F475201

General Info

Members Datasets Scaffolds Average Seq Length
686 355 1372 97

Family's Representative Sequence

Representative Sequence 3300044694|Ga0466963_0624680|Ga0466963_0624680_229_525
Length 98
Sequence VSGAAQSIPDAARPKLSRGVRLTHNEAQGGWVLLAPERVFKADAVTAEILKRCDGEKTLTEIVDDLCSAFTGAPRERIHADVNNLLGALVEKRLLELG

Samples

Sample ID Description Type Environment
1 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
73 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
74 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
75 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
76 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
77 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
78 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
79 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
80 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
81 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
82 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
83 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
86 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
87 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
88 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
89 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
90 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
92 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
93 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
94 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
95 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
96 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
98 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
99 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
100 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
101 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
102 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
103 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
104 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
105 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
106 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
107 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
108 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
109 3300012477 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 Metagenome Rhizosphere
110 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
111 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
112 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
113 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
114 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
115 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
116 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
117 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
118 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
119 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
120 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
121 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
122 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
123 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
124 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
125 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
126 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
127 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
128 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
129 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
130 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
188 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
189 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
190 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
194 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
195 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
196 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
197 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
198 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
199 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
200 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
201 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
202 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
203 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
204 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
205 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
206 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
207 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
208 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
209 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
210 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
211 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
212 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
213 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
214 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
215 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
216 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
217 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
218 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
219 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
220 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
221 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
222 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
223 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
224 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
225 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
226 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
227 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
228 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
229 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
230 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
231 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
232 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
233 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
234 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
235 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
236 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
237 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
238 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
239 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
240 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
241 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
242 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
243 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
244 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
245 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
246 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
247 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
248 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
249 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
250 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
251 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
252 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
253 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
254 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
255 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
256 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
257 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
258 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
259 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
260 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
261 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
262 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
263 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
264 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
265 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
266 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
267 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
