria 2411
245 Ga0207687_10081423 3300025927 Bacteria 2340
246 Ga0207687_10160906 3300025927 Bacteria 1723
247 Ga0207700_10418735 3300025928 Bacteria 1176
248 Ga0207664_10008525 3300025929 Bacteria 7158
249 Ga0207664_10508018 3300025929 Bacteria 1079
250 Ga0207644_10047057 3300025931 Bacteria 3076
251 Ga0207690_10016008 3300025932 Bacteria 4557
252 Ga0207690_10028120 3300025932 Bacteria 3561
253 Ga0207690_10211599 3300025932 Bacteria 1478
254 Ga0207690_10533674 3300025932 Bacteria 952
255 Ga0207706_10011803 3300025933 Bacteria 7957
256 Ga0207706_10124285 3300025933 Bacteria 2270
257 Ga0207706_10212048 3300025933 Bacteria 1697
258 Ga0207706_10272831 3300025933 Bacteria 1476
259 Ga0207706_10612987 3300025933 Bacteria 934
260 Ga0207686_10066704 3300025934 Bacteria 2299
261 Ga0207709_10018207 3300025935 Bacteria 3930
262 Ga0207709_10195322 3300025935 Bacteria 1441
263 Ga0207670_10066437 3300025936 Bacteria 2478
264 Ga0207670_10597759 3300025936 Bacteria 906
265 Ga0207669_10229730 3300025937 Bacteria 1368
266 Ga0207669_10406028 3300025937 Bacteria 1068
267 Ga0207669_10410728 3300025937 Bacteria 1063
268 Ga0207704_10073121 3300025938 Bacteria 2182
269 Ga0207704_10389584 3300025938 Bacteria 1096
270 Ga0207691_10011627 3300025940 Bacteria 8449
271 Ga0207691_10024018 3300025940 Bacteria 5734
272 Ga0207691_10027612 3300025940 Bacteria 5321
273 Ga0207711_10160674 3300025941 Bacteria 2033
274 Ga0207689_10065068 3300025942 Bacteria 2999
275 Ga0207689_10253291 3300025942 Bacteria 1456
276 Ga0207661_10000759 3300025944 Bacteria 20992
277 Ga0207661_10048444 3300025944 Bacteria 3377
278 Ga0207661_10127499 3300025944 Bacteria 2175
279 Ga0207661_10535236 3300025944 Bacteria 1072
280 Ga0207661_10583180 3300025944 Bacteria 1026
281 Ga0207679_10011535 3300025945 Bacteria 5729
282 Ga0207679_10071012 3300025945 Bacteria 2625
283 Ga0207679_10116571 3300025945 Bacteria 2118
284 Ga0207667_10571232 3300025949 Bacteria 1142
285 Ga0207667_10980304 3300025949 Bacteria 833
286 Ga0207651_10078674 3300025960 Bacteria 2366
287 Ga0207651_10241692 3300025960 Bacteria 1472
288 Ga0207712_10686394 3300025961 Bacteria 893
289 Ga0207668_10234940 3300025972 Bacteria 1480
290 Ga0207668_11169484 3300025972 Bacteria 691
291 Ga0207640_10022999 3300025981 Bacteria 3740
292 Ga0207677_10036117 3300026023 Bacteria 3217
293 Ga0207677_10072862 3300026023 Bacteria 2430
294 Ga0207677_10984972 3300026023 Bacteria 764
295 Ga0207703_10511668 3300026035 Bacteria 1128
296 Ga0207703_10821117 3300026035 Bacteria 888
297 Ga0207639_10173835 3300026041 Bacteria 1826
298 Ga0207639_10175436 3300026041 Bacteria 1819
299 Ga0207678_10096689 3300026067 Bacteria 2524
300 Ga0207678_10103430 3300026067 Bacteria 2431
301 Ga0207708_10034676 3300026075 Bacteria 3839
302 Ga0207708_10112188 3300026075 Bacteria 2118
303 Ga0207708_10216928 3300026075 Bacteria 1531
304 Ga0207708_10603590 3300026075 Bacteria 930
305 Ga0207702_10054431 3300026078 Bacteria 3391
306 Ga0207702_10110652 3300026078 Bacteria 2441
307 Ga0207641_10181942 3300026088 Bacteria 1926
308 Ga0207676_10107005 3300026095 Bacteria 2331
309 Ga0207674_10030636 3300026116 Bacteria 5655
310 Ga0207674_10051508 3300026116 Bacteria 4201
311 Ga0207675_100070977 3300026118 Bacteria 3256
312 Ga0207675_100622348 3300026118 Bacteria 1084
313 Ga0207683_10032482 3300026121 Bacteria 4534
314 Ga0207683_10139784 3300026121 Bacteria 2181
315 Ga0207683_10444361 3300026121 Bacteria 1195
316 Ga0207698_10289929 3300026142 Bacteria 1518
317 Ga0207698_10395753 3300026142 Bacteria 1319
318 Ga0207698_10708275 3300026142 Bacteria 1002
319 Ga0209966_1033667 3300027695 Bacteria 1047
320 Ga0207428_10000223 3300027907 Bacteria 78687
321 Ga0207428_10016947 3300027907 Bacteria 6261
322 Ga0207428_10049508 3300027907 Bacteria 3367
323 Ga0268265_10047189 3300028380 Bacteria 3226
324 Ga0265338_10158201 3300028800 Bacteria 1752
325 Ga0307416_100828089 3300032002 Bacteria 1023
326 Ga0373958_0046189 3300034819 Bacteria 907
327 Ga0373939_0179549 3300035114 Bacteria 789
328 Ga0373953_0178347 3300035117 Bacteria 916
329 Ga0373931_0071070 3300035691 Bacteria 1900
330 Ga0373937_0672692 3300036401 Bacteria 981
331 Ga0373925_0542696 3300037068 Bacteria 956
332 Ga0395899_0001772 3300037312 Bacteria 17910
333 Ga0395899_0037441 3300037312 Bacteria 3636
334 Ga0395899_0129155 3300037312 Bacteria 1806
335 Ga0395899_0274923 3300037312 Bacteria 1148
336 Ga0395899_0371236 3300037312 Bacteria 952
337 Ga0395899_0431618 3300037312 Bacteria 866
338 Ga0395900_0001652 3300037418 Bacteria 26101
339 Ga0395900_0050503 3300037418 Bacteria 4283
340 Ga0395900_0057691 3300037418 Bacteria 3997
341 Ga0395900_0080983 3300037418 Bacteria 3336
342 Ga0395898_0001953 3300037466 Bacteria 26076
343 Ga0395898_0003869 3300037466 Bacteria 16542
344 Ga0395898_0163146 3300037466 Bacteria 2131
345 Ga0395905_0003548 3300037471 Bacteria 16616
