F475184

General Info

Members Datasets Scaffolds Average Seq Length
686 246 1372 233

Family's Representative Sequence

Representative Sequence 3300025918|Ga0207662_10564704|Ga0207662_105647041
Length 231
Sequence MRILVVEDEPRIARFLTSGLQAEGFVVDAVGDGESAIHWIARYEVDFVILDLALPGIDGLDVLEQIKHTRPDIAVLILSARRDVATKLAGLRGGACDYMVKPFSFDELVERIRIHKRAQAASQAGGEVLQAGEIVLDTRARSVDTGSGSVQLTGLEFRLLEYMMRNRGRPLSRTMIVEHVWDMDYDGLTNIVDVYIRHLRSKIDDKYPQKLIQTVRGIGYMIEAPDKPAQV

Samples

Sample ID Description Type Environment
1 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
50 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
84 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
85 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
86 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
87 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
88 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
136 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
137 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
138 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
139 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
140 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
141 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
142 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
143 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
144 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
145 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
146 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
147 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
148 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
149 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
150 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
151 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
152 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
153 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
154 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
155 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
156 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
157 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
158 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
159 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
160 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
161 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
162 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
163 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
164 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
165 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
166 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
167 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
168 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
169 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
170 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
171 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
172 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
173 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
174 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
175 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
176 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
177 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
178 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
179 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
180 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
181 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
182 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
183 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