268 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
269 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
270 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
271 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
272 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
273 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
274 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
275 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
276 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
277 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
278 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
279 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
280 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
281 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
282 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
283 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
284 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
285 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
286 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
287 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
288 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
289 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
290 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
291 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
292 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
293 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
294 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
295 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
296 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
297 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
298 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
299 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
300 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
301 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
302 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
303 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
304 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
305 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
306 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
307 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
308 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
309 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
310 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
311 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
312 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
313 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
314 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
315 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
316 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
317 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
318 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
319 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
320 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
321 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
322 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
323 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
324 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
325 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
326 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
327 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
328 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
329 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
330 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
331 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
332 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
333 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
334 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
335 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
336 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
337 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
338 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
339 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
340 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
341 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
342 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
343 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
344 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
345 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
346 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
347 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
348 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
349 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
350 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
351 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
352 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
353 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
354 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
355 2952252522 Salinicola sp. DM10 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.56
Metatranscriptomes 0.29
Isolates 0.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.33
Nodule 0
Rhizoplane 9.77
Rhizosphere 85.42
Stem 0
Stem Tuber 0
Unclassified 9.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466963_0624680 3300044694 Bacteria 760
2 JGI24743J22301_10133613 3300001991 Bacteria 549
3 JGI24749J21850_1084059 3300002076 Bacteria 503
4 JGI24034J26672_10037084 3300002239 Bacteria 810
5 JGI24751J29686_10039408 3300002459 Bacteria 978
6 JGI25407J50210_10063419 3300003373 Unclassified 926
7 Ga0065712_10272598 3300005290 Bacteria 910
8 Ga0065715_10285387 3300005293 Bacteria 1064
9 Ga0070676_10402554 3300005328 Bacteria 953
10 Ga0070683_100329168 3300005329 Bacteria 1454
11 Ga0070690_100030808 3300005330 Bacteria 3338
12 Ga0070690_100143050 3300005330 Bacteria 1625
13 Ga0070670_100055475 3300005331 Bacteria 3401
14 Ga0070670_100285897 3300005331 Bacteria 1440
15 Ga0070670_102008191 3300005331 Bacteria 533
16 Ga0070677_10521355 3300005333 Unclassified 647
17 Ga0068869_100921628 3300005334 Bacteria 757
18 Ga0068869_101690178 3300005334 Unclassified 565
19 Ga0070666_10009458 3300005335 Bacteria 6077
20 Ga0070682_100114850 3300005337 Bacteria 1800
21 Ga0068868_100006290 3300005338 Bacteria 8394
22 Ga0070660_100050740 3300005339 Bacteria 3193
23 Ga0070660_100198563 3300005339 Bacteria 1627
24 Ga0070689_100181504 3300005340 Bacteria 1710
25 Ga0070689_100309660 3300005340 Bacteria 1316
26 Ga0070689_101162681 3300005340 Bacteria 691
27 Ga0070687_100006110 3300005343 Bacteria 4916
28 Ga0070687_100170611 3300005343 Bacteria 1295
29 Ga0070661_100071570 3300005344 Bacteria 2552
30 Ga0070692_10397534 3300005345 Bacteria 869
31 Ga0070668_100092388 3300005347 Bacteria 2387
32 Ga0070669_100252607 3300005353 Bacteria 1404
33 Ga0070669_101258776 3300005353 Bacteria 640
34 Ga0070675_101148500 3300005354 Unclassified 715
35 Ga0070671_100033645 3300005355 Bacteria 4241
36 Ga0070671_101331741 3300005355 Bacteria 634
37 Ga0070674_100024434 3300005356 Bacteria 3922
38 Ga0070674_100379371 3300005356 Bacteria 1150
39 Ga0070673_100013598 3300005364 Bacteria 5639
40 Ga0070673_100520430 3300005364 Bacteria 1078
41 Ga0070688_100006606 3300005365 Bacteria 6208
42 Ga0070688_100130893 3300005365 Bacteria 1692
43 Ga0070688_101432006 3300005365 Bacteria 561
44 Ga0070667_100015293 3300005367 Bacteria 6343
45 Ga0070667_100048564 3300005367 Bacteria 3572
46 Ga0070709_10005714 3300005434 Bacteria 6748
47 Ga0070709_10043373 3300005434 Bacteria 2781
48 Ga0070714_100030535 3300005435 Bacteria 4486
49 Ga0070713_100013214 3300005436 Bacteria 6087
50 Ga0070713_100201139 3300005436 Bacteria 1799
51 Ga0070710_10002327 3300005437 Bacteria 8997
52 Ga0070710_10405645 3300005437 Unclassified 914
53 Ga0070701_10455162 3300005438 Bacteria 822
54 Ga0070711_100014478 3300005439 Bacteria 4969
55 Ga0070705_100025822 3300005440 Bacteria 3189
56 Ga0070694_100625827 3300005444 Unclassified 869