346 Ga0395905_0008217 3300037471 Bacteria 10305
347 Ga0395905_0074220 3300037471 Bacteria 3187
348 Ga0395905_0112948 3300037471 Bacteria 2552
349 Ga0436364_0321234 3300037853 Bacteria 1068
350 Ga0436364_1501533 3300037853 Bacteria 3061
351 Ga0395901_0038094 3300038443 Bacteria 4973
352 Ga0395901_0105365 3300038443 Bacteria 2959
353 Ga0395901_0138235 3300038443 Bacteria 2560
354 Ga0395901_0229586 3300038443 Bacteria 1938
355 Ga0395901_0342568 3300038443 Bacteria 1544
356 Ga0395901_0512349 3300038443 Bacteria 1220
357 Ga0436365_1604692 3300039437 Unclassified 3205
358 Ga0439448_0092499 3300042005 Bacteria 1023
359 Ga0450911_020325 3300042115 Bacteria 867
360 Ga0450923_051599 3300042125 Bacteria 884
361 Ga0450907_002840 3300042146 Bacteria 3200
362 Ga0450918_008492 3300042531 Bacteria 1804
363 Ga0466965_0565104 3300044683 Bacteria 643
364 Ga0466966_0060980 3300044684 Bacteria 2380
365 Ga0466961_0008948 3300044693 Bacteria 6387
366 Ga0466961_0024673 3300044693 Bacteria 3868
367 Ga0466961_0107520 3300044693 Bacteria 1756
368 Ga0466961_0133119 3300044693 Bacteria 1558
369 Ga0466961_0140471 3300044693 Bacteria 1512
370 Ga0466963_0006723 3300044694 Bacteria 6831
371 Ga0466963_0040672 3300044694 Bacteria 3047
372 Ga0466963_0055318 3300044694 Bacteria 2639
373 Ga0466964_0125995 3300044706 Bacteria 1160
374 Ga0466971_0039904 3300044719 Bacteria 2108
375 Ga0466971_0051648 3300044719 Bacteria 1850
376 Ga0466971_0064614 3300044719 Bacteria 1657
377 Ga0466971_0065537 3300044719 Bacteria 1645
378 Ga0466968_0001328 3300044735 Bacteria 8845
379 Ga0466968_0182312 3300044735 Bacteria 977
380 Ga0466968_0279107 3300044735 Bacteria 799
381 Ga0466970_0053944 3300044765 Bacteria 2147
382 Ga0466970_0081747 3300044765 Bacteria 1747
383 Ga0466957_0017511 3300044842 Bacteria 4198
384 Ga0466957_0049649 3300044842 Bacteria 2551
385 Ga0466957_0068314 3300044842 Bacteria 2194
386 Ga0466957_0069853 3300044842 Bacteria 2170
387 Ga0466957_0274419 3300044842 Bacteria 1127
388 Ga0466960_0199464 3300044901 Bacteria 1092
389 Ga0466959_0038337 3300045049 Bacteria 3541
390 Ga0466959_0202632 3300045049 Bacteria 1381
391 Ga0451576_1159396 3300045051 Bacteria 808
392 Ga0466958_0009403 3300045836 Bacteria 5447
393 Ga0466958_0009952 3300045836 Bacteria 5313
394 Ga0466967_0005436 3300045976 Bacteria 8833
395 Ga0466967_0032083 3300045976 Bacteria 4431
396 Ga0466967_0062257 3300045976 Bacteria 3312
397 Ga0466967_0083995 3300045976 Bacteria 2880
398 Ga0466967_0102899 3300045976 Bacteria 2613
399 Ga0466967_0271468 3300045976 Bacteria 1625
400 Ga0466967_0595019 3300045976 Bacteria 1091
401 Ga0495592_0031445 3300046454 Bacteria 4011
402 Ga0495603_0016720 3300046455 Bacteria 4437
403 Ga0495641_0132021 3300046461 Bacteria 1115
404 Ga0495651_0002556 3300046462 Bacteria 14070
405 Ga0495651_0324481 3300046462 Bacteria 1025
406 Ga0495653_0020423 3300046463 Bacteria 5370
407 Ga0495653_0048653 3300046463 Bacteria 3272
408 Ga0495582_0033360 3300046473 Bacteria 2830
409 Ga0495664_0013665 3300046477 Bacteria 4608
410 Ga0495607_0337863 3300046501 Bacteria 698
411 Ga0495608_0064457 3300046511 Bacteria 2402
412 Ga0495608_0145636 3300046511 Bacteria 1511
413 Ga0495618_0075699 3300046514 Bacteria 2144
414 Ga0495628_0150750 3300046516 Bacteria 1771
415 Ga0495630_0005948 3300046517 Bacteria 8624
416 Ga0495630_0014710 3300046517 Bacteria 5705
417 Ga0495652_0037317 3300046529 Bacteria 4216
418 Ga0495587_0060476 3300046536 Bacteria 2221
419 Ga0495645_0042018 3300046543 Bacteria 3333
420 Ga0495645_0109826 3300046543 Bacteria 1952
421 Ga0495667_0053349 3300046559 Bacteria 2663
422 Ga0495667_0130205 3300046559 Bacteria 1623
423 Ga0495634_0052581 3300046642 Bacteria 2730
424 Ga0495635_0074130 3300046663 Bacteria 2331
425 Ga0495588_0149616 3300046674 Bacteria 1234
426 Ga0495599_0029993 3300046678 Bacteria 3411
427 Ga0495599_0093199 3300046678 Bacteria 1879
428 Ga0495600_0066871 3300046809 Bacteria 2349
429 Ga0495600_0393516 3300046809 Bacteria 863
430 Ga0495674_0057642 3300047319 Bacteria 3399
431 Ga0495680_0185451 3300047322 Bacteria 1499
432 Ga0495680_0214807 3300047322 Bacteria 1375
433 Ga0495675_0074093 3300047444 Bacteria 2146
434 Ga0495675_0246598 3300047444 Bacteria 1074
435 Ga0495684_0019530 3300047471 Bacteria 5220
436 Ga0495686_0013269 3300047472 Bacteria 5722
437 Ga0495602_0030868 3300048088 Bacteria 5075
438 Ga0496100_0062857 3300048903 Bacteria 2452
439 Ga0496100_0184627 3300048903 Bacteria 1510
440 Ga0496101_0092131 3300048904 Bacteria 2256
441 Ga0496102_0001304 3300048905 Bacteria 22424
442 Ga0496102_0097834 3300048905 Bacteria 2722
443 Ga0496104_0058346 3300048907 Bacteria 3653
444 Ga0496104_0116577 3300048907 Bacteria 2563
445 Ga0496104_0407556 3300048907 Bacteria 1272
446 Ga0496105_0133620 3300048908 Bacteria 2044
447 Ga0496105_0634699 3300048908 Bacteria 826
448 Ga0496106_0636909 3300048909 Bacteria 852