184 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
185 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
186 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
187 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
188 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
189 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
190 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
191 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
192 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
193 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
194 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
195 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
196 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
197 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
198 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
199 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
200 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
201 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
202 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
203 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
204 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
205 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
206 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
207 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
208 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
209 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
210 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
211 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
212 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
213 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
214 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
215 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
228 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
229 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
230 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
231 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
232 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
233 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
234 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
235 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
236 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
237 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
238 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
239 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
240 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
242 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
243 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
244 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
245 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
246 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.27
Metatranscriptomes 0.73
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.77
Rhizosphere 91.4
Stem 0
Stem Tuber 0
Unclassified 2.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207662_10564704 3300025918 Bacteria 789
2 Ga0070658_10000619 3300005327 Bacteria 30630
3 Ga0070658_10094135 3300005327 Bacteria 2471
4 Ga0070658_10178674 3300005327 Bacteria 1786
5 Ga0070658_10353896 3300005327 Bacteria 1257
6 Ga0070658_10650758 3300005327 Bacteria 914
7 Ga0070658_10702046 3300005327 Unclassified 878
8 Ga0070683_100002169 3300005329 Bacteria 15519
9 Ga0070683_100017698 3300005329 Bacteria 6297
10 Ga0070683_100143762 3300005329 Bacteria 2260
11 Ga0070683_100151362 3300005329 Bacteria 2200
12 Ga0070683_100315828 3300005329 Bacteria 1487
13 Ga0070683_100551759 3300005329 Bacteria 1102