57 Ga0070663_100029224 3300005455 Bacteria 3763
58 Ga0070663_100035327 3300005455 Bacteria 3467
59 Ga0070678_100030092 3300005456 Bacteria 3727
60 Ga0070678_100065969 3300005456 Bacteria 2689
61 Ga0070662_100016429 3300005457 Bacteria 4971
62 Ga0070681_10025368 3300005458 Bacteria 5962
63 Ga0070681_10304903 3300005458 Bacteria 1502
64 Ga0068867_100099224 3300005459 Bacteria 2221
65 Ga0070685_10035288 3300005466 Bacteria 2820
66 Ga0070685_10893840 3300005466 Bacteria 660
67 Ga0070685_11008241 3300005466 Unclassified 625
68 Ga0070707_101762973 3300005468 Unclassified 586
69 Ga0070679_100265614 3300005530 Bacteria 1671
70 Ga0070679_100309220 3300005530 Bacteria 1530
71 Ga0070684_102016953 3300005535 Bacteria 545
72 Ga0070697_100578882 3300005536 Bacteria 986
73 Ga0068853_100387020 3300005539 Bacteria 1307
74 Ga0068853_101058506 3300005539 Unclassified 782
75 Ga0070672_100080043 3300005543 Bacteria 2617
76 Ga0070686_100016976 3300005544 Bacteria 4244
77 Ga0070686_100696940 3300005544 Bacteria 810
78 Ga0070686_101933448 3300005544 Bacteria 504
79 Ga0070695_100315385 3300005545 Unclassified 1160
80 Ga0070695_100531117 3300005545 Bacteria 914
81 Ga0070696_100242998 3300005546 Bacteria 1359
82 Ga0070696_101586667 3300005546 Bacteria 562
83 Ga0070693_100247638 3300005547 Bacteria 1180
84 Ga0070665_100046816 3300005548 Bacteria 4342
85 Ga0070665_100894680 3300005548 Unclassified 900
86 Ga0068855_100413284 3300005563 Bacteria 1477
87 Ga0068855_101205439 3300005563 Bacteria 787
88 Ga0070664_100094221 3300005564 Bacteria 2596
89 Ga0068857_100228404 3300005577 Bacteria 1701
90 Ga0068857_100540904 3300005577 Bacteria 1096
91 Ga0068854_100537753 3300005578 Unclassified 989
92 Ga0068856_100339682 3300005614 Bacteria 1520
93 Ga0068856_100540835 3300005614 Bacteria 1186
94 Ga0070702_100192265 3300005615 Bacteria 1344
95 Ga0070702_100260317 3300005615 Bacteria 1181
96 Ga0070702_101659509 3300005615 Bacteria 530
97 Ga0068852_100164786 3300005616 Bacteria 2073
98 Ga0068859_100500351 3300005617 Bacteria 1310
99 Ga0068859_100527485 3300005617 Bacteria 1276
100 Ga0068864_100004887 3300005618 Bacteria 10977
101 Ga0068864_100019679 3300005618 Bacteria 5645
102 Ga0068864_101062289 3300005618 Bacteria 805
103 Ga0068864_101646702 3300005618 Bacteria 646
104 Ga0068866_10044762 3300005718 Bacteria 2216
105 Ga0068866_10604575 3300005718 Bacteria 741
106 Ga0068861_101084978 3300005719 Bacteria 769
107 Ga0068870_10036055 3300005840 Bacteria 2542
108 Ga0068863_100505648 3300005841 Bacteria 1190
109 Ga0068863_100633191 3300005841 Bacteria 1060
110 Ga0068858_100015727 3300005842 Bacteria 7116
111 Ga0068858_100241082 3300005842 Bacteria 1716
112 Ga0068858_101475397 3300005842 Unclassified 670
113 Ga0068860_100203516 3300005843 Bacteria 1919
114 Ga0068860_100498534 3300005843 Bacteria 1215
115 Ga0068860_101913190 3300005843 Bacteria 615
116 Ga0068862_101050473 3300005844 Bacteria 808
117 Ga0081455_10000444 3300005937 Bacteria 54433
118 Ga0081455_10039105 3300005937 Bacteria 4195
119 Ga0081538_10025680 3300005981 Bacteria 4144
120 Ga0081538_10188303 3300005981 Bacteria 871
121 Ga0081540_1014094 3300005983 Bacteria 5147
122 Ga0081540_1017788 3300005983 Bacteria 4388
123 Ga0081540_1047799 3300005983 Bacteria 2148
124 Ga0081539_10021059 3300005985 Bacteria 4373
125 Ga0070717_10000396 3300006028 Bacteria 27915
126 Ga0070717_10128074 3300006028 Bacteria 2181
127 Ga0070717_10359663 3300006028 Bacteria 1303
128 Ga0070717_11004753 3300006028 Bacteria 760
129 Ga0075365_10519445 3300006038 Bacteria 842
130 Ga0075363_100449670 3300006048 Unclassified 761
131 Ga0070715_10002900 3300006163 Bacteria 5351
132 Ga0070715_10130706 3300006163 Bacteria 1208
133 Ga0070715_10245226 3300006163 Bacteria 933
134 Ga0070715_10268793 3300006163 Bacteria 899
135 Ga0070715_11029599 3300006163 Bacteria 515
136 Ga0070716_100000927 3300006173 Bacteria 12708
137 Ga0070716_101096975 3300006173 Bacteria 634
138 Ga0070716_101819426 3300006173 Bacteria 505
139 Ga0070712_100099209 3300006175 Bacteria 2149
140 Ga0075367_10133370 3300006178 Bacteria 1536
141 Ga0097621_100016731 3300006237 Bacteria 5554
142 Ga0097621_100214715 3300006237 Bacteria 1674
143 Ga0068871_100007646 3300006358 Bacteria 7731
144 Ga0068871_100417343 3300006358 Bacteria 1198
145 Ga0068871_100743537 3300006358 Bacteria 901
146 Ga0075428_100657098 3300006844 Bacteria 1118
147 Ga0075428_101368691 3300006844 Bacteria 743
148 Ga0075433_10176092 3300006852 Bacteria 1904
149 Ga0075433_10312864 3300006852 Bacteria 1390
150 Ga0075434_100745329 3300006871 Bacteria 996
151 Ga0075434_101638637 3300006871 Unclassified 652
152 Ga0068865_100566762 3300006881 Bacteria 956
153 Ga0075436_100080935 3300006914 Bacteria 2251
154 Ga0075436_100615753 3300006914 Bacteria 800
155 Ga0075436_100707328 3300006914 Bacteria 746
156 Ga0097620_100500354 3300006931 Bacteria 1310
157 Ga0097620_100527486 3300006931 Bacteria 1276
158 Ga0075435_100030751 3300007076 Bacteria 4225
159 Ga0075435_100506497 3300007076 Bacteria 1044
160 Ga0075435_100544253 3300007076 Bacteria 1005
161 Ga0075435_100773887 3300007076 Unclassified 835
162 Ga0075435_101105579 3300007076 Bacteria 693
163 Ga0099794_10079542 3300007265 Bacteria 1615
164 Ga0099795_10035894 3300007788 Bacteria 1736
165 Ga0099795_10038573 3300007788 Bacteria 1686
166 Ga0105250_10232091 3300009092 Bacteria 785
167 Ga0105240_10576759 3300009093 Bacteria 1241
168 Ga0111539_11327862 3300009094 Bacteria 835
169 Ga0111539_11385850 3300009094 Bacteria 816
170 Ga0105245_10047178 3300009098 Bacteria 3850
171 Ga0105245_10166333 3300009098 Bacteria 2097
172 Ga0105245_10415265 3300009098 Bacteria 1348
173 Ga0105245_12867217 3300009098 Bacteria 534
174 Ga0105247_10015753 3300009101 Bacteria 4527
175 Ga0105247_10166987 3300009101 Bacteria 1461
176 Ga0105247_10648132 3300009101 Bacteria 789
177 Ga0105243_10090883 3300009148 Bacteria 2513
178 Ga0105243_10175682 3300009148 Bacteria 1859
179 Ga0105243_11557699 3300009148 Bacteria 686
180 Ga0105241_10235465 3300009174 Bacteria 1545
181 Ga0105241_10716059 3300009174 Bacteria 915
182 Ga0105242_10006809 3300009176 Bacteria 8815
183 Ga0105242_10007875 3300009176 Bacteria 8200
184 Ga0105248_10079466 3300009177 Bacteria 3686
185 Ga0105248_10105053 3300009177 Bacteria 3184
186 Ga0105237_10102292 3300009545 Bacteria 2857
187 Ga0105237_10199122 3300009545 Bacteria 2002
188 Ga0105237_10539021 3300009545 Bacteria 1174
189 Ga0105238_10018215 3300009551 Bacteria 7142
190 Ga0105238_10114784 3300009551 Bacteria 2672
191 Ga0105249_10353619 3300009553 Bacteria 1489
192 Ga0099796_10002525 3300010159 Bacteria 4039
193 Ga0099796_10224368 3300010159 Bacteria 771
194 Ga0105239_10107153 3300010375 Bacteria 3096
195 Ga0105239_10429069 3300010375 Bacteria 1498
196 Ga0105239_10825628 3300010375 Bacteria 1062
197 Ga0105246_10086639 3300011119 Bacteria 2246
198 Ga0157336_1003199 3300012477 Bacteria 973
199 Ga0157343_1004057 3300012488 Bacteria 890
200 Ga0157345_1042568 3300012498 Bacteria 551
201 Ga0157342_1001677 3300012507 Bacteria 1690
202 Ga0157373_10086048 3300013100 Bacteria 2215
203 Ga0157373_10184352 3300013100 Bacteria 1470
204 Ga0157371_10814308 3300013102 Unclassified 704
205 Ga0157374_10120179 3300013296 Bacteria 2535
206 Ga0157378_10315374 3300013297 Bacteria 1518
207 Ga0157378_10434155 3300013297 Bacteria 1300
208 Ga0157378_10854987 3300013297 Unclassified 938
209 Ga0157378_10897858 3300013297 Bacteria 917
210 Ga0163162_10044593 3300013306 Bacteria 4442
211 Ga0163162_10799224 3300013306 Bacteria 1061
212 Ga0157375_10227346 3300013308 Bacteria 2024
213 Ga0157375_12727148 3300013308 Bacteria 591
214 Ga0163163_10071577 3300014325 Bacteria 3455
215 Ga0163163_10277948 3300014325 Bacteria 1726
216 Ga0163163_10496545 3300014325 Bacteria 1282
217 Ga0163163_10993706 3300014325 Bacteria 902
218 Ga0157380_10483065 3300014326 Bacteria 1199
219 Ga0182008_10190222 3300014497 Bacteria 1041
220 Ga0157377_10141617 3300014745 Bacteria 1478
221 Ga0157377_11275125 3300014745 Bacteria 573
222 Ga0157379_10089922 3300014968 Bacteria 2754
223 Ga0157379_10212383 3300014968 Bacteria 1752