449 Ga0496107_0167682 3300048910 Bacteria 1629
450 Ga0496107_0270205 3300048910 Bacteria 1265
451 Ga0496107_0502916 3300048910 Bacteria 899
452 Ga0496108_0007834 3300048911 Bacteria 8658
453 Ga0496108_0013589 3300048911 Bacteria 6644
454 Ga0496108_0023081 3300048911 Bacteria 5118
455 Ga0496108_1007653 3300048911 Bacteria 711
456 Ga0496109_0025450 3300048912 Bacteria 5274
457 Ga0496109_0040868 3300048912 Bacteria 4201
458 Ga0496109_0399844 3300048912 Bacteria 1298
459 Ga0496110_0009085 3300048913 Bacteria 8022
460 Ga0496110_0017815 3300048913 Bacteria 5945
461 Ga0496110_0028285 3300048913 Bacteria 4813
462 Ga0496110_0475780 3300048913 Bacteria 1138
463 Ga0496110_0622988 3300048913 Bacteria 978
464 Ga0496110_0744883 3300048913 Bacteria 883
465 Ga0496111_0017790 3300048914 Bacteria 4915
466 Ga0496111_0072133 3300048914 Bacteria 2513
467 Ga0496111_0104050 3300048914 Bacteria 2088
468 Ga0496111_0376100 3300048914 Bacteria 1051
469 Ga0496111_0406639 3300048914 Bacteria 1006
470 Ga0496112_0052845 3300048915 Bacteria 3989
471 Ga0496113_0073117 3300048916 Bacteria 2611
472 Ga0496113_0842858 3300048916 Bacteria 727
473 Ga0496113_1088432 3300048916 Unclassified 627
474 Ga0496114_0044765 3300048917 Bacteria 3674
475 Ga0496114_0234239 3300048917 Bacteria 1614
476 Ga0496114_0518341 3300048917 Bacteria 1054
477 Ga0501031_0021724 3300049568 Bacteria 4183
478 Ga0501031_0036117 3300049568 Bacteria 3223
479 Ga0501031_0043677 3300049568 Bacteria 2924
480 Ga0501031_0296512 3300049568 Bacteria 1048
481 Ga0501032_0025327 3300049569 Bacteria 4090
482 Ga0501032_0168354 3300049569 Bacteria 1437
483 Ga0501032_0894946 3300049569 Bacteria 559
484 Ga0501033_0009434 3300049570 Bacteria 7513
485 Ga0501033_0088173 3300049570 Bacteria 2270
486 Ga0501034_0418598 3300049571 Bacteria 1261
487 Ga0501036_0002799 3300049572 Bacteria 13819
488 Ga0501036_0010020 3300049572 Bacteria 7806
489 Ga0501036_0025726 3300049572 Bacteria 4967
490 Ga0501036_0036097 3300049572 Bacteria 4182
491 Ga0501036_0166417 3300049572 Unclassified 1858
492 Ga0501036_0230928 3300049572 Bacteria 1553
493 Ga0501036_0251726 3300049572 Bacteria 1480
494 Ga0501037_0029651 3300049573 Bacteria 4042
495 Ga0501037_0057310 3300049573 Bacteria 2844
496 Ga0501037_0177149 3300049573 Bacteria 1514
497 Ga0501037_0229704 3300049573 Bacteria 1303
498 Ga0501037_0360308 3300049573 Bacteria 1002
499 Ga0501038_0006907 3300049574 Bacteria 10485
500 Ga0501038_0013793 3300049574 Bacteria 7363
501 Ga0501038_0049517 3300049574 Bacteria 3633
502 Ga0501038_0085693 3300049574 Bacteria 2648
503 Ga0501038_0251588 3300049574 Bacteria 1399
504 Ga0501039_0000969 3300049575 Bacteria 20851
505 Ga0501039_0009255 3300049575 Bacteria 7504
506 Ga0501039_0031371 3300049575 Bacteria 4097
507 Ga0501039_0081200 3300049575 Bacteria 2524
508 Ga0501039_0132955 3300049575 Bacteria 1953
509 Ga0501039_0169849 3300049575 Bacteria 1714
510 Ga0501039_0186004 3300049575 Bacteria 1633
511 Ga0501040_0008132 3300049576 Bacteria 6815
512 Ga0501040_0008147 3300049576 Bacteria 6812
513 Ga0501040_0008376 3300049576 Bacteria 6719
514 Ga0501040_0098674 3300049576 Bacteria 2036
515 Ga0501041_0003119 3300049577 Bacteria 9530
516 Ga0501041_0008988 3300049577 Bacteria 5878
517 Ga0501041_0010614 3300049577 Bacteria 5431
518 Ga0501041_0043312 3300049577 Bacteria 2736
519 Ga0501041_0103586 3300049577 Bacteria 1762
520 Ga0501042_0005126 3300049578 Bacteria 8409
521 Ga0501042_0032736 3300049578 Bacteria 3683
522 Ga0501042_0033533 3300049578 Bacteria 3640
523 Ga0501042_0048178 3300049578 Bacteria 3038
524 Ga0501042_0106786 3300049578 Bacteria 2015
525 Ga0501042_0867798 3300049578 Bacteria 657
526 Ga0501043_0128887 3300049579 Bacteria 1983
527 Ga0501046_0007430 3300049580 Bacteria 9633
528 Ga0501046_0007432 3300049580 Bacteria 9630
529 Ga0501046_0027101 3300049580 Bacteria 4679
530 Ga0501046_0031677 3300049580 Bacteria 4284
531 Ga0501046_0205958 3300049580 Bacteria 1462
532 Ga0501047_0895253 3300049581 Bacteria 701
533 Ga0501048_0003275 3300049582 Bacteria 12338
534 Ga0501048_0016984 3300049582 Bacteria 5363
535 Ga0501048_0021145 3300049582 Bacteria 4765
536 Ga0501048_0032460 3300049582 Bacteria 3773
537 Ga0501048_0044472 3300049582 Bacteria 3175
538 Ga0501048_0096282 3300049582 Bacteria 2088
539 Ga0501048_0098164 3300049582 Bacteria 2066
540 Ga0501048_0413588 3300049582 Bacteria 964
541 Ga0501067_0413190 3300049583 Unclassified 753
542 Ga0501068_0009988 3300049584 Bacteria 5322
543 Ga0501068_0015539 3300049584 Bacteria 4373
544 Ga0501068_0262065 3300049584 Bacteria 1103
545 Ga0501069_0011820 3300049585 Bacteria 4628
546 Ga0501069_0586350 3300049585 Bacteria 668
547 Ga0501070_0018935 3300049586 Bacteria 5775
548 Ga0501070_0035460 3300049586 Bacteria 4168
549 Ga0501070_0396868 3300049586 Bacteria 1116
550 Ga0501070_0630979 3300049586 Bacteria 852
551 Ga0501070_0904982 3300049586 Bacteria 688