14 Ga0070690_100555447 3300005330 Bacteria 866
15 Ga0068869_100052763 3300005334 Bacteria 2953
16 Ga0068869_100156055 3300005334 Bacteria 1773
17 Ga0070666_10004136 3300005335 Bacteria 8804
18 Ga0070680_100002391 3300005336 Bacteria 13889
19 Ga0070680_100015499 3300005336 Bacteria 5978
20 Ga0070680_100261258 3300005336 Bacteria 1465
21 Ga0070682_100119457 3300005337 Unclassified 1767
22 Ga0070682_100260329 3300005337 Bacteria 1255
23 Ga0068868_100029963 3300005338 Bacteria 4171
24 Ga0068868_100106884 3300005338 Bacteria 2270
25 Ga0068868_100285112 3300005338 Bacteria 1399
26 Ga0070660_100041656 3300005339 Bacteria 3501
27 Ga0070660_100070593 3300005339 Bacteria 2726
28 Ga0070660_100086890 3300005339 Bacteria 2461
29 Ga0070660_100258952 3300005339 Bacteria 1420
30 Ga0070660_100266736 3300005339 Bacteria 1399
31 Ga0070691_10016052 3300005341 Bacteria 3442
32 Ga0070661_100016041 3300005344 Bacteria 5288
33 Ga0070661_100162082 3300005344 Bacteria 1694
34 Ga0070692_10025986 3300005345 Bacteria 2891
35 Ga0070671_100153472 3300005355 Bacteria 1945
36 Ga0070671_100239554 3300005355 Bacteria 1540
37 Ga0070674_100144701 3300005356 Bacteria 1788
38 Ga0070674_100401019 3300005356 Bacteria 1121
39 Ga0070674_100465873 3300005356 Bacteria 1046
40 Ga0070674_100583552 3300005356 Bacteria 942
41 Ga0070673_100395593 3300005364 Bacteria 1235
42 Ga0070688_100337981 3300005365 Bacteria 1099
43 Ga0070659_100144196 3300005366 Unclassified 1940
44 Ga0070667_100085012 3300005367 Bacteria 2713
45 Ga0070667_100374090 3300005367 Bacteria 1293
46 Ga0070714_100005514 3300005435 Bacteria 9660
47 Ga0070714_100039193 3300005435 Bacteria 3988
48 Ga0070714_100084964 3300005435 Bacteria 2763
49 Ga0070713_100009385 3300005436 Bacteria 7000
50 Ga0070713_100054055 3300005436 Bacteria 3330
51 Ga0070713_100123504 3300005436 Bacteria 2274
52 Ga0070713_100344323 3300005436 Bacteria 1382
53 Ga0070713_100580833 3300005436 Bacteria 1063
54 Ga0070701_10129753 3300005438 Bacteria 1431
55 Ga0070711_100002443 3300005439 Bacteria 10599
56 Ga0070711_100059377 3300005439 Bacteria 2655
57 Ga0070711_100067101 3300005439 Bacteria 2516
58 Ga0070711_100253733 3300005439 Bacteria 1381
59 Ga0070708_100337544 3300005445 Bacteria 1420
60 Ga0070662_100262480 3300005457 Bacteria 1392
61 Ga0070681_10001496 3300005458 Bacteria 20664
62 Ga0070681_10007203 3300005458 Bacteria 10844
63 Ga0070681_10011027 3300005458 Bacteria 8934
64 Ga0070681_10045901 3300005458 Bacteria 4369
65 Ga0070681_10167210 3300005458 Bacteria 2122
66 Ga0070681_10364249 3300005458 Bacteria 1356
67 Ga0068867_100042458 3300005459 Bacteria 3327
68 Ga0068867_100086264 3300005459 Bacteria 2375
69 Ga0070679_100004686 3300005530 Bacteria 12621
70 Ga0070679_100021143 3300005530 Bacteria 6348
71 Ga0070679_100034341 3300005530 Bacteria 5026
72 Ga0070679_100300055 3300005530 Bacteria 1557
73 Ga0070679_100359295 3300005530 Bacteria 1404
74 Ga0070679_100407376 3300005530 Bacteria 1305
75 Ga0070679_100451863 3300005530 Bacteria 1230
76 Ga0070684_100013887 3300005535 Bacteria 6507
77 Ga0070684_100237551 3300005535 Bacteria 1664
78 Ga0070684_100405165 3300005535 Bacteria 1258
79 Ga0070684_100757124 3300005535 Bacteria 907
80 Ga0068853_100004983 3300005539 Bacteria 10351
81 Ga0068853_100027705 3300005539 Bacteria 4762
82 Ga0068853_100432332 3300005539 Bacteria 1236
83 Ga0070686_100443818 3300005544 Bacteria 996
84 Ga0070695_100018627 3300005545 Bacteria 4217
85 Ga0070693_100009305 3300005547 Bacteria 4882
86 Ga0070665_100005139 3300005548 Bacteria 13555
87 Ga0070665_100022494 3300005548 Bacteria 6345
88 Ga0070665_100033024 3300005548 Bacteria 5207
89 Ga0070665_100138148 3300005548 Bacteria 2440