224 Ga0157379_10561816 3300014968 Bacteria 1062
225 Ga0157376_10050410 3300014969 Bacteria 3454
226 Ga0157376_10070756 3300014969 Bacteria 2962
227 Ga0157376_11975529 3300014969 Bacteria 621
228 Ga0157376_12666803 3300014969 Unclassified 540
229 Ga0163161_10030002 3300017792 Bacteria 3868
230 Ga0163161_10038529 3300017792 Bacteria 3429
231 Ga0213874_10038689 3300021377 Bacteria 1417
232 Ga0213875_10140814 3300021388 Unclassified 1129
233 Ga0224572_1006587 3300024225 Bacteria 2103
234 Ga0228598_1010303 3300024227 Bacteria 1862
235 Ga0207692_10003995 3300025898 Bacteria 5797
236 Ga0207692_10132649 3300025898 Bacteria 1408
237 Ga0207642_10035700 3300025899 Bacteria 2127
238 Ga0207642_10261111 3300025899 Bacteria 987
239 Ga0207710_10003506 3300025900 Bacteria 6979
240 Ga0207710_10067218 3300025900 Bacteria 1637
241 Ga0207710_10219386 3300025900 Bacteria 944
242 Ga0207688_10027407 3300025901 Bacteria 3134
243 Ga0207680_10027266 3300025903 Bacteria 3178
244 Ga0207685_10005547 3300025905 Bacteria 3343
245 Ga0207685_10055479 3300025905 Bacteria 1547
246 Ga0207699_10002244 3300025906 Bacteria 9114
247 Ga0207699_10052868 3300025906 Bacteria 2406
248 Ga0207645_10039312 3300025907 Bacteria 3031
249 Ga0207645_10055246 3300025907 Bacteria 2535
250 Ga0207643_10054730 3300025908 Bacteria 2268
251 Ga0207654_10028135 3300025911 Bacteria 3063
252 Ga0207654_10139185 3300025911 Bacteria 1546
253 Ga0207707_10038688 3300025912 Bacteria 4168
254 Ga0207707_10268308 3300025912 Bacteria 1480
255 Ga0207707_10599437 3300025912 Bacteria 932
256 Ga0207695_10584468 3300025913 Bacteria 998
257 Ga0207671_10102127 3300025914 Bacteria 2173
258 Ga0207671_10158022 3300025914 Bacteria 1754
259 Ga0207693_10022079 3300025915 Bacteria 5061
260 Ga0207693_10121067 3300025915 Bacteria 2055
261 Ga0207663_10099640 3300025916 Bacteria 1948
262 Ga0207663_10321916 3300025916 Bacteria 1162
263 Ga0207660_10680879 3300025917 Unclassified 839
264 Ga0207662_10055417 3300025918 Bacteria 2366
265 Ga0207662_10067170 3300025918 Bacteria 2162
266 Ga0207657_10073532 3300025919 Bacteria 2888
267 Ga0207657_10120792 3300025919 Bacteria 2156
268 Ga0207649_10364825 3300025920 Bacteria 1073
269 Ga0207652_10485259 3300025921 Bacteria 1113
270 Ga0207681_10312320 3300025923 Bacteria 1247
271 Ga0207681_10342150 3300025923 Bacteria 1195
272 Ga0207694_10024490 3300025924 Bacteria 4584
273 Ga0207650_10401383 3300025925 Bacteria 1135
274 Ga0207687_10026146 3300025927 Bacteria 3908
275 Ga0207687_10066579 3300025927 Bacteria 2561
276 Ga0207687_10282196 3300025927 Bacteria 1331
277 Ga0207700_10005151 3300025928 Bacteria 7778
278 Ga0207700_10197382 3300025928 Bacteria 1694
279 Ga0207700_10363641 3300025928 Bacteria 1262
280 Ga0207664_10048297 3300025929 Bacteria 3346
281 Ga0207664_10983165 3300025929 Unclassified 756
282 Ga0207644_10006751 3300025931 Bacteria 7478
283 Ga0207644_10029195 3300025931 Bacteria 3824
284 Ga0207690_10055554 3300025932 Bacteria 2667
285 Ga0207706_10007934 3300025933 Bacteria 9799
286 Ga0207686_10016292 3300025934 Bacteria 4170
287 Ga0207686_10051477 3300025934 Bacteria 2565
288 Ga0207709_10089807 3300025935 Bacteria 2004
289 Ga0207709_10133447 3300025935 Bacteria 1695
290 Ga0207709_10583865 3300025935 Unclassified 883
291 Ga0207669_10199413 3300025937 Bacteria 1451
292 Ga0207669_11684717 3300025937 Bacteria 541
293 Ga0207704_10051832 3300025938 Bacteria 2484
294 Ga0207704_10288469 3300025938 Bacteria 1251
295 Ga0207704_11285488 3300025938 Bacteria 625
296 Ga0207665_10000286 3300025939 Bacteria 35188
297 Ga0207691_10046270 3300025940 Bacteria 3999
298 Ga0207691_11248880 3300025940 Bacteria 615
299 Ga0207711_10011234 3300025941 Bacteria 7441
300 Ga0207711_10047527 3300025941 Bacteria 3669
301 Ga0207689_10071156 3300025942 Bacteria 2857
302 Ga0207689_10153942 3300025942 Bacteria 1895
303 Ga0207689_10307255 3300025942 Bacteria 1315
304 Ga0207661_10561293 3300025944 Bacteria 1046
305 Ga0207661_11636142 3300025944 Unclassified 589
306 Ga0207679_10082673 3300025945 Bacteria 2459
307 Ga0207667_10299197 3300025949 Bacteria 1644
308 Ga0207651_10029525 3300025960 Bacteria 3475
309 Ga0207651_10430533 3300025960 Bacteria 1128
310 Ga0207712_10115410 3300025961 Bacteria 2021
311 Ga0207668_10069822 3300025972 Bacteria 2503
312 Ga0207640_11552654 3300025981 Bacteria 596
313 Ga0207658_10876845 3300025986 Bacteria 816
314 Ga0207677_10010691 3300026023 Bacteria 5201
315 Ga0207703_10109701 3300026035 Bacteria 2352
316 Ga0207703_10138504 3300026035 Bacteria 2110
317 Ga0207639_10042897 3300026041 Bacteria 3393
318 Ga0207678_10009105 3300026067 Bacteria 8743
319 Ga0207678_10025140 3300026067 Bacteria 5199
320 Ga0207702_10307283 3300026078 Bacteria 1507
321 Ga0207702_10497581 3300026078 Bacteria 1188
322 Ga0207641_10020997 3300026088 Bacteria 5368
323 Ga0207641_10224315 3300026088 Bacteria 1744
324 Ga0207641_10240817 3300026088 Bacteria 1686
325 Ga0207641_10819321 3300026088 Bacteria 921
326 Ga0207648_10413028 3300026089 Bacteria 1224
327 Ga0207676_10025041 3300026095 Bacteria 4424
328 Ga0207676_10196435 3300026095 Bacteria 1779
329 Ga0207676_12144752 3300026095 Bacteria 557
330 Ga0207674_10018619 3300026116 Bacteria 7543
331 Ga0207674_10628407 3300026116 Bacteria 1037
332 Ga0207675_100235933 3300026118 Bacteria 1766
333 Ga0207675_100640787 3300026118 Unclassified 1068
334 Ga0207675_101646418 3300026118 Bacteria 662
335 Ga0207683_10007280 3300026121 Bacteria 9484
336 Ga0207683_10016057 3300026121 Bacteria 6372
337 Ga0207683_10331564 3300026121 Bacteria 1395
338 Ga0207698_10191319 3300026142 Bacteria 1823
339 Ga0207428_10156905 3300027907 Bacteria 1730
340 Ga0265356_1022344 3300028017 Bacteria 685
341 Ga0265357_1004553 3300028023 Bacteria 1256
342 Ga0268266_10054238 3300028379 Bacteria 3444
343 Ga0268266_10874087 3300028379 Bacteria 869
344 Ga0268265_10147920 3300028380 Bacteria 1977
345 Ga0268265_10622636 3300028380 Bacteria 1034
346 Ga0268264_10397552 3300028381 Bacteria 1323
347 Ga0268264_10568747 3300028381 Bacteria 1114
348 Ga0268264_10659276 3300028381 Unclassified 1036
349 Ga0265763_1003759 3300030763 Bacteria 1221
350 Ga0265773_1003757 3300031018 Bacteria 1015
351 Ga0265332_10004768 3300031238 Bacteria 6320
352 Ga0265325_10266766 3300031241 Bacteria 771
353 Ga0265329_10011239 3300031242 Bacteria 3259
354 Ga0265340_10004841 3300031247 Bacteria 7485
355 Ga0265339_10029928 3300031249 Bacteria 3086
356 Ga0265339_10285429 3300031249 Bacteria 790
357 Ga0265339_10356017 3300031249 Bacteria 689
358 Ga0307509_10510650 3300031507 Bacteria 885
359 Ga0265313_10028169 3300031595 Bacteria 2925
360 Ga0265313_10263719 3300031595 Bacteria 700
361 Ga0265313_10306062 3300031595 Bacteria 637
362 Ga0265314_10423297 3300031711 Bacteria 715
363 Ga0265342_10008939 3300031712 Bacteria 7116
364 Ga0307409_102302042 3300031995 Bacteria 568
365 Ga0373950_0025601 3300034818 Unclassified 1066
366 Ga0373958_0047863 3300034819 Bacteria 895
367 Ga0373959_0005838 3300034820 Bacteria 2027
368 Ga0373938_0001641 3300034957 Bacteria 3586
369 Ga0373926_0092328 3300035083 Bacteria 1126
370 Ga0373928_0003982 3300035084 Bacteria 2818
371 Ga0373928_0224596 3300035084 Unclassified 550
372 Ga0373934_0022249 3300035086 Bacteria 2445
373 Ga0373944_0094017 3300035089 Unclassified 1005
374 Ga0373949_0006905 3300035090 Bacteria 2492
375 Ga0373949_0019873 3300035090 Bacteria 1534
376 Ga0373949_0221369 3300035090 Unclassified 575
377 Ga0373951_0029454 3300035091 Bacteria 1289
378 Ga0373951_0127715 3300035091 Bacteria 697
379 Ga0373923_0046523 3300035111 Bacteria 1805
380 Ga0373923_0095202 3300035111 Bacteria 1307
381 Ga0373923_0432616 3300035111 Bacteria 636
382 Ga0373923_0568660 3300035111 Bacteria 556
383 Ga0373932_0005996 3300035112 Bacteria 2866
384 Ga0373932_0295950 3300035112 Unclassified 602
385 Ga0373936_0101995 3300035113 Bacteria 1211
386 Ga0373936_0113295 3300035113 Bacteria 1153
387 Ga0373939_0080341 3300035114 Bacteria 1081
388 Ga0373939_0158415 3300035114 Bacteria 829
389 Ga0373945_0152289 3300035116 Bacteria 938
390 Ga0373953_0001803 3300035117 Bacteria 6333