552 Ga0501071_0004698 3300049587 Bacteria 8679
553 Ga0501071_0004920 3300049587 Bacteria 8525
554 Ga0501071_0018011 3300049587 Bacteria 4884
555 Ga0501071_0069749 3300049587 Bacteria 2560
556 Ga0501071_0072338 3300049587 Unclassified 2514
557 Ga0501071_0079277 3300049587 Bacteria 2401
558 Ga0501071_0181136 3300049587 Bacteria 1579
559 Ga0501071_0183637 3300049587 Bacteria 1567
560 Ga0501072_0002569 3300049588 Bacteria 13598
561 Ga0501072_0006712 3300049588 Bacteria 8749
562 Ga0501072_0007024 3300049588 Bacteria 8549
563 Ga0501072_0016802 3300049588 Bacteria 5620
564 Ga0501072_0033866 3300049588 Bacteria 4002
565 Ga0501072_0047309 3300049588 Bacteria 3387
566 Ga0501072_0137566 3300049588 Bacteria 1947
567 Ga0501072_0273914 3300049588 Bacteria 1343
568 Ga0501072_0291074 3300049588 Bacteria 1298
569 Ga0501072_0651667 3300049588 Bacteria 829
570 Ga0501073_0016725 3300049589 Bacteria 5314
571 Ga0501073_0072233 3300049589 Bacteria 2403
572 Ga0501074_0005492 3300049590 Bacteria 9119
573 Ga0501074_0025496 3300049590 Bacteria 4293
574 Ga0501074_0078048 3300049590 Bacteria 2376
575 Ga0501075_0005750 3300049591 Bacteria 8482
576 Ga0501075_0020524 3300049591 Bacteria 4808
577 Ga0501075_0036776 3300049591 Bacteria 3655
578 Ga0501075_0036845 3300049591 Bacteria 3651
579 Ga0501075_0168429 3300049591 Bacteria 1671
580 Ga0501075_0261800 3300049591 Bacteria 1318
581 Ga0501075_0523930 3300049591 Bacteria 904
582 Ga0501076_0007005 3300049592 Bacteria 8188
583 Ga0501076_0023198 3300049592 Bacteria 4780
584 Ga0501076_0044833 3300049592 Bacteria 3489
585 Ga0501076_0181499 3300049592 Bacteria 1716
586 Ga0501076_0208763 3300049592 Bacteria 1595
587 Ga0501076_0219877 3300049592 Bacteria 1552
588 Ga0501076_0318138 3300049592 Bacteria 1276
589 Ga0501077_0004936 3300049593 Bacteria 8097
590 Ga0501077_0015234 3300049593 Bacteria 4836
591 Ga0501077_0031363 3300049593 Bacteria 3381
592 Ga0501077_0047295 3300049593 Bacteria 2733
593 Ga0501077_0066570 3300049593 Bacteria 2285
594 Ga0501079_0004033 3300049741 Bacteria 10870
595 Ga0501079_0009705 3300049741 Bacteria 7297
596 Ga0501079_0049290 3300049741 Bacteria 3250
597 Ga0501079_0061861 3300049741 Bacteria 2887
598 Ga0501079_0125644 3300049741 Bacteria 1995
599 Ga0501079_0142349 3300049741 Bacteria 1868
600 Ga0501079_0579768 3300049741 Bacteria 882
601 Ga0501080_0024577 3300049742 Bacteria 5586
602 Ga0501080_0169003 3300049742 Unclassified 2017
603 Ga0501080_0284406 3300049742 Bacteria 1503
604 Ga0501081_0007245 3300049743 Bacteria 7209
605 Ga0501081_0009963 3300049743 Bacteria 6195
606 Ga0501081_0010820 3300049743 Bacteria 5959
607 Ga0501081_0028597 3300049743 Bacteria 3762
608 Ga0501081_0191134 3300049743 Bacteria 1482
609 Ga0501081_0282462 3300049743 Bacteria 1215
610 Ga0501081_0474455 3300049743 Bacteria 931
611 Ga0501081_0541232 3300049743 Bacteria 869
612 Ga0501083_0002948 3300049744 Bacteria 11790
613 Ga0501083_0040142 3300049744 Bacteria 3177
614 Ga0501083_0360650 3300049744 Bacteria 945
615 Ga0501035_0026293 3300049822 Bacteria 5326
616 Ga0501035_0711365 3300049822 Bacteria 809
617 Ga0501035_0790362 3300049822 Bacteria 759
618 Ga0501044_0045636 3300049823 Bacteria 4540
619 Ga0501044_0083504 3300049823 Bacteria 3230
620 Ga0501045_0002092 3300049824 Bacteria 13492
621 Ga0501045_0008918 3300049824 Bacteria 7003
622 Ga0501045_0013426 3300049824 Bacteria 5787
623 Ga0501045_0018537 3300049824 Bacteria 4952
624 Ga0501045_0023548 3300049824 Bacteria 4416
625 Ga0501045_0038371 3300049824 Bacteria 3483
626 Ga0501045_0039761 3300049824 Bacteria 3422
627 Ga0501045_0140964 3300049824 Bacteria 1793
628 Ga0501045_0142967 3300049824 Bacteria 1779
629 Ga0501045_0171887 3300049824 Bacteria 1614
630 nmdc:mga00v17_40897_c1 3300050491 Bacteria 2782
631 nmdc:mga0yw44_10552_c1 3300050492 Bacteria 4726
632 nmdc:mga06z11_95021_c1 3300050494 Bacteria 1625
633 nmdc:mga05p37_135933_c1 3300050507 Bacteria 3015
634 nmdc:mga05p37_431786_c1 3300050507 Bacteria 1530
635 nmdc:mga05p37_483712_c1 3300050507 Bacteria 1425
636 nmdc:mga05p37_56780_c1 3300050507 Bacteria 4820
637 nmdc:mga09592_48783_c1 3300050508 Bacteria 3570
638 nmdc:mga06r32_58706_c1 3300050510 Bacteria 3698
639 nmdc:mga08y16_132776_c1 3300050511 Bacteria 2588
640 nmdc:mga08y16_133397_c1 3300050511 Bacteria 2582
641 nmdc:mga08y16_15142_c1 3300050511 Bacteria 8107
642 nmdc:mga08y16_19667_c1 3300050511 Bacteria 7120
643 nmdc:mga08y16_26886_c1 3300050511 Bacteria 6063
644 nmdc:mga08y16_806226_c1 3300050511 Bacteria 931
645 nmdc:mga08y16_876389_c1 3300050511 Bacteria 885
646 nmdc:mga08y16_915485_c1 3300050511 Bacteria 862
647 nmdc:mga0n895_24864_c1 3300050512 Bacteria 5651
648 nmdc:mga0rr50_10352_c1 3300050513 Bacteria 5915
649 nmdc:mga08x19_569012_c1 3300050514 Bacteria 802
650 nmdc:mga08x19_91169_c1 3300050514 Bacteria 2012
651 nmdc:mga0a205_222269_c1 3300050515 Bacteria 1774