90 Ga0068855_100010118 3300005563 Bacteria 11367
91 Ga0068855_100019302 3300005563 Bacteria 8191
92 Ga0068855_100020849 3300005563 Bacteria 7860
93 Ga0068855_100023548 3300005563 Bacteria 7373
94 Ga0068855_100029002 3300005563 Bacteria 6619
95 Ga0068855_100080255 3300005563 Bacteria 3783
96 Ga0068855_100121714 3300005563 Bacteria 2986
97 Ga0068855_100184103 3300005563 Bacteria 2360
98 Ga0068855_100283277 3300005563 Bacteria 1840
99 Ga0070664_100120261 3300005564 Bacteria 2299
100 Ga0070664_100199774 3300005564 Unclassified 1784
101 Ga0068857_100000790 3300005577 Bacteria 23681
102 Ga0068857_100004199 3300005577 Bacteria 12128
103 Ga0068857_100022722 3300005577 Bacteria 5517
104 Ga0068857_100024382 3300005577 Bacteria 5324
105 Ga0068856_100004149 3300005614 Bacteria 14474
106 Ga0068856_100005962 3300005614 Bacteria 11994
107 Ga0068856_100045769 3300005614 Bacteria 4309
108 Ga0068856_100070725 3300005614 Bacteria 3453
109 Ga0068856_100070760 3300005614 Bacteria 3452
110 Ga0068856_100403767 3300005614 Bacteria 1386
111 Ga0068856_100759727 3300005614 Bacteria 989
112 Ga0068852_100002171 3300005616 Bacteria 13449
113 Ga0068852_100177490 3300005616 Bacteria 2001
114 Ga0068859_100206836 3300005617 Bacteria 2048
115 Ga0068859_100252796 3300005617 Bacteria 1853
116 Ga0068864_100005999 3300005618 Bacteria 9971
117 Ga0068864_100189039 3300005618 Bacteria 1887
118 Ga0068864_100471113 3300005618 Bacteria 1204
119 Ga0068866_10008545 3300005718 Bacteria 4321
120 Ga0068870_10034990 3300005840 Bacteria 2574
121 Ga0068863_100018731 3300005841 Bacteria 6625
122 Ga0068863_100354075 3300005841 Bacteria 1430
123 Ga0068863_100448638 3300005841 Bacteria 1266
124 Ga0068858_100001542 3300005842 Bacteria 23653
125 Ga0068858_100003877 3300005842 Bacteria 14779
126 Ga0068858_100006802 3300005842 Bacteria 11122
127 Ga0068860_100011391 3300005843 Bacteria 8762
128 Ga0068860_100147958 3300005843 Bacteria 2261
129 Ga0068860_100205706 3300005843 Bacteria 1909
130 Ga0081455_10015198 3300005937 Bacteria 7488
131 Ga0070717_10010260 3300006028 Bacteria 7059
132 Ga0070717_10033479 3300006028 Bacteria 4146
133 Ga0070717_10078483 3300006028 Bacteria 2767
134 Ga0070717_10182538 3300006028 Bacteria 1830
135 Ga0070715_10057162 3300006163 Bacteria 1699
136 Ga0070716_100324303 3300006173 Bacteria 1080
137 Ga0070712_100073892 3300006175 Bacteria 2447
138 Ga0097621_100005371 3300006237 Bacteria 9028
139 Ga0097621_100007647 3300006237 Bacteria 7746
140 Ga0097621_100014634 3300006237 Bacteria 5878
141 Ga0097621_100062449 3300006237 Bacteria 3058
142 Ga0068871_100012854 3300006358 Bacteria 6198
143 Ga0068871_100016891 3300006358 Bacteria 5509
144 Ga0068871_100017407 3300006358 Bacteria 5438
145 Ga0068871_100018950 3300006358 Bacteria 5245
146 Ga0075430_100043961 3300006846 Bacteria 3778
147 Ga0075429_100161386 3300006880 Bacteria 1963
148 Ga0068865_100013356 3300006881 Bacteria 5189
149 Ga0068865_100278970 3300006881 Bacteria 1330
150 Ga0068865_100319328 3300006881 Bacteria 1248
151 Ga0097620_100206833 3300006931 Bacteria 2048
152 Ga0097620_100252775 3300006931 Bacteria 1853
153 Ga0105240_10000274 3300009093 Bacteria 102157
154 Ga0105240_10002178 3300009093 Bacteria 31971
155 Ga0105240_10011874 3300009093 Bacteria 12085
156 Ga0105240_10033367 3300009093 Bacteria 6651
157 Ga0105240_10033878 3300009093 Bacteria 6595
158 Ga0105240_10040539 3300009093 Bacteria 5954
159 Ga0105240_10061451 3300009093 Bacteria 4681
160 Ga0105240_10132607 3300009093 Bacteria 2987
161 Ga0105240_10148558 3300009093 Bacteria 2793
162 Ga0105240_10216889 3300009093 Bacteria 2232
163 Ga0105240_10272401 3300009093 Bacteria 1948
164 Ga0105240_10441965 3300009093 Bacteria 1457