391 Ga0373953_0163811 3300035117 Unclassified 956
392 Ga0373954_0006128 3300035118 Bacteria 5238
393 Ga0373954_0016470 3300035118 Bacteria 3309
394 Ga0373956_0160815 3300035119 Bacteria 1058
395 Ga0373957_0033220 3300035120 Bacteria 1905
396 Ga0373960_0047390 3300035121 Bacteria 1264
397 Ga0373960_0123781 3300035121 Unclassified 860
398 Ga0373943_0022914 3300035170 Bacteria 2899
399 Ga0373943_0042747 3300035170 Bacteria 2197
400 Ga0373943_0243628 3300035170 Bacteria 1008
401 Ga0373943_0440306 3300035170 Unclassified 756
402 Ga0373946_0019693 3300035171 Bacteria 2602
403 Ga0373946_0205463 3300035171 Unclassified 945
404 Ga0373955_0001596 3300035172 Bacteria 9704
405 Ga0373955_0003520 3300035172 Bacteria 6890
406 Ga0373942_0005119 3300035207 Bacteria 3039
407 Ga0373942_0032677 3300035207 Bacteria 1383
408 Ga0373961_0055763 3300035241 Bacteria 1185
409 Ga0373961_0371458 3300035241 Bacteria 543
410 Ga0373962_0084042 3300035242 Bacteria 970
411 Ga0373924_0009419 3300035410 Bacteria 3579
412 Ga0373924_0086497 3300035410 Bacteria 1337
413 Ga0373924_0169350 3300035410 Unclassified 960
414 Ga0373931_0010762 3300035691 Bacteria 4403
415 Ga0373931_0029195 3300035691 Bacteria 2829
416 Ga0373931_0522026 3300035691 Bacteria 768
417 Ga0373935_0226842 3300035692 Bacteria 1299
418 Ga0373935_0266135 3300035692 Bacteria 1203
419 Ga0373935_0283299 3300035692 Unclassified 1167
420 Ga0373927_0008531 3300035695 Bacteria 6894
421 Ga0373933_0000812 3300035724 Bacteria 19052
422 Ga0373933_0009688 3300035724 Bacteria 5268
423 Ga0373947_0004664 3300035725 Bacteria 8035
424 Ga0373947_0056748 3300035725 Bacteria 2367
425 Ga0373947_0211214 3300035725 Bacteria 1273
426 Ga0373947_0228342 3300035725 Bacteria 1225
427 Ga0373947_0387472 3300035725 Bacteria 941
428 Ga0373937_0001031 3300036401 Bacteria 23580
429 Ga0373937_0017215 3300036401 Bacteria 6433
430 Ga0373925_0007430 3300037068 Bacteria 7995
431 Ga0373925_0033045 3300037068 Bacteria 3812
432 Ga0373925_0047620 3300037068 Bacteria 3192
433 Ga0373925_0454172 3300037068 Unclassified 1049
434 Ga0436364_0067079 3300037853 Bacteria 1368
435 Ga0436364_0957937 3300037853 Bacteria 1749
436 Ga0436364_1359324 3300037853 Unclassified 772
437 Ga0436365_1640731 3300039437 Bacteria 753
438 Ga0436365_1767131 3300039437 Bacteria 574
439 Ga0436360_0864802 3300039438 Unclassified 654
440 Ga0436361_1210304 3300039447 Bacteria 1393
441 Ga0436363_0147439 3300039450 Bacteria 3725
442 Ga0436363_0325806 3300039450 Unclassified 512
443 Ga0439439_0055492 3300041406 Bacteria 1045
444 Ga0439461_0118487 3300041410 Bacteria 660
445 Ga0451853_0404444 3300041512 Bacteria 611
446 Ga0451853_0732109 3300041512 Bacteria 799
447 Ga0439455_0038004 3300042012 Bacteria 1223
448 Ga0439446_0077646 3300042156 Bacteria 1024
449 Ga0439459_0016988 3300042438 Bacteria 1351
450 Ga0439440_0053817 3300042993 Bacteria 1012
451 Ga0466966_0309481 3300044684 Bacteria 949
452 Ga0466961_0920636 3300044693 Bacteria 520
453 Ga0466963_0124954 3300044694 Bacteria 1773
454 Ga0466963_0179493 3300044694 Bacteria 1478
455 Ga0466957_0121756 3300044842 Bacteria 1664
456 Ga0466957_0711069 3300044842 Bacteria 710
457 Ga0466959_0244675 3300045049 Bacteria 1238
458 Ga0451576_0088644 3300045051 Bacteria 3218
459 Ga0466958_0212404 3300045836 Bacteria 1233
460 Ga0466958_0472122 3300045836 Bacteria 813
461 Ga0466967_0314861 3300045976 Bacteria 1508
462 Ga0495592_0018187 3300046454 Bacteria 5340
463 Ga0495592_0020551 3300046454 Bacteria 5024
464 Ga0495592_0068273 3300046454 Bacteria 2595
465 Ga0495603_0031401 3300046455 Bacteria 3197
466 Ga0495590_0156924 3300046457 Bacteria 826
467 Ga0495629_0000107 3300046459 Bacteria 74043
468 Ga0495629_0002766 3300046459 Bacteria 13416
469 Ga0495629_0017270 3300046459 Bacteria 5175
470 Ga0495638_0161099 3300046460 Bacteria 1294
471 Ga0495651_0001203 3300046462 Bacteria 20001
472 Ga0495651_0002660 3300046462 Bacteria 13860
473 Ga0495653_0002068 3300046463 Bacteria 15779
474 Ga0495653_0007452 3300046463 Bacteria 8957
475 Ga0495653_0427569 3300046463 Bacteria 837
476 Ga0495580_0693766 3300046472 Bacteria 667
477 Ga0495582_0003804 3300046473 Bacteria 8494
478 Ga0495582_0864006 3300046473 Unclassified 523
479 Ga0495639_0110703 3300046475 Bacteria 1303
480 Ga0495639_0453638 3300046475 Bacteria 651
481 Ga0495662_0602035 3300046476 Unclassified 537
482 Ga0495664_0033265 3300046477 Bacteria 3030
483 Ga0495664_0115307 3300046477 Bacteria 1623
484 Ga0495584_0121793 3300046491 Bacteria 1321
485 Ga0495608_0001549 3300046511 Bacteria 16411
486 Ga0495608_0001557 3300046511 Bacteria 16383
487 Ga0495608_0376411 3300046511 Unclassified 871
488 Ga0495618_0000576 3300046514 Bacteria 26108
489 Ga0495618_0001223 3300046514 Bacteria 17412
490 Ga0495628_0010637 3300046516 Bacteria 7802
491 Ga0495628_0019696 3300046516 Bacteria 5573
492 Ga0495628_0026767 3300046516 Bacteria 4696
493 Ga0495630_0023532 3300046517 Bacteria 4554
494 Ga0495630_1071477 3300046517 Bacteria 611
495 Ga0495637_0342119 3300046520 Unclassified 526
496 Ga0495652_0003106 3300046529 Bacteria 16596
497 Ga0495652_0056498 3300046529 Bacteria 3332
498 Ga0495665_0067676 3300046531 Bacteria 1884
499 Ga0495640_0003344 3300046533 Bacteria 12908
500 Ga0495640_0016081 3300046533 Bacteria 5606
501 Ga0495640_0162529 3300046533 Bacteria 1430
502 Ga0495640_0460323 3300046533 Unclassified 776
503 Ga0495586_0024124 3300046535 Bacteria 3249
504 Ga0495586_0307279 3300046535 Bacteria 909
505 Ga0495587_0000308 3300046536 Bacteria 34905
506 Ga0495587_0007970 3300046536 Bacteria 6843
507 Ga0495587_0043134 3300046536 Bacteria 2688
508 Ga0495609_0068336 3300046538 Bacteria 1564
509 Ga0495645_0011743 3300046543 Bacteria 6167
510 Ga0495645_0126659 3300046543 Bacteria 1794
511 Ga0495667_0001377 3300046559 Bacteria 16003
512 Ga0495667_0050075 3300046559 Bacteria 2757
513 Ga0495656_0031822 3300046615 Bacteria 2143
514 Ga0495634_0014560 3300046642 Bacteria 5669
515 Ga0495634_0209350 3300046642 Unclassified 1208
516 Ga0495635_0003954 3300046663 Bacteria 10308
517 Ga0495635_0011118 3300046663 Bacteria 6310
518 Ga0495659_0063432 3300046664 Bacteria 1370
519 Ga0495659_0169813 3300046664 Bacteria 884
520 Ga0495588_0019083 3300046674 Bacteria 3355
521 Ga0495657_0009685 3300046675 Bacteria 7289
522 Ga0495657_0038502 3300046675 Bacteria 3290
523 Ga0495599_0002032 3300046678 Bacteria 11712
524 Ga0495599_0029130 3300046678 Bacteria 3460
525 Ga0495599_0137796 3300046678 Bacteria 1514
526 Ga0495623_0000611 3300046679 Bacteria 23793
527 Ga0495623_0004054 3300046679 Bacteria 9643
528 Ga0495623_0011952 3300046679 Bacteria 5626
529 Ga0495646_0002152 3300046680 Bacteria 11970
530 Ga0495646_0011083 3300046680 Bacteria 5723
531 Ga0495646_0050837 3300046680 Bacteria 2510
532 Ga0495647_0005654 3300046681 Bacteria 4107
533 Ga0495647_0097701 3300046681 Bacteria 1212
534 Ga0495647_0196489 3300046681 Unclassified 883
535 Ga0495658_0019644 3300046683 Bacteria 3529
536 Ga0495658_0033837 3300046683 Bacteria 2802
537 Ga0495613_0001228 3300046689 Bacteria 19586
538 Ga0495613_0156126 3300046689 Bacteria 1625
539 Ga0495613_0221685 3300046689 Bacteria 1327
540 Ga0495613_0657960 3300046689 Bacteria 693
541 Ga0495624_0022719 3300046690 Bacteria 4141
542 Ga0495624_0239504 3300046690 Unclassified 1098
543 Ga0495589_0215485 3300046794 Bacteria 903
544 Ga0495600_0000879 3300046809 Bacteria 16048
545 Ga0495600_0023170 3300046809 Bacteria 3993
546 Ga0495600_0152798 3300046809 Bacteria 1494
547 Ga0495581_0319013 3300047315 Bacteria 908
548 Ga0495581_0631763 3300047315 Bacteria 619
549 Ga0495604_0000543 3300047317 Bacteria 33191
550 Ga0495604_0001842 3300047317 Bacteria 17273
551 Ga0495604_0518998 3300047317 Unclassified 771
552 Ga0495674_0022237 3300047319 Bacteria 5847
553 Ga0495674_0023485 3300047319 Bacteria 5681
554 Ga0495676_0046011 3300047321 Bacteria 3547
555 Ga0495676_0313362 3300047321 Unclassified 1055
556 Ga0495680_0002855 3300047322 Bacteria 17362
557 Ga0495680_0008838 3300047322 Bacteria 9115
558 Ga0495675_0006367 3300047444 Bacteria 7224
559 Ga0495675_0009078 3300047444 Bacteria 6179
560 Ga0495675_0057971 3300047444 Bacteria 2456