652 nmdc:mga0a205_510925_c1 3300050515 Bacteria 1058
653 Ga0495601_0008086 3300053077 Bacteria 6200
654 Ga0495601_0012433 3300053077 Bacteria 5107
655 Ga0495601_0051649 3300053077 Bacteria 2595
656 Ga0495612_0103935 3300053078 Bacteria 1211
657 Ga0495595_0011541 3300053084 Bacteria 3695
658 Ga0495595_0149096 3300053084 Bacteria 1150
659 Ga0495619_0013138 3300053085 Bacteria 5218
660 Ga0501084_0008792 3300054114 Bacteria 8355
661 Ga0501084_0010479 3300054114 Bacteria 7661
662 Ga0501084_0043036 3300054114 Bacteria 3777
663 Ga0501084_0046551 3300054114 Bacteria 3634
664 Ga0501084_0139367 3300054114 Bacteria 2042
665 Ga0501084_0190797 3300054114 Bacteria 1729
666 Ga0501084_1064318 3300054114 Bacteria 679
667 Ga0501082_0012124 3300060353 Bacteria 7407
668 Ga0501082_0054596 3300060353 Bacteria 3443
669 Ga0501082_0066215 3300060353 Bacteria 3111
670 Ga0501082_0072050 3300060353 Bacteria 2976
671 Ga0501082_0184609 3300060353 Bacteria 1814
672 Ga0501082_0290298 3300060353 Bacteria 1424
673 Ga0466962_0012488 3300061719 Bacteria 4083
674 Ga0466962_0026437 3300061719 Bacteria 2786
675 Ga0466962_0169694 3300061719 Bacteria 1062
676 Ga0530510_0004181 3300061734 Bacteria 9969
677 Ga0530510_0008207 3300061734 Bacteria 7283
678 Ga0530510_0010045 3300061734 Bacteria 6639
679 Ga0530510_0011563 3300061734 Bacteria 6195
680 Ga0530510_0011632 3300061734 Bacteria 6176
681 Ga0530510_0025409 3300061734 Bacteria 4235
682 Ga0530510_0101238 3300061734 Bacteria 2107
683 Ga0530510_0124687 3300061734 Bacteria 1892
684 2552109747 2551306166 Bacteria 9731570
685 2837187130 2837183177 Bacteria 4637169
686 2868088568 2868088558 Bacteria 7609351
687 2887444996 2887443736 Bacteria 4426037
688 Ga0395898_0473217
689 JGI24738J21930_10060445
690 Ga0070658_10206543
691 Ga0070676_10135349
692 Ga0070676_10342472
693 Ga0070683_100077501
694 Ga0070683_100187044
695 Ga0070683_100327467
696 Ga0070670_100063272
697 Ga0070677_10145722
698 Ga0068869_100019121
699 Ga0068869_100096132
700 Ga0068869_100351337
701 Ga0070680_100016373
702 Ga0070680_100114983
703 Ga0070680_100415505
704 Ga0070682_100082652
705 Ga0070682_100125919
706 Ga0070682_100491835
707 Ga0068868_100028222
708 Ga0068868_100090551
709 Ga0070660_100016163
710 Ga0070660_100091830
711 Ga0070689_100073756
712 Ga0070691_10356591
713 Ga0070687_100189327
714 Ga0070661_100010361
715 Ga0070692_10032565
716 Ga0070668_100359247
717 Ga0070668_100739428
718 Ga0070669_100455963
719 Ga0070675_100074888
720 Ga0070675_100458718
721 Ga0070671_100023590
722 Ga0070674_100040161
723 Ga0070674_100050130
724 Ga0070673_100003902
725 Ga0070673_100054318
726 Ga0070688_100005344
727 Ga0070659_100012939
728 Ga0070659_100034109
729 Ga0070659_100396529
730 Ga0070659_100405207
731 Ga0070713_100416564
732 Ga0070710_10320110
733 Ga0070701_10002004
734 Ga0070705_100010348
735 Ga0070700_100044711
736 Ga0070700_100214907
737 Ga0070694_100004756
738 Ga0070694_100188761
739 Ga0070708_100453248
740 Ga0070663_100034524
741 Ga0070663_100062852
742 Ga0070678_100587408
743 Ga0070678_100845318
744 Ga0070662_100092208
745 Ga0070662_100206938
746 Ga0070662_100596098
747 Ga0070681_10006226
748 Ga0068867_100223929
749 Ga0070685_10007298
750 Ga0070685_10183740
751 Ga0070706_100125536
752 Ga0070706_100819378
753 Ga0070698_100382223
754 Ga0070699_100861058
755 Ga0070679_100496328
756 Ga0070684_100078363
757 Ga0070684_100099165
758 Ga0070684_100137660
759 Ga0070684_100430981
760 Ga0070684_100445335
761 Ga0070684_100469642
762 Ga0068853_100112902
763 Ga0068853_100300500
764 Ga0070672_100046252
765 Ga0070672_100047016
766 Ga0070672_100114591
767 Ga0070696_100032752
768 Ga0070696_100118561
769 Ga0070693_100019895
770 Ga0070693_100587885
771 Ga0070704_100036650
772 Ga0070704_100249678
773 Ga0070704_100608671
774 Ga0068855_100049089
775 Ga0068855_100100851
776 Ga0068855_100552650
777 Ga0070664_100016336
778 Ga0070664_100019654
779 Ga0070664_100077414
780 Ga0070664_100135686
781 Ga0068857_100038725
782 Ga0068857_100071372
783 Ga0068857_100499320
784 Ga0068854_100028107
785 Ga0068856_100042451
786 Ga0070702_100040524
787 Ga0070702_100457159
788 Ga0068852_100078629
789 Ga0068852_100335025
790 Ga0068859_100039855
791 Ga0068859_100165139
792 Ga0068866_10027253
793 Ga0068866_10254698
794 Ga0068861_100054598
795 Ga0068861_100384044
796 Ga0068861_100633703
797 Ga0068851_10378432
798 Ga0068870_10116412
799 Ga0068870_10416842
800 Ga0068863_100118827
801 Ga0068858_100053718
802 Ga0068860_100440073
803 Ga0068862_100424084
804 Ga0068862_100623529
805 Ga0081455_10003333
806 Ga0081455_10022485
807 Ga0081455_10076777
808 Ga0081455_10221106
809 Ga0081455_10529404
810 Ga0081539_10214060
811 Ga0070717_10001304
812 Ga0070717_10087031
813 Ga0075365_10028119
814 Ga0075432_10000929
815 Ga0075432_10030392
816 Ga0070712_100173254
817 Ga0075367_10104336
818 Ga0097621_100597205
819 Ga0068871_100238972