165 Ga0105240_10505297 3300009093 Bacteria 1343
166 Ga0111539_10079758 3300009094 Bacteria 3851
167 Ga0105245_10000447 3300009098 Bacteria 37818
168 Ga0105245_10002618 3300009098 Bacteria 16215
169 Ga0105245_10003095 3300009098 Bacteria 14887
170 Ga0105245_10004761 3300009098 Bacteria 11980
171 Ga0105245_10014832 3300009098 Bacteria 6786
172 Ga0105245_10026788 3300009098 Bacteria 5075
173 Ga0105245_10145316 3300009098 Bacteria 2237
174 Ga0105245_10305158 3300009098 Bacteria 1563
175 Ga0105245_10412759 3300009098 Bacteria 1352
176 Ga0105245_10524389 3300009098 Bacteria 1204
177 Ga0105243_10014997 3300009148 Bacteria 5865
178 Ga0105243_10218389 3300009148 Bacteria 1683
179 Ga0105243_10316133 3300009148 Bacteria 1421
180 Ga0105243_10656996 3300009148 Bacteria 1017
181 Ga0105241_10010135 3300009174 Bacteria 6918
182 Ga0105241_10015583 3300009174 Bacteria 5571
183 Ga0105241_10077774 3300009174 Unclassified 2591
184 Ga0105241_10083314 3300009174 Bacteria 2509
185 Ga0105241_10120859 3300009174 Bacteria 2109
186 Ga0105241_10294275 3300009174 Bacteria 1391
187 Ga0105241_10352341 3300009174 Bacteria 1278
188 Ga0105242_10006136 3300009176 Bacteria 9263
189 Ga0105242_10008793 3300009176 Bacteria 7749
190 Ga0105242_10227334 3300009176 Bacteria 1670
191 Ga0105242_10984365 3300009176 Bacteria 850
192 Ga0105248_10006815 3300009177 Bacteria 12524
193 Ga0105248_10016032 3300009177 Bacteria 8247
194 Ga0105248_10027868 3300009177 Bacteria 6289
195 Ga0105248_10027929 3300009177 Bacteria 6283
196 Ga0105248_10082068 3300009177 Bacteria 3624
197 Ga0105248_10217797 3300009177 Bacteria 2150
198 Ga0105237_10005350 3300009545 Bacteria 14526
199 Ga0105237_10011291 3300009545 Bacteria 9449
200 Ga0105237_10040945 3300009545 Bacteria 4673
201 Ga0105237_10085129 3300009545 Bacteria 3151
202 Ga0105237_10332264 3300009545 Bacteria 1524
203 Ga0105237_10655800 3300009545 Bacteria 1056
204 Ga0105237_10762267 3300009545 Bacteria 974
205 Ga0105238_10003081 3300009551 Bacteria 16629
206 Ga0105238_10003237 3300009551 Bacteria 16268
207 Ga0105238_10018155 3300009551 Bacteria 7153
208 Ga0105238_10021510 3300009551 Bacteria 6570
209 Ga0105238_10030181 3300009551 Bacteria 5517
210 Ga0105238_10053924 3300009551 Bacteria 4040
211 Ga0105238_10102128 3300009551 Bacteria 2850
212 Ga0105238_10138887 3300009551 Bacteria 2407
213 Ga0105238_11239246 3300009551 Bacteria 771
214 Ga0105239_10005776 3300010375 Bacteria 14435
215 Ga0105239_10005927 3300010375 Bacteria 14224
216 Ga0105239_10006454 3300010375 Bacteria 13604
217 Ga0105239_10030226 3300010375 Bacteria 5955
218 Ga0105239_10039005 3300010375 Bacteria 5203
219 Ga0105239_10161602 3300010375 Bacteria 2502
220 Ga0105239_10183882 3300010375 Bacteria 2339
221 Ga0105239_10403780 3300010375 Bacteria 1546
222 Ga0105239_10437265 3300010375 Bacteria 1483
223 Ga0105239_10784934 3300010375 Unclassified 1091
224 Ga0105239_11117893 3300010375 Bacteria 907
225 Ga0105246_10116916 3300011119 Bacteria 1969
226 Ga0105246_10175491 3300011119 Bacteria 1645
227 Ga0157373_10030293 3300013100 Unclassified 3893
228 Ga0157373_10595946 3300013100 Bacteria 804
229 Ga0157370_10001596 3300013104 Bacteria 28016
230 Ga0157370_10012149 3300013104 Bacteria 8954
231 Ga0157370_10017263 3300013104 Bacteria 7285
232 Ga0157370_10023922 3300013104 Bacteria 6057
233 Ga0157370_10030679 3300013104 Bacteria 5266
234 Ga0157370_10079855 3300013104 Bacteria 3081
235 Ga0157370_10105430 3300013104 Bacteria 2638
236 Ga0157370_10194625 3300013104 Bacteria 1882
237 Ga0157370_10221118 3300013104 Bacteria 1754
238 Ga0157369_10003036 3300013105 Bacteria 20028
239 Ga0157369_10003806 3300013105 Bacteria 17917
240 Ga0157369_10015063 3300013105 Bacteria 8728
241 Ga0157369_10039782 3300013105 Bacteria 5138