561 Ga0495685_071328 3300047447 Bacteria 1163
562 Ga0495684_0048465 3300047471 Bacteria 3248
563 Ga0495684_0740588 3300047471 Bacteria 648
564 Ga0495593_0021509 3300047673 Bacteria 3602
565 Ga0495593_0119157 3300047673 Bacteria 1344
566 Ga0495602_0010641 3300048088 Bacteria 9546
567 Ga0495602_0010853 3300048088 Bacteria 9441
568 Ga0495602_0020706 3300048088 Bacteria 6495
569 Ga0495614_0156422 3300048089 Unclassified 1018
570 Ga0496100_0007404 3300048903 Bacteria 6054
571 Ga0496100_0115785 3300048903 Bacteria 1869
572 Ga0496100_0877514 3300048903 Unclassified 704
573 Ga0496101_0034864 3300048904 Bacteria 3556
574 Ga0496101_0133544 3300048904 Bacteria 1886
575 Ga0496101_0145434 3300048904 Bacteria 1810
576 Ga0496101_0394526 3300048904 Bacteria 1089
577 Ga0496101_1006626 3300048904 Unclassified 655
578 Ga0496102_0047246 3300048905 Bacteria 3910
579 Ga0496102_0052139 3300048905 Bacteria 3726
580 Ga0496102_0078423 3300048905 Bacteria 3040
581 Ga0496102_0107667 3300048905 Bacteria 2595
582 Ga0496103_0021417 3300048906 Bacteria 3888
583 Ga0496103_0022652 3300048906 Bacteria 3782
584 Ga0496103_0140801 3300048906 Bacteria 1542
585 Ga0496103_0303360 3300048906 Bacteria 1027
586 Ga0496103_0369075 3300048906 Bacteria 922
587 Ga0496104_0005238 3300048907 Bacteria 11337
588 Ga0496104_0034633 3300048907 Bacteria 4710
589 Ga0496104_0072734 3300048907 Bacteria 3269
590 Ga0496104_0143951 3300048907 Bacteria 2289
591 Ga0496104_0496734 3300048907 Bacteria 1131
592 Ga0496104_1059678 3300048907 Unclassified 714
593 Ga0496104_1102197 3300048907 Unclassified 697
594 Ga0496104_1147892 3300048907 Bacteria 680
595 Ga0496105_0029324 3300048908 Bacteria 4503
596 Ga0496105_0054660 3300048908 Bacteria 3296
597 Ga0496105_0071433 3300048908 Bacteria 2868
598 Ga0496105_0807953 3300048908 Unclassified 712
599 Ga0496106_0012095 3300048909 Bacteria 6368
600 Ga0496106_0062704 3300048909 Bacteria 2823
601 Ga0496106_0137734 3300048909 Bacteria 1918
602 Ga0496106_0746623 3300048909 Bacteria 778
603 Ga0496107_0005401 3300048910 Bacteria 8744
604 Ga0496107_0142071 3300048910 Bacteria 1774
605 Ga0496107_0827767 3300048910 Bacteria 677
606 Ga0496107_1170531 3300048910 Unclassified 553
607 Ga0496108_0043693 3300048911 Bacteria 3742
608 Ga0496108_0071298 3300048911 Bacteria 2931
609 Ga0496108_0427829 3300048911 Bacteria 1156
610 Ga0496109_0016945 3300048912 Bacteria 6377
611 Ga0496109_0049682 3300048912 Bacteria 3819
612 Ga0496109_0101746 3300048912 Bacteria 2667
613 Ga0496109_0163070 3300048912 Bacteria 2088
614 Ga0496109_0680994 3300048912 Bacteria 966
615 Ga0496109_1149753 3300048912 Bacteria 713
616 Ga0496109_1987792 3300048912 Unclassified 513
617 Ga0496110_0026290 3300048913 Bacteria 4978
618 Ga0496110_0117125 3300048913 Bacteria 2399
619 Ga0496110_1327842 3300048913 Unclassified 628
620 Ga0496111_0208755 3300048914 Bacteria 1451
621 Ga0496111_0711441 3300048914 Bacteria 730
622 Ga0496112_0029422 3300048915 Bacteria 5312
623 Ga0496112_0078216 3300048915 Bacteria 3271
624 Ga0496112_0563571 3300048915 Bacteria 1073
625 Ga0496112_0777670 3300048915 Bacteria 883
626 Ga0496113_0219772 3300048916 Bacteria 1514
627 Ga0496113_0420448 3300048916 Bacteria 1073
628 Ga0496113_0455826 3300048916 Bacteria 1027
629 Ga0496113_0470814 3300048916 Bacteria 1009
630 Ga0496114_0123546 3300048917 Bacteria 2228
631 Ga0496114_0240576 3300048917 Bacteria 1591
632 Ga0496114_0614829 3300048917 Unclassified 957
633 Ga0496114_0964440 3300048917 Bacteria 735
634 Ga0496115_0162037 3300048918 Bacteria 1848
635 Ga0496115_0193443 3300048918 Bacteria 1680
636 Ga0496115_0320596 3300048918 Bacteria 1267
637 Ga0496116_0384548 3300048919 Bacteria 628
638 Ga0496119_0093523 3300048922 Bacteria 1703
639 Ga0496125_0216379 3300048928 Bacteria 1239
640 Ga0496126_0142347 3300048929 Bacteria 2063
641 Ga0501068_0268457 3300049584 Bacteria 1089
642 Ga0501079_0505988 3300049741 Bacteria 950
643 Ga0501079_0766424 3300049741 Bacteria 760
644 nmdc:mga03n38_912545_c1 3300050490 Unclassified 517
645 nmdc:mga0yw44_318876_c1 3300050492 Bacteria 1043
646 nmdc:mga06z11_1036048_c1 3300050494 Bacteria 500
647 nmdc:mga06z11_21082_c1 3300050494 Bacteria 1557
648 nmdc:mga08y16_233899_c1 3300050511 Bacteria 1900
649 nmdc:mga08y16_61378_c1 3300050511 Bacteria 3925
650 nmdc:mga08y16_838496_c1 3300050511 Bacteria 909
651 nmdc:mga0n895_2770_c1 3300050512 Bacteria 13857
652 nmdc:mga0n895_607950_c1 3300050512 Bacteria 1095
653 nmdc:mga0n895_883377_c1 3300050512 Unclassified 880
654 nmdc:mga0n895_89236_c1 3300050512 Bacteria 3084
655 nmdc:mga0rr50_568911_c1 3300050513 Bacteria 965
656 nmdc:mga0rr50_951673_c1 3300050513 Bacteria 732
657 nmdc:mga0rr50_99388_c1 3300050513 Bacteria 2283
658 nmdc:mga08x19_31803_c1 3300050514 Bacteria 3323
659 nmdc:mga08x19_581794_c1 3300050514 Bacteria 793
660 nmdc:mga0a205_163902_c1 3300050515 Bacteria 2119
661 nmdc:mga0a205_344924_c1 3300050515 Bacteria 1357
662 Ga0495601_0007067 3300053077 Bacteria 6579
663 Ga0495601_0040974 3300053077 Bacteria 2901
664 Ga0495601_0475253 3300053077 Bacteria 807
665 Ga0495612_0000364 3300053078 Bacteria 18228
666 Ga0495612_0015814 3300053078 Bacteria 3024
667 Ga0495612_0556310 3300053078 Unclassified 528
668 Ga0495595_0000179 3300053084 Bacteria 25284
669 Ga0495595_0012382 3300053084 Bacteria 3585
670 Ga0495619_0000440 3300053085 Bacteria 28061
671 Ga0495619_0001264 3300053085 Bacteria 16587
672 Ga0495619_0003998 3300053085 Bacteria 9452
673 Ga0500644_0000450 3300053088 Bacteria 18821
674 Ga0500651_0077856 3300053093 Bacteria 2057
675 Ga0500641_0062309 3300053096 Bacteria 1555
676 Ga0500650_0143175 3300053098 Bacteria 1108
677 Ga0500655_048357 3300053133 Bacteria 845
678 Ga0500604_0077389 3300053151 Bacteria 1070
679 Ga0500616_0000001 3300053153 Bacteria 1986011
680 Ga0500616_0003517 3300053153 Bacteria 11894
681 Ga0500645_000258 3300053730 Bacteria 38707
682 Ga0501084_0486897 3300054114 Bacteria 1043
683 Ga0501082_0935823 3300060353 Bacteria 758
684 Ga0466962_0058213 3300061719 Bacteria 1845
685 Ga0466962_0378287 3300061719 Bacteria 707
686 2952254263 2952252522 Bacteria 4171745
687 Ga0466963_0624680
688 JGI24743J22301_10133613
689 JGI24749J21850_1084059
690 JGI24034J26672_10037084
691 JGI24751J29686_10039408
692 JGI25407J50210_10063419
693 Ga0065712_10272598
694 Ga0065715_10285387
695 Ga0070676_10402554
696 Ga0070683_100329168
697 Ga0070690_100030808
698 Ga0070690_100143050
699 Ga0070670_100055475
700 Ga0070670_100285897
701 Ga0070670_102008191
702 Ga0070677_10521355
703 Ga0068869_100921628
704 Ga0068869_101690178
705 Ga0070666_10009458
706 Ga0070682_100114850
707 Ga0068868_100006290
708 Ga0070660_100050740
709 Ga0070660_100198563
710 Ga0070689_100181504
711 Ga0070689_100309660
712 Ga0070689_101162681
713 Ga0070687_100006110
714 Ga0070687_100170611
715 Ga0070661_100071570
716 Ga0070692_10397534
717 Ga0070668_100092388
718 Ga0070669_100252607
719 Ga0070669_101258776
720 Ga0070675_101148500
721 Ga0070671_100033645
722 Ga0070671_101331741
723 Ga0070674_100024434
724 Ga0070674_100379371
725 Ga0070673_100013598
726 Ga0070673_100520430
727 Ga0070688_100006606
728 Ga0070688_100130893
729 Ga0070688_101432006
730 Ga0070667_100015293
731 Ga0070667_100048564
732 Ga0070709_10005714
733 Ga0070709_10043373
734 Ga0070714_100030535
735 Ga0070713_100013214
736 Ga0070713_100201139
737 Ga0070710_10002327
738 Ga0070710_10405645
739 Ga0070701_10455162
740 Ga0070711_100014478
741 Ga0070705_100025822
742 Ga0070694_100625827
743 Ga0070663_100029224
744 Ga0070663_100035327
745 Ga0070678_100030092
746 Ga0070678_100065969
747 Ga0070662_100016429
748 Ga0070681_10025368
749 Ga0070681_10304903
750 Ga0068867_100099224
751 Ga0070685_10035288
752 Ga0070685_10893840
753 Ga0070685_11008241
754 Ga0070707_101762973
755 Ga0070679_100265614
756 Ga0070679_100309220
757 Ga0070684_102016953
758 Ga0070697_100578882
759 Ga0068853_100387020
760 Ga0068853_101058506
761 Ga0070672_100080043
762 Ga0070686_100016976
763 Ga0070686_100696940
764 Ga0070686_101933448
765 Ga0070695_100315385
766 Ga0070695_100531117
767 Ga0070696_100242998
768 Ga0070696_101586667