820 Ga0068871_101051625
821 Ga0075428_100006251
822 Ga0075428_100080165
823 Ga0075428_100288118
824 Ga0075431_100064877
825 Ga0075433_10013818
826 Ga0075433_10310903
827 Ga0075433_10798134
828 Ga0075429_100133301
829 Ga0068865_100030440
830 Ga0068865_100391038
831 Ga0075436_100009637
832 Ga0097620_100039852
833 Ga0097620_100165151
834 Ga0075435_100012166
835 Ga0105244_10107625
836 Ga0111539_10028144
837 Ga0111539_10032436
838 Ga0111539_10035531
839 Ga0111539_10179353
840 Ga0111539_10578771
841 Ga0111539_11094732
842 Ga0111539_11787765
843 Ga0105245_10086000
844 Ga0105245_10125667
845 Ga0105245_10137635
846 Ga0105245_10209120
847 Ga0105245_10429123
848 Ga0105247_10045120
849 Ga0114129_10004191
850 Ga0114129_10247503
851 Ga0114129_10571226
852 Ga0114129_11421556
853 Ga0105243_10020037
854 Ga0105243_10052626
855 Ga0105243_10491815
856 Ga0105243_10779490
857 Ga0105241_11277086
858 Ga0105242_10315411
859 Ga0105242_10628589
860 Ga0105242_10891265
861 Ga0105248_10039751
862 Ga0105248_10332724
863 Ga0105237_10845819
864 Ga0105237_10973442
865 Ga0105238_10024588
866 Ga0105249_10043015
867 Ga0105249_10194093
868 Ga0105239_10165729
869 Ga0105239_10231198
870 Ga0105239_10340688
871 Ga0105239_11659479
872 Ga0105246_10025040
873 Ga0105246_10236776
874 Ga0105246_10494538
875 Ga0157373_10127595
876 Ga0157371_10012169
877 Ga0157371_10294410
878 Ga0157369_10064718
879 Ga0157369_10679626
880 Ga0157374_10224755
881 Ga0157374_10833202
882 Ga0163162_10255285
883 Ga0163162_11174172
884 Ga0157372_10145993
885 Ga0157372_10152544
886 Ga0157375_10218857
887 Ga0157375_11274991
888 Ga0163163_10019989
889 Ga0157380_10020125
890 Ga0157380_10030641
891 Ga0157380_10058906
892 Ga0157380_12125027
893 Ga0157377_10035697
894 Ga0157377_10057187
895 Ga0157377_10148802
896 Ga0157377_10369759
897 Ga0157379_10065279
898 Ga0157376_10429966
899 Ga0157376_10478123
900 Ga0163161_10099723
901 Ga0206356_11084160
902 Ga0207682_10059027
903 Ga0207682_10187697
904 Ga0207688_10038561
905 Ga0207688_10052185
906 Ga0207688_10343319
907 Ga0207645_10166122
908 Ga0207645_10258636
909 Ga0207643_10008161
910 Ga0207643_10054447
911 Ga0207705_10083568
912 Ga0207705_10432922
913 Ga0207684_10600652
914 Ga0207707_10067192
915 Ga0207707_10288841
916 Ga0207693_10068471
917 Ga0207660_10227267
918 Ga0207662_10009181
919 Ga0207657_10024404
920 Ga0207657_10131199
921 Ga0207657_10210592
922 Ga0207649_10034371
923 Ga0207652_10905182
924 Ga0207681_10059121
925 Ga0207694_10539692
926 Ga0207650_10065206
927 Ga0207659_10360852
928 Ga0207659_10396740
929 Ga0207659_10531468
930 Ga0207687_10059219
931 Ga0207687_10076044
932 Ga0207687_10081423
933 Ga0207687_10160906
934 Ga0207700_10418735
935 Ga0207664_10008525
936 Ga0207664_10508018
937 Ga0207644_10047057
938 Ga0207690_10016008
939 Ga0207690_10028120
940 Ga0207690_10211599
941 Ga0207690_10533674
942 Ga0207706_10011803
943 Ga0207706_10124285
944 Ga0207706_10212048
945 Ga0207706_10272831
946 Ga0207706_10612987
947 Ga0207686_10066704
948 Ga0207709_10018207
949 Ga0207709_10195322
950 Ga0207670_10066437
951 Ga0207670_10597759
952 Ga0207669_10229730
953 Ga0207669_10406028
954 Ga0207669_10410728
955 Ga0207704_10073121
956 Ga0207704_10389584
957 Ga0207691_10011627
958 Ga0207691_10024018
959 Ga0207691_10027612
960 Ga0207711_10160674
961 Ga0207689_10065068
962 Ga0207689_10253291
963 Ga0207661_10000759
964 Ga0207661_10048444
965 Ga0207661_10127499
966 Ga0207661_10535236
967 Ga0207661_10583180
968 Ga0207679_10011535
969 Ga0207679_10071012
970 Ga0207679_10116571
971 Ga0207667_10571232
972 Ga0207667_10980304
973 Ga0207651_10078674
974 Ga0207651_10241692
975 Ga0207712_10686394
976 Ga0207668_10234940
977 Ga0207668_11169484
978 Ga0207640_10022999
979 Ga0207677_10036117
980 Ga0207677_10072862
981 Ga0207677_10984972
982 Ga0207703_10511668
983 Ga0207703_10821117
984 Ga0207639_10173835
985 Ga0207639_10175436
986 Ga0207678_10096689
987 Ga0207678_10103430
988 Ga0207708_10034676
989 Ga0207708_10112188
990 Ga0207708_10216928
991 Ga0207708_10603590
992 Ga0207702_10054431
993 Ga0207702_10110652
994 Ga0207641_10181942
995 Ga0207676_10107005
996 Ga0207674_10030636
997 Ga0207674_10051508
998 Ga0207675_100070977
999 Ga0207675_100622348
1000 Ga0207683_10032482
1001 Ga0207683_10139784
1002 Ga0207683_10444361
1003 Ga0207698_10289929
1004 Ga0207698_10395753
1005 Ga0207698_10708275
1006 Ga0209966_1033667
1007 Ga0207428_10000223
1008 Ga0207428_10016947
1009 Ga0207428_10049508
1010 Ga0268265_10047189
1011 Ga0265338_10158201
1012 Ga0307416_100828089
1013 Ga0373958_0046189
1014 Ga0373939_0179549
1015 Ga0373953_0178347
1016 Ga0373931_0071070
1017 Ga0373937_0672692
1018 Ga0373925_0542696
1019 Ga0395899_0001772
1020 Ga0395899_0037441
1021 Ga0395899_0129155
1022 Ga0395899_0274923
1023 Ga0395899_0371236
1024 Ga0395899_0431618
1025 Ga0395900_0001652
1026 Ga0395900_0050503
1027 Ga0395900_0057691
1028 Ga0395900_0080983