242 Ga0157369_10091021 3300013105 Bacteria 3257
243 Ga0157369_10129062 3300013105 Bacteria 2680
244 Ga0157369_10131208 3300013105 Bacteria 2655
245 Ga0157369_10228283 3300013105 Bacteria 1947
246 Ga0157369_10355649 3300013105 Bacteria 1521
247 Ga0157369_10457976 3300013105 Bacteria 1321
248 Ga0157369_10660194 3300013105 Bacteria 1078
249 Ga0157374_10002395 3300013296 Bacteria 15806
250 Ga0157374_10003800 3300013296 Bacteria 12699
251 Ga0157374_10024253 3300013296 Bacteria 5435
252 Ga0157374_10273706 3300013296 Bacteria 1665
253 Ga0157374_10349174 3300013296 Bacteria 1470
254 Ga0157374_10379267 3300013296 Bacteria 1408
255 Ga0157374_10871819 3300013296 Bacteria 917
256 Ga0157378_10003109 3300013297 Bacteria 14757
257 Ga0157378_10019988 3300013297 Bacteria 5888
258 Ga0157378_10024916 3300013297 Bacteria 5269
259 Ga0163162_10006031 3300013306 Bacteria 11730
260 Ga0163162_10043912 3300013306 Bacteria 4475
261 Ga0163162_10150931 3300013306 Bacteria 2441
262 Ga0163162_10659789 3300013306 Bacteria 1169
263 Ga0157372_10007106 3300013307 Bacteria 11934
264 Ga0157372_10050977 3300013307 Bacteria 4605
265 Ga0157372_10062722 3300013307 Bacteria 4165
266 Ga0157372_10087181 3300013307 Bacteria 3541
267 Ga0157372_10136955 3300013307 Bacteria 2820
268 Ga0157372_10137640 3300013307 Bacteria 2813
269 Ga0157375_10061170 3300013308 Bacteria 3738
270 Ga0157375_10099261 3300013308 Bacteria 2990
271 Ga0157375_10241197 3300013308 Bacteria 1967
272 Ga0163163_10016068 3300014325 Bacteria 6942
273 Ga0163163_10020349 3300014325 Bacteria 6248
274 Ga0163163_10023966 3300014325 Bacteria 5804
275 Ga0163163_10030713 3300014325 Bacteria 5180
276 Ga0163163_10031458 3300014325 Bacteria 5121
277 Ga0163163_10329102 3300014325 Bacteria 1582
278 Ga0163163_10466879 3300014325 Bacteria 1323
279 Ga0157380_10187970 3300014326 Bacteria 1821
280 Ga0157379_10011397 3300014968 Bacteria 7757
281 Ga0157379_10137054 3300014968 Bacteria 2205
282 Ga0157379_10148857 3300014968 Bacteria 2112
283 Ga0157379_10376799 3300014968 Bacteria 1302
284 Ga0157379_10584877 3300014968 Bacteria 1041
285 Ga0157376_10138692 3300014969 Bacteria 2179
286 Ga0157376_10252438 3300014969 Bacteria 1648
287 Ga0197907_10859770 3300020069 Bacteria 1684
288 Ga0206356_10454340 3300020070 Bacteria 830
289 Ga0206356_11045281 3300020070 Bacteria 1141
290 Ga0206355_1651917 3300020076 Bacteria 1311
291 Ga0213872_10001072 3300021361 Bacteria 18898
292 Ga0213872_10153312 3300021361 Bacteria 1006
293 Ga0213874_10023914 3300021377 Bacteria 1708
294 Ga0213874_10100895 3300021377 Bacteria 959
295 Ga0213876_10012503 3300021384 Bacteria 4517
296 Ga0213876_10016270 3300021384 Bacteria 3931
297 Ga0213876_10132648 3300021384 Bacteria 1324
298 Ga0213876_10150904 3300021384 Bacteria 1236
299 Ga0213875_10000006 3300021388 Bacteria 579005
300 Ga0213875_10001049 3300021388 Bacteria 19432
301 Ga0213875_10002883 3300021388 Bacteria 10054
302 Ga0213875_10021508 3300021388 Bacteria 3089
303 Ga0213875_10035343 3300021388 Bacteria 2358
304 Ga0213875_10178589 3300021388 Bacteria 997
305 Ga0207642_10044875 3300025899 Bacteria 1959
306 Ga0207680_10004668 3300025903 Bacteria 6506
307 Ga0207685_10013592 3300025905 Bacteria 2523
308 Ga0207643_10069935 3300025908 Bacteria 2018
309 Ga0207705_10184026 3300025909 Bacteria 1578
310 Ga0207705_10403704 3300025909 Bacteria 1057
311 Ga0207705_10467180 3300025909 Bacteria 979
312 Ga0207654_10022542 3300025911 Bacteria 3361
313 Ga0207654_10030168 3300025911 Bacteria 2974
314 Ga0207654_10046425 3300025911 Bacteria 2477
315 Ga0207654_10158078 3300025911 Unclassified 1461
316 Ga0207707_10001047 3300025912 Bacteria 26538
317 Ga0207707_10018363 3300025912 Bacteria 6095