769 Ga0070693_100247638
770 Ga0070665_100046816
771 Ga0070665_100894680
772 Ga0068855_100413284
773 Ga0068855_101205439
774 Ga0070664_100094221
775 Ga0068857_100228404
776 Ga0068857_100540904
777 Ga0068854_100537753
778 Ga0068856_100339682
779 Ga0068856_100540835
780 Ga0070702_100192265
781 Ga0070702_100260317
782 Ga0070702_101659509
783 Ga0068852_100164786
784 Ga0068859_100500351
785 Ga0068859_100527485
786 Ga0068864_100004887
787 Ga0068864_100019679
788 Ga0068864_101062289
789 Ga0068864_101646702
790 Ga0068866_10044762
791 Ga0068866_10604575
792 Ga0068861_101084978
793 Ga0068870_10036055
794 Ga0068863_100505648
795 Ga0068863_100633191
796 Ga0068858_100015727
797 Ga0068858_100241082
798 Ga0068858_101475397
799 Ga0068860_100203516
800 Ga0068860_100498534
801 Ga0068860_101913190
802 Ga0068862_101050473
803 Ga0081455_10000444
804 Ga0081455_10039105
805 Ga0081538_10025680
806 Ga0081538_10188303
807 Ga0081540_1014094
808 Ga0081540_1017788
809 Ga0081540_1047799
810 Ga0081539_10021059
811 Ga0070717_10000396
812 Ga0070717_10128074
813 Ga0070717_10359663
814 Ga0070717_11004753
815 Ga0075365_10519445
816 Ga0075363_100449670
817 Ga0070715_10002900
818 Ga0070715_10130706
819 Ga0070715_10245226
820 Ga0070715_10268793
821 Ga0070715_11029599
822 Ga0070716_100000927
823 Ga0070716_101096975
824 Ga0070716_101819426
825 Ga0070712_100099209
826 Ga0075367_10133370
827 Ga0097621_100016731
828 Ga0097621_100214715
829 Ga0068871_100007646
830 Ga0068871_100417343
831 Ga0068871_100743537
832 Ga0075428_100657098
833 Ga0075428_101368691
834 Ga0075433_10176092
835 Ga0075433_10312864
836 Ga0075434_100745329
837 Ga0075434_101638637
838 Ga0068865_100566762
839 Ga0075436_100080935
840 Ga0075436_100615753
841 Ga0075436_100707328
842 Ga0097620_100500354
843 Ga0097620_100527486
844 Ga0075435_100030751
845 Ga0075435_100506497
846 Ga0075435_100544253
847 Ga0075435_100773887
848 Ga0075435_101105579
849 Ga0099794_10079542
850 Ga0099795_10035894
851 Ga0099795_10038573
852 Ga0105250_10232091
853 Ga0105240_10576759
854 Ga0111539_11327862
855 Ga0111539_11385850
856 Ga0105245_10047178
857 Ga0105245_10166333
858 Ga0105245_10415265
859 Ga0105245_12867217
860 Ga0105247_10015753
861 Ga0105247_10166987
862 Ga0105247_10648132
863 Ga0105243_10090883
864 Ga0105243_10175682
865 Ga0105243_11557699
866 Ga0105241_10235465
867 Ga0105241_10716059
868 Ga0105242_10006809
869 Ga0105242_10007875
870 Ga0105248_10079466
871 Ga0105248_10105053
872 Ga0105237_10102292
873 Ga0105237_10199122
874 Ga0105237_10539021
875 Ga0105238_10018215
876 Ga0105238_10114784
877 Ga0105249_10353619
878 Ga0099796_10002525
879 Ga0099796_10224368
880 Ga0105239_10107153
881 Ga0105239_10429069
882 Ga0105239_10825628
883 Ga0105246_10086639
884 Ga0157336_1003199
885 Ga0157343_1004057
886 Ga0157345_1042568
887 Ga0157342_1001677
888 Ga0157373_10086048
889 Ga0157373_10184352
890 Ga0157371_10814308
891 Ga0157374_10120179
892 Ga0157378_10315374
893 Ga0157378_10434155
894 Ga0157378_10854987
895 Ga0157378_10897858
896 Ga0163162_10044593
897 Ga0163162_10799224
898 Ga0157375_10227346
899 Ga0157375_12727148
900 Ga0163163_10071577
901 Ga0163163_10277948
902 Ga0163163_10496545
903 Ga0163163_10993706
904 Ga0157380_10483065
905 Ga0182008_10190222
906 Ga0157377_10141617
907 Ga0157377_11275125
908 Ga0157379_10089922
909 Ga0157379_10212383
910 Ga0157379_10561816
911 Ga0157376_10050410
912 Ga0157376_10070756
913 Ga0157376_11975529
914 Ga0157376_12666803
915 Ga0163161_10030002
916 Ga0163161_10038529
917 Ga0213874_10038689
918 Ga0213875_10140814
919 Ga0224572_1006587
920 Ga0228598_1010303
921 Ga0207692_10003995
922 Ga0207692_10132649
923 Ga0207642_10035700
924 Ga0207642_10261111
925 Ga0207710_10003506
926 Ga0207710_10067218
927 Ga0207710_10219386
928 Ga0207688_10027407
929 Ga0207680_10027266
930 Ga0207685_10005547
931 Ga0207685_10055479
932 Ga0207699_10002244
933 Ga0207699_10052868
934 Ga0207645_10039312
935 Ga0207645_10055246
936 Ga0207643_10054730
937 Ga0207654_10028135
938 Ga0207654_10139185
939 Ga0207707_10038688
940 Ga0207707_10268308
941 Ga0207707_10599437
942 Ga0207695_10584468
943 Ga0207671_10102127
944 Ga0207671_10158022
945 Ga0207693_10022079
946 Ga0207693_10121067
947 Ga0207663_10099640
948 Ga0207663_10321916
949 Ga0207660_10680879
950 Ga0207662_10055417
951 Ga0207662_10067170
952 Ga0207657_10073532
953 Ga0207657_10120792
954 Ga0207649_10364825
955 Ga0207652_10485259
956 Ga0207681_10312320
957 Ga0207681_10342150
958 Ga0207694_10024490
959 Ga0207650_10401383
960 Ga0207687_10026146
961 Ga0207687_10066579
962 Ga0207687_10282196
963 Ga0207700_10005151
964 Ga0207700_10197382
965 Ga0207700_10363641
966 Ga0207664_10048297
967 Ga0207664_10983165
968 Ga0207644_10006751
969 Ga0207644_10029195
970 Ga0207690_10055554
971 Ga0207706_10007934
972 Ga0207686_10016292
973 Ga0207686_10051477
974 Ga0207709_10089807
975 Ga0207709_10133447
976 Ga0207709_10583865
977 Ga0207669_10199413
978 Ga0207669_11684717
979 Ga0207704_10051832
980 Ga0207704_10288469
981 Ga0207704_11285488
982 Ga0207665_10000286
983 Ga0207691_10046270
984 Ga0207691_11248880
985 Ga0207711_10011234
986 Ga0207711_10047527
987 Ga0207689_10071156
988 Ga0207689_10153942
989 Ga0207689_10307255
990 Ga0207661_10561293
991 Ga0207661_11636142
992 Ga0207679_10082673
993 Ga0207667_10299197
994 Ga0207651_10029525
995 Ga0207651_10430533
996 Ga0207712_10115410
997 Ga0207668_10069822
998 Ga0207640_11552654
999 Ga0207658_10876845
1000 Ga0207677_10010691
1001 Ga0207703_10109701
1002 Ga0207703_10138504
1003 Ga0207639_10042897
1004 Ga0207678_10009105
1005 Ga0207678_10025140
1006 Ga0207702_10307283
1007 Ga0207702_10497581
1008 Ga0207641_10020997
1009 Ga0207641_10224315
1010 Ga0207641_10240817
1011 Ga0207641_10819321
1012 Ga0207648_10413028
1013 Ga0207676_10025041
1014 Ga0207676_10196435
1015 Ga0207676_12144752
1016 Ga0207674_10018619
1017 Ga0207674_10628407
1018 Ga0207675_100235933
1019 Ga0207675_100640787
1020 Ga0207675_101646418
1021 Ga0207683_10007280
1022 Ga0207683_10016057
1023 Ga0207683_10331564
1024 Ga0207698_10191319
1025 Ga0207428_10156905
1026 Ga0265356_1022344
1027 Ga0265357_1004553
1028 Ga0268266_10054238
1029 Ga0268266_10874087
1030 Ga0268265_10147920
1031 Ga0268265_10622636
1032 Ga0268264_10397552
1033 Ga0268264_10568747
1034 Ga0268264_10659276
1035 Ga0265763_1003759
1036 Ga0265773_1003757
1037 Ga0265332_10004768
1038 Ga0265325_10266766
1039 Ga0265329_10011239
1040 Ga0265340_10004841
1041 Ga0265339_10029928
1042 Ga0265339_10285429
1043 Ga0265339_10356017
1044 Ga0307509_10510650
1045 Ga0265313_10028169
1046 Ga0265313_10263719
1047 Ga0265313_10306062
1048 Ga0265314_10423297
1049 Ga0265342_10008939
1050 Ga0307409_102302042
1051 Ga0373950_0025601
1052 Ga0373958_0047863
1053 Ga0373959_0005838
1054 Ga0373938_0001641
1055 Ga0373926_0092328
1056 Ga0373928_0003982
1057 Ga0373928_0224596
1058 Ga0373934_0022249
1059 Ga0373944_0094017
1060 Ga0373949_0006905
1061 Ga0373949_0019873
1062 Ga0373949_0221369
1063 Ga0373951_0029454
1064 Ga0373951_0127715
1065 Ga0373923_0046523
1066 Ga0373923_0095202
1067 Ga0373923_0432616
1068 Ga0373923_0568660
1069 Ga0373932_0005996
1070 Ga0373932_0295950
1071 Ga0373936_0101995
1072 Ga0373936_0113295
1073 Ga0373939_0080341
1074 Ga0373939_0158415
1075 Ga0373945_0152289
1076 Ga0373953_0001803
1077 Ga0373953_0163811
1078 Ga0373954_0006128
1079 Ga0373954_0016470
1080 Ga0373956_0160815
1081 Ga0373957_0033220
1082 Ga0373960_0047390
1083 Ga0373960_0123781
1084 Ga0373943_0022914
1085 Ga0373943_0042747
1086 Ga0373943_0243628
1087 Ga0373943_0440306
1088 Ga0373946_0019693
1089 Ga0373946_0205463
1090 Ga0373955_0001596
1091 Ga0373955_0003520
1092 Ga0373942_0005119
1093 Ga0373942_0032677
1094 Ga0373961_0055763
1095 Ga0373961_0371458
1096 Ga0373962_0084042
1097 Ga0373924_0009419
1098 Ga0373924_0086497
1099 Ga0373924_0169350
1100 Ga0373931_0010762
1101 Ga0373931_0029195
1102 Ga0373931_0522026
1103 Ga0373935_0226842
1104 Ga0373935_0266135
1105 Ga0373935_0283299
1106 Ga0373927_0008531
1107 Ga0373933_0000812
1108 Ga0373933_0009688
1109 Ga0373947_0004664
1110 Ga0373947_0056748
1111 Ga0373947_0211214
1112 Ga0373947_0228342
1113 Ga0373947_0387472