1029 Ga0395898_0001953
1030 Ga0395898_0003869
1031 Ga0395898_0163146
1032 Ga0395905_0003548
1033 Ga0395905_0008217
1034 Ga0395905_0074220
1035 Ga0395905_0112948
1036 Ga0436364_0321234
1037 Ga0436364_1501533
1038 Ga0395901_0038094
1039 Ga0395901_0105365
1040 Ga0395901_0138235
1041 Ga0395901_0229586
1042 Ga0395901_0342568
1043 Ga0395901_0512349
1044 Ga0436365_1604692
1045 Ga0439448_0092499
1046 Ga0450911_020325
1047 Ga0450923_051599
1048 Ga0450907_002840
1049 Ga0450918_008492
1050 Ga0466965_0565104
1051 Ga0466966_0060980
1052 Ga0466961_0008948
1053 Ga0466961_0024673
1054 Ga0466961_0107520
1055 Ga0466961_0133119
1056 Ga0466961_0140471
1057 Ga0466963_0006723
1058 Ga0466963_0040672
1059 Ga0466963_0055318
1060 Ga0466964_0125995
1061 Ga0466971_0039904
1062 Ga0466971_0051648
1063 Ga0466971_0064614
1064 Ga0466971_0065537
1065 Ga0466968_0001328
1066 Ga0466968_0182312
1067 Ga0466968_0279107
1068 Ga0466970_0053944
1069 Ga0466970_0081747
1070 Ga0466957_0017511
1071 Ga0466957_0049649
1072 Ga0466957_0068314
1073 Ga0466957_0069853
1074 Ga0466957_0274419
1075 Ga0466960_0199464
1076 Ga0466959_0038337
1077 Ga0466959_0202632
1078 Ga0451576_1159396
1079 Ga0466958_0009403
1080 Ga0466958_0009952
1081 Ga0466967_0005436
1082 Ga0466967_0032083
1083 Ga0466967_0062257
1084 Ga0466967_0083995
1085 Ga0466967_0102899
1086 Ga0466967_0271468
1087 Ga0466967_0595019
1088 Ga0495592_0031445
1089 Ga0495603_0016720
1090 Ga0495641_0132021
1091 Ga0495651_0002556
1092 Ga0495651_0324481
1093 Ga0495653_0020423
1094 Ga0495653_0048653
1095 Ga0495582_0033360
1096 Ga0495664_0013665
1097 Ga0495607_0337863
1098 Ga0495608_0064457
1099 Ga0495608_0145636
1100 Ga0495618_0075699
1101 Ga0495628_0150750
1102 Ga0495630_0005948
1103 Ga0495630_0014710
1104 Ga0495652_0037317
1105 Ga0495587_0060476
1106 Ga0495645_0042018
1107 Ga0495645_0109826
1108 Ga0495667_0053349
1109 Ga0495667_0130205
1110 Ga0495634_0052581
1111 Ga0495635_0074130
1112 Ga0495588_0149616
1113 Ga0495599_0029993
1114 Ga0495599_0093199
1115 Ga0495600_0066871
1116 Ga0495600_0393516
1117 Ga0495674_0057642
1118 Ga0495680_0185451
1119 Ga0495680_0214807
1120 Ga0495675_0074093
1121 Ga0495675_0246598
1122 Ga0495684_0019530
1123 Ga0495686_0013269
1124 Ga0495602_0030868
1125 Ga0496100_0062857
1126 Ga0496100_0184627
1127 Ga0496101_0092131
1128 Ga0496102_0001304
1129 Ga0496102_0097834
1130 Ga0496104_0058346
1131 Ga0496104_0116577
1132 Ga0496104_0407556
1133 Ga0496105_0133620
1134 Ga0496105_0634699
1135 Ga0496106_0636909
1136 Ga0496107_0167682
1137 Ga0496107_0270205
1138 Ga0496107_0502916
1139 Ga0496108_0007834
1140 Ga0496108_0013589
1141 Ga0496108_0023081
1142 Ga0496108_1007653
1143 Ga0496109_0025450
1144 Ga0496109_0040868
1145 Ga0496109_0399844
1146 Ga0496110_0009085
1147 Ga0496110_0017815
1148 Ga0496110_0028285
1149 Ga0496110_0475780
1150 Ga0496110_0622988
1151 Ga0496110_0744883
1152 Ga0496111_0017790
1153 Ga0496111_0072133
1154 Ga0496111_0104050
1155 Ga0496111_0376100
1156 Ga0496111_0406639
1157 Ga0496112_0052845
1158 Ga0496113_0073117
1159 Ga0496113_0842858
1160 Ga0496113_1088432
1161 Ga0496114_0044765
1162 Ga0496114_0234239
1163 Ga0496114_0518341
1164 Ga0501031_0021724
1165 Ga0501031_0036117
1166 Ga0501031_0043677
1167 Ga0501031_0296512
1168 Ga0501032_0025327
1169 Ga0501032_0168354
1170 Ga0501032_0894946
1171 Ga0501033_0009434
1172 Ga0501033_0088173
1173 Ga0501034_0418598
1174 Ga0501036_0002799
1175 Ga0501036_0010020
1176 Ga0501036_0025726
1177 Ga0501036_0036097
1178 Ga0501036_0166417
1179 Ga0501036_0230928
1180 Ga0501036_0251726
1181 Ga0501037_0029651
1182 Ga0501037_0057310
1183 Ga0501037_0177149
1184 Ga0501037_0229704
1185 Ga0501037_0360308
1186 Ga0501038_0006907
1187 Ga0501038_0013793
1188 Ga0501038_0049517
1189 Ga0501038_0085693
1190 Ga0501038_0251588
1191 Ga0501039_0000969
1192 Ga0501039_0009255
1193 Ga0501039_0031371
1194 Ga0501039_0081200
1195 Ga0501039_0132955
1196 Ga0501039_0169849
1197 Ga0501039_0186004
1198 Ga0501040_0008132
1199 Ga0501040_0008147
1200 Ga0501040_0008376
1201 Ga0501040_0098674
1202 Ga0501041_0003119
1203 Ga0501041_0008988
1204 Ga0501041_0010614
1205 Ga0501041_0043312
1206 Ga0501041_0103586
1207 Ga0501042_0005126
1208 Ga0501042_0032736
1209 Ga0501042_0033533
1210 Ga0501042_0048178
1211 Ga0501042_0106786
1212 Ga0501042_0867798
1213 Ga0501043_0128887
1214 Ga0501046_0007430
1215 Ga0501046_0007432
1216 Ga0501046_0027101
1217 Ga0501046_0031677
1218 Ga0501046_0205958
1219 Ga0501047_0895253
1220 Ga0501048_0003275
1221 Ga0501048_0016984
1222 Ga0501048_0021145
1223 Ga0501048_0032460
1224 Ga0501048_0044472
1225 Ga0501048_0096282
1226 Ga0501048_0098164
1227 Ga0501048_0413588
1228 Ga0501067_0413190
1229 Ga0501068_0009988
1230 Ga0501068_0015539
1231 Ga0501068_0262065
1232 Ga0501069_0011820
1233 Ga0501069_0586350
1234 Ga0501070_0018935
1235 Ga0501070_0035460
1236 Ga0501070_0396868
1237 Ga0501070_0630979
1238 Ga0501070_0904982
1239 Ga0501071_0004698