318 Ga0207707_10031591 3300025912 Bacteria 4634
319 Ga0207707_10169283 3300025912 Bacteria 1909
320 Ga0207707_10197043 3300025912 Bacteria 1757
321 Ga0207695_10005000 3300025913 Bacteria 17819
322 Ga0207695_10006447 3300025913 Bacteria 15238
323 Ga0207695_10006718 3300025913 Bacteria 14848
324 Ga0207695_10009409 3300025913 Bacteria 12087
325 Ga0207695_10014848 3300025913 Bacteria 9198
326 Ga0207695_10048028 3300025913 Bacteria 4511
327 Ga0207695_10055897 3300025913 Bacteria 4110
328 Ga0207695_10069951 3300025913 Bacteria 3590
329 Ga0207695_10111782 3300025913 Bacteria 2711
330 Ga0207695_10132873 3300025913 Bacteria 2445
331 Ga0207671_10009331 3300025914 Bacteria 8212
332 Ga0207671_10021312 3300025914 Bacteria 4918
333 Ga0207671_10027811 3300025914 Bacteria 4227
334 Ga0207671_10115990 3300025914 Bacteria 2042
335 Ga0207671_10584694 3300025914 Bacteria 890
336 Ga0207693_10112286 3300025915 Bacteria 2138
337 Ga0207663_10007117 3300025916 Bacteria 5780
338 Ga0207660_10011922 3300025917 Bacteria 5673
339 Ga0207660_10108377 3300025917 Bacteria 2086
340 Ga0207660_10193946 3300025917 Bacteria 1583
341 Ga0207660_10276528 3300025917 Bacteria 1331
342 Ga0207657_10003906 3300025919 Bacteria 15817
343 Ga0207657_10043809 3300025919 Bacteria 3939
344 Ga0207657_10046709 3300025919 Bacteria 3791
345 Ga0207657_10050491 3300025919 Bacteria 3620
346 Ga0207657_10082339 3300025919 Unclassified 2701
347 Ga0207649_10035332 3300025920 Unclassified 3003
348 Ga0207649_10070152 3300025920 Bacteria 2234
349 Ga0207649_10089753 3300025920 Bacteria 2010
350 Ga0207649_10315723 3300025920 Bacteria 1147
351 Ga0207652_10019881 3300025921 Bacteria 5528
352 Ga0207652_10020936 3300025921 Bacteria 5392
353 Ga0207652_10033109 3300025921 Bacteria 4350
354 Ga0207652_10057173 3300025921 Bacteria 3359
355 Ga0207652_10067919 3300025921 Bacteria 3092
356 Ga0207652_10205405 3300025921 Bacteria 1773
357 Ga0207652_10361914 3300025921 Bacteria 1309
358 Ga0207652_10686346 3300025921 Bacteria 914
359 Ga0207681_10209431 3300025923 Bacteria 1502
360 Ga0207681_10473654 3300025923 Bacteria 1022
361 Ga0207694_10001067 3300025924 Bacteria 23855
362 Ga0207694_10002799 3300025924 Bacteria 14079
363 Ga0207694_10004825 3300025924 Bacteria 10464
364 Ga0207694_10097408 3300025924 Bacteria 2327
365 Ga0207694_10171605 3300025924 Bacteria 1756
366 Ga0207687_10000964 3300025927 Bacteria 19563
367 Ga0207687_10006530 3300025927 Bacteria 7705
368 Ga0207687_10009132 3300025927 Bacteria 6483
369 Ga0207687_10019358 3300025927 Bacteria 4510
370 Ga0207687_10029031 3300025927 Bacteria 3718
371 Ga0207687_10122848 3300025927 Bacteria 1944
372 Ga0207687_10169854 3300025927 Bacteria 1681
373 Ga0207687_10238784 3300025927 Bacteria 1439
374 Ga0207687_10252271 3300025927 Bacteria 1403
375 Ga0207687_10268261 3300025927 Bacteria 1363
376 Ga0207687_10415385 3300025927 Bacteria 1109
377 Ga0207700_10000943 3300025928 Bacteria 16733
378 Ga0207700_10043288 3300025928 Bacteria 3307
379 Ga0207700_10236719 3300025928 Bacteria 1555
380 Ga0207700_10305242 3300025928 Bacteria 1375
381 Ga0207700_10489829 3300025928 Bacteria 1087
382 Ga0207664_10004685 3300025929 Bacteria 9279
383 Ga0207664_10040983 3300025929 Bacteria 3605
384 Ga0207664_10184273 3300025929 Bacteria 1794
385 Ga0207644_10043393 3300025931 Bacteria 3191
386 Ga0207644_10183215 3300025931 Bacteria 1642
387 Ga0207690_10053424 3300025932 Bacteria 2711
388 Ga0207690_10330986 3300025932 Bacteria 1200
389 Ga0207706_10318078 3300025933 Bacteria 1355
390 Ga0207686_10004152 3300025934 Bacteria 7773
391 Ga0207686_10014133 3300025934 Bacteria 4437
392 Ga0207686_10034017 3300025934 Bacteria 3047
393 Ga0207686_10075425 3300025934 Bacteria 2183