1114 Ga0373937_0001031
1115 Ga0373937_0017215
1116 Ga0373925_0007430
1117 Ga0373925_0033045
1118 Ga0373925_0047620
1119 Ga0373925_0454172
1120 Ga0436364_0067079
1121 Ga0436364_0957937
1122 Ga0436364_1359324
1123 Ga0436365_1640731
1124 Ga0436365_1767131
1125 Ga0436360_0864802
1126 Ga0436361_1210304
1127 Ga0436363_0147439
1128 Ga0436363_0325806
1129 Ga0439439_0055492
1130 Ga0439461_0118487
1131 Ga0451853_0404444
1132 Ga0451853_0732109
1133 Ga0439455_0038004
1134 Ga0439446_0077646
1135 Ga0439459_0016988
1136 Ga0439440_0053817
1137 Ga0466966_0309481
1138 Ga0466961_0920636
1139 Ga0466963_0124954
1140 Ga0466963_0179493
1141 Ga0466957_0121756
1142 Ga0466957_0711069
1143 Ga0466959_0244675
1144 Ga0451576_0088644
1145 Ga0466958_0212404
1146 Ga0466958_0472122
1147 Ga0466967_0314861
1148 Ga0495592_0018187
1149 Ga0495592_0020551
1150 Ga0495592_0068273
1151 Ga0495603_0031401
1152 Ga0495590_0156924
1153 Ga0495629_0000107
1154 Ga0495629_0002766
1155 Ga0495629_0017270
1156 Ga0495638_0161099
1157 Ga0495651_0001203
1158 Ga0495651_0002660
1159 Ga0495653_0002068
1160 Ga0495653_0007452
1161 Ga0495653_0427569
1162 Ga0495580_0693766
1163 Ga0495582_0003804
1164 Ga0495582_0864006
1165 Ga0495639_0110703
1166 Ga0495639_0453638
1167 Ga0495662_0602035
1168 Ga0495664_0033265
1169 Ga0495664_0115307
1170 Ga0495584_0121793
1171 Ga0495608_0001549
1172 Ga0495608_0001557
1173 Ga0495608_0376411
1174 Ga0495618_0000576
1175 Ga0495618_0001223
1176 Ga0495628_0010637
1177 Ga0495628_0019696
1178 Ga0495628_0026767
1179 Ga0495630_0023532
1180 Ga0495630_1071477
1181 Ga0495637_0342119
1182 Ga0495652_0003106
1183 Ga0495652_0056498
1184 Ga0495665_0067676
1185 Ga0495640_0003344
1186 Ga0495640_0016081
1187 Ga0495640_0162529
1188 Ga0495640_0460323
1189 Ga0495586_0024124
1190 Ga0495586_0307279
1191 Ga0495587_0000308
1192 Ga0495587_0007970
1193 Ga0495587_0043134
1194 Ga0495609_0068336
1195 Ga0495645_0011743
1196 Ga0495645_0126659
1197 Ga0495667_0001377
1198 Ga0495667_0050075
1199 Ga0495656_0031822
1200 Ga0495634_0014560
1201 Ga0495634_0209350
1202 Ga0495635_0003954
1203 Ga0495635_0011118
1204 Ga0495659_0063432
1205 Ga0495659_0169813
1206 Ga0495588_0019083
1207 Ga0495657_0009685
1208 Ga0495657_0038502
1209 Ga0495599_0002032
1210 Ga0495599_0029130
1211 Ga0495599_0137796
1212 Ga0495623_0000611
1213 Ga0495623_0004054
1214 Ga0495623_0011952
1215 Ga0495646_0002152
1216 Ga0495646_0011083
1217 Ga0495646_0050837
1218 Ga0495647_0005654
1219 Ga0495647_0097701
1220 Ga0495647_0196489
1221 Ga0495658_0019644
1222 Ga0495658_0033837
1223 Ga0495613_0001228
1224 Ga0495613_0156126
1225 Ga0495613_0221685
1226 Ga0495613_0657960
1227 Ga0495624_0022719
1228 Ga0495624_0239504
1229 Ga0495589_0215485
1230 Ga0495600_0000879
1231 Ga0495600_0023170
1232 Ga0495600_0152798
1233 Ga0495581_0319013
1234 Ga0495581_0631763
1235 Ga0495604_0000543
1236 Ga0495604_0001842
1237 Ga0495604_0518998
1238 Ga0495674_0022237
1239 Ga0495674_0023485
1240 Ga0495676_0046011
1241 Ga0495676_0313362
1242 Ga0495680_0002855
1243 Ga0495680_0008838
1244 Ga0495675_0006367
1245 Ga0495675_0009078
1246 Ga0495675_0057971
1247 Ga0495685_071328
1248 Ga0495684_0048465
1249 Ga0495684_0740588
1250 Ga0495593_0021509
1251 Ga0495593_0119157
1252 Ga0495602_0010641
1253 Ga0495602_0010853
1254 Ga0495602_0020706
1255 Ga0495614_0156422
1256 Ga0496100_0007404
1257 Ga0496100_0115785
1258 Ga0496100_0877514
1259 Ga0496101_0034864
1260 Ga0496101_0133544
1261 Ga0496101_0145434
1262 Ga0496101_0394526
1263 Ga0496101_1006626
1264 Ga0496102_0047246
1265 Ga0496102_0052139
1266 Ga0496102_0078423
1267 Ga0496102_0107667
1268 Ga0496103_0021417
1269 Ga0496103_0022652
1270 Ga0496103_0140801
1271 Ga0496103_0303360
1272 Ga0496103_0369075
1273 Ga0496104_0005238
1274 Ga0496104_0034633
1275 Ga0496104_0072734
1276 Ga0496104_0143951
1277 Ga0496104_0496734
1278 Ga0496104_1059678
1279 Ga0496104_1102197
1280 Ga0496104_1147892
1281 Ga0496105_0029324
1282 Ga0496105_0054660
1283 Ga0496105_0071433
1284 Ga0496105_0807953
1285 Ga0496106_0012095
1286 Ga0496106_0062704
1287 Ga0496106_0137734
1288 Ga0496106_0746623
1289 Ga0496107_0005401
1290 Ga0496107_0142071
1291 Ga0496107_0827767
1292 Ga0496107_1170531
1293 Ga0496108_0043693
1294 Ga0496108_0071298
1295 Ga0496108_0427829
1296 Ga0496109_0016945
1297 Ga0496109_0049682
1298 Ga0496109_0101746
1299 Ga0496109_0163070
1300 Ga0496109_0680994
1301 Ga0496109_1149753
1302 Ga0496109_1987792
1303 Ga0496110_0026290
1304 Ga0496110_0117125
1305 Ga0496110_1327842
1306 Ga0496111_0208755
1307 Ga0496111_0711441
1308 Ga0496112_0029422
1309 Ga0496112_0078216
1310 Ga0496112_0563571
1311 Ga0496112_0777670
1312 Ga0496113_0219772
1313 Ga0496113_0420448
1314 Ga0496113_0455826
1315 Ga0496113_0470814
1316 Ga0496114_0123546
1317 Ga0496114_0240576
1318 Ga0496114_0614829
1319 Ga0496114_0964440
1320 Ga0496115_0162037
1321 Ga0496115_0193443
1322 Ga0496115_0320596
1323 Ga0496116_0384548
1324 Ga0496119_0093523
1325 Ga0496125_0216379
1326 Ga0496126_0142347
1327 Ga0501068_0268457
1328 Ga0501079_0505988
1329 Ga0501079_0766424
1330 nmdc:mga03n38_912545_c1
1331 nmdc:mga0yw44_318876_c1
1332 nmdc:mga06z11_1036048_c1
1333 nmdc:mga06z11_21082_c1
1334 nmdc:mga08y16_233899_c1
1335 nmdc:mga08y16_61378_c1
1336 nmdc:mga08y16_838496_c1
1337 nmdc:mga0n895_2770_c1
1338 nmdc:mga0n895_607950_c1
1339 nmdc:mga0n895_883377_c1
1340 nmdc:mga0n895_89236_c1
1341 nmdc:mga0rr50_568911_c1
1342 nmdc:mga0rr50_951673_c1
1343 nmdc:mga0rr50_99388_c1
1344 nmdc:mga08x19_31803_c1
1345 nmdc:mga08x19_581794_c1
1346 nmdc:mga0a205_163902_c1
1347 nmdc:mga0a205_344924_c1
1348 Ga0495601_0007067
1349 Ga0495601_0040974
1350 Ga0495601_0475253
1351 Ga0495612_0000364
1352 Ga0495612_0015814
1353 Ga0495612_0556310
1354 Ga0495595_0000179
1355 Ga0495595_0012382
1356 Ga0495619_0000440
1357 Ga0495619_0001264
1358 Ga0495619_0003998
1359 Ga0500644_0000450
1360 Ga0500651_0077856
1361 Ga0500641_0062309
1362 Ga0500650_0143175
1363 Ga0500655_048357
1364 Ga0500604_0077389
1365 Ga0500616_0000001
1366 Ga0500616_0003517
1367 Ga0500645_000258
1368 Ga0501084_0486897
1369 Ga0501082_0935823
1370 Ga0466962_0058213
1371 Ga0466962_0378287
1372 2952254263

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05402

PqqD

Coenzyme PQQ synthesis protein D (PqqD)

30

95

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hkr-assembly1.cif.gz_A crystal structure of histone h3 lysine 79 (h3k79) methyltransferase rv2067c from mycobacterium tuberculosis 0.9163 5 91
8hkr-assembly1.cif.gz_B crystal structure of histone h3 lysine 79 (h3k79) methyltransferase rv2067c from mycobacterium tuberculosis 0.9033 5 91
1b8z-assembly1.cif.gz_B hu from thermotoga maritima 0.8773 52 85
5sxy-assembly1.cif.gz_A the solution nmr structure for the pqqd truncation of methylobacterium extorquens pqqcd representing a functional and stand-alone ribosomally synthesized and post-translational modified (ripp) recognition element (rre) 0.8608 1 90
6jx3-assembly1.cif.gz_B lasso peptide synthetase b1 complexed with the leader peptide 0.8459 7 90
ID Description Score Start End Superfamily
af_Q58434_458_660_3.30.230.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.8852 56 79 3.30.230.10
af_P9WLL9_303_407_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8749 5 92 1.10.10.10
2z99A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.845 58 87 1.10.10.10
af_Q8INM8_6_71_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8389 56 86 1.10.10.10
af_Q4DDS4_1_596_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8359 54 83 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A537L5V8-F1-model_v4 Pyrroloquinoline quinone biosynthesis peptide chaperone PqqD 1.001 1 90 GO:0018189
GO:0048038
AF-A0A4R7BJ10-F1-model_v4 Pyrroloquinoline quinone biosynthesis protein D 0.9943 4 90 GO:0018189
GO:0048038
AF-A0A537VAW8-F1-model_v4 Pyrroloquinoline quinone biosynthesis peptide chaperone PqqD 0.9921 1 90 GO:0018189
GO:0048038
AF-A0A0S3PPH1-F1-model_v4 Coenzyme PQQ synthesis protein D 0.9914 1 92 GO:0018189
GO:0048038
AF-A0A537MWI5-F1-model_v4 Pyrroloquinoline quinone biosynthesis peptide chaperone PqqD 0.9906 2 92 GO:0018189
GO:0048038

Map