1240 Ga0501071_0004920
1241 Ga0501071_0018011
1242 Ga0501071_0069749
1243 Ga0501071_0072338
1244 Ga0501071_0079277
1245 Ga0501071_0181136
1246 Ga0501071_0183637
1247 Ga0501072_0002569
1248 Ga0501072_0006712
1249 Ga0501072_0007024
1250 Ga0501072_0016802
1251 Ga0501072_0033866
1252 Ga0501072_0047309
1253 Ga0501072_0137566
1254 Ga0501072_0273914
1255 Ga0501072_0291074
1256 Ga0501072_0651667
1257 Ga0501073_0016725
1258 Ga0501073_0072233
1259 Ga0501074_0005492
1260 Ga0501074_0025496
1261 Ga0501074_0078048
1262 Ga0501075_0005750
1263 Ga0501075_0020524
1264 Ga0501075_0036776
1265 Ga0501075_0036845
1266 Ga0501075_0168429
1267 Ga0501075_0261800
1268 Ga0501075_0523930
1269 Ga0501076_0007005
1270 Ga0501076_0023198
1271 Ga0501076_0044833
1272 Ga0501076_0181499
1273 Ga0501076_0208763
1274 Ga0501076_0219877
1275 Ga0501076_0318138
1276 Ga0501077_0004936
1277 Ga0501077_0015234
1278 Ga0501077_0031363
1279 Ga0501077_0047295
1280 Ga0501077_0066570
1281 Ga0501079_0004033
1282 Ga0501079_0009705
1283 Ga0501079_0049290
1284 Ga0501079_0061861
1285 Ga0501079_0125644
1286 Ga0501079_0142349
1287 Ga0501079_0579768
1288 Ga0501080_0024577
1289 Ga0501080_0169003
1290 Ga0501080_0284406
1291 Ga0501081_0007245
1292 Ga0501081_0009963
1293 Ga0501081_0010820
1294 Ga0501081_0028597
1295 Ga0501081_0191134
1296 Ga0501081_0282462
1297 Ga0501081_0474455
1298 Ga0501081_0541232
1299 Ga0501083_0002948
1300 Ga0501083_0040142
1301 Ga0501083_0360650
1302 Ga0501035_0026293
1303 Ga0501035_0711365
1304 Ga0501035_0790362
1305 Ga0501044_0045636
1306 Ga0501044_0083504
1307 Ga0501045_0002092
1308 Ga0501045_0008918
1309 Ga0501045_0013426
1310 Ga0501045_0018537
1311 Ga0501045_0023548
1312 Ga0501045_0038371
1313 Ga0501045_0039761
1314 Ga0501045_0140964
1315 Ga0501045_0142967
1316 Ga0501045_0171887
1317 nmdc:mga00v17_40897_c1
1318 nmdc:mga0yw44_10552_c1
1319 nmdc:mga06z11_95021_c1
1320 nmdc:mga05p37_135933_c1
1321 nmdc:mga05p37_431786_c1
1322 nmdc:mga05p37_483712_c1
1323 nmdc:mga05p37_56780_c1
1324 nmdc:mga09592_48783_c1
1325 nmdc:mga06r32_58706_c1
1326 nmdc:mga08y16_132776_c1
1327 nmdc:mga08y16_133397_c1
1328 nmdc:mga08y16_15142_c1
1329 nmdc:mga08y16_19667_c1
1330 nmdc:mga08y16_26886_c1
1331 nmdc:mga08y16_806226_c1
1332 nmdc:mga08y16_876389_c1
1333 nmdc:mga08y16_915485_c1
1334 nmdc:mga0n895_24864_c1
1335 nmdc:mga0rr50_10352_c1
1336 nmdc:mga08x19_569012_c1
1337 nmdc:mga08x19_91169_c1
1338 nmdc:mga0a205_222269_c1
1339 nmdc:mga0a205_510925_c1
1340 Ga0495601_0008086
1341 Ga0495601_0012433
1342 Ga0495601_0051649
1343 Ga0495612_0103935
1344 Ga0495595_0011541
1345 Ga0495595_0149096
1346 Ga0495619_0013138
1347 Ga0501084_0008792
1348 Ga0501084_0010479
1349 Ga0501084_0043036
1350 Ga0501084_0046551
1351 Ga0501084_0139367
1352 Ga0501084_0190797
1353 Ga0501084_1064318
1354 Ga0501082_0012124
1355 Ga0501082_0054596
1356 Ga0501082_0066215
1357 Ga0501082_0072050
1358 Ga0501082_0184609
1359 Ga0501082_0290298
1360 Ga0466962_0012488
1361 Ga0466962_0026437
1362 Ga0466962_0169694
1363 Ga0530510_0004181
1364 Ga0530510_0008207
1365 Ga0530510_0010045
1366 Ga0530510_0011563
1367 Ga0530510_0011632
1368 Ga0530510_0025409
1369 Ga0530510_0101238
1370 Ga0530510_0124687
1371 2552109747
1372 2837187130
1373 2868088568
1374 2887444996

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01965

DJ-1_PfpI

DJ-1/PfpI family

39

209

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3noq-assembly1.cif.gz_A crystal structure of c101s isocyanide hydratase from pseudomonas fluorescens 0.9243 2 195
7l9q-assembly1.cif.gz_B wild-type pseudomonas fluorescens isocyanide hydratase (wt-1) at 274k, refmac5-refined 0.9178 2 195
3noo-assembly1.cif.gz_B crystal structure of c101a isocyanide hydratase from pseudomonas fluorescens 0.9175 1 195
7la0-assembly1.cif.gz_B pseudomonas fluorescens g150a isocyanide hydratase (g150a-2) at 274k, refmac5-refined 0.9173 2 195
3nor-assembly1.cif.gz_A-2 crystal structure of t102s isocyanide hydratase from pseudomonas fluorescens 0.9121 2 195
ID Description Score Start End Superfamily
3norA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9121 2 195 3.40.50.880
af_O16228_2_184_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9096 1 189 3.40.50.880
3mgkA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9067 1 189 3.40.50.880
af_O88767_1_189_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9039 2 187 3.40.50.880
af_I6Y6S3_1_186_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9011 37 195 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A0B8NRN2-F1-model_v4 Thiamine biosynthesis protein ThiJ 0.9884 2 167 GO:0006355
AF-A0A7V9V6E1-F1-model_v4 DJ-1/PfpI family protein 0.9858 1 136
AF-A0A1H0J4L8-F1-model_v4 DJ-1/PfpI family protein 0.9828 2 189 GO:0006355
AF-A0A2A3FTP8-F1-model_v4 Thiamine biosynthesis protein ThiJ 0.9807 1 191 GO:0006355
AF-A0A523F3A2-F1-model_v4 deleted 0.9796 1 139

Map