394 Ga0207686_10261218 3300025934 Bacteria 1270
395 Ga0207686_10311698 3300025934 Bacteria 1172
396 Ga0207709_10146685 3300025935 Bacteria 1629
397 Ga0207709_10150652 3300025935 Bacteria 1611
398 Ga0207709_10259239 3300025935 Bacteria 1274
399 Ga0207669_10196928 3300025937 Bacteria 1459
400 Ga0207704_10097129 3300025938 Bacteria 1952
401 Ga0207704_10151142 3300025938 Bacteria 1638
402 Ga0207665_10077784 3300025939 Bacteria 2278
403 Ga0207711_10001158 3300025941 Bacteria 25079
404 Ga0207711_10031660 3300025941 Bacteria 4467
405 Ga0207711_10095633 3300025941 Bacteria 2620
406 Ga0207711_10255279 3300025941 Bacteria 1611
407 Ga0207711_10537110 3300025941 Bacteria 1090
408 Ga0207689_10021053 3300025942 Bacteria 5481
409 Ga0207689_10055248 3300025942 Unclassified 3268
410 Ga0207661_10011740 3300025944 Bacteria 6359
411 Ga0207661_10014575 3300025944 Bacteria 5766
412 Ga0207661_10037925 3300025944 Bacteria 3774
413 Ga0207661_10050300 3300025944 Bacteria 3320
414 Ga0207661_10065181 3300025944 Bacteria 2956
415 Ga0207661_10249220 3300025944 Bacteria 1578
416 Ga0207661_10342394 3300025944 Bacteria 1347
417 Ga0207661_10538105 3300025944 Bacteria 1069
418 Ga0207679_10078634 3300025945 Bacteria 2513
419 Ga0207679_10312172 3300025945 Bacteria 1359
420 Ga0207667_10001521 3300025949 Bacteria 29152
421 Ga0207667_10012021 3300025949 Bacteria 10018
422 Ga0207667_10024359 3300025949 Bacteria 6645
423 Ga0207667_10026176 3300025949 Bacteria 6377
424 Ga0207667_10029301 3300025949 Bacteria 5971
425 Ga0207667_10084121 3300025949 Bacteria 3294
426 Ga0207667_10085681 3300025949 Bacteria 3261
427 Ga0207667_10456845 3300025949 Bacteria 1297
428 Ga0207667_10772070 3300025949 Bacteria 959
429 Ga0207658_10011177 3300025986 Bacteria 6115
430 Ga0207677_10083635 3300026023 Bacteria 2298
431 Ga0207677_10336594 3300026023 Bacteria 1259
432 Ga0207703_10006165 3300026035 Bacteria 9596
433 Ga0207703_10311305 3300026035 Bacteria 1439
434 Ga0207639_10013984 3300026041 Bacteria 5632
435 Ga0207639_10027271 3300026041 Bacteria 4159
436 Ga0207639_10148663 3300026041 Bacteria 1960
437 Ga0207639_10229075 3300026041 Bacteria 1609
438 Ga0207678_10126725 3300026067 Bacteria 2178
439 Ga0207678_10670162 3300026067 Bacteria 912
440 Ga0207702_10012636 3300026078 Bacteria 7030
441 Ga0207702_10016559 3300026078 Bacteria 6101
442 Ga0207702_10030519 3300026078 Unclassified 4492
443 Ga0207702_10034261 3300026078 Bacteria 4245
444 Ga0207702_10047756 3300026078 Bacteria 3608
445 Ga0207702_10060519 3300026078 Bacteria 3228
446 Ga0207702_10102411 3300026078 Bacteria 2530
447 Ga0207702_10185951 3300026078 Bacteria 1916
448 Ga0207702_10359159 3300026078 Bacteria 1396
449 Ga0207702_10374270 3300026078 Bacteria 1368
450 Ga0207641_10032025 3300026088 Bacteria 4364
451 Ga0207641_10096674 3300026088 Bacteria 2594
452 Ga0207641_10427467 3300026088 Bacteria 1276
453 Ga0207648_10006646 3300026089 Bacteria 11475
454 Ga0207648_10031660 3300026089 Bacteria 4675
455 Ga0207648_10106099 3300026089 Bacteria 2465
456 Ga0207676_10012856 3300026095 Bacteria 6011
457 Ga0207676_10407317 3300026095 Bacteria 1272
458 Ga0207674_10002017 3300026116 Bacteria 25760
459 Ga0207674_10005796 3300026116 Bacteria 14656
460 Ga0207674_10007190 3300026116 Bacteria 12996
461 Ga0207674_10014561 3300026116 Bacteria 8680
462 Ga0207674_10014679 3300026116 Bacteria 8637
463 Ga0207674_10325564 3300026116 Bacteria 1486
464 Ga0207683_10632683 3300026121 Bacteria 991
465 Ga0207698_10006849 3300026142 Bacteria 7129
466 Ga0207698_10067586 3300026142 Bacteria 2819
467 Ga0207698_10231458 3300026142 Unclassified 1678
468 Ga0268266_10019797 3300028379 Bacteria 5736
469 Ga0268266_10095386 3300028379 Bacteria 2612
470 Ga0268266_10165912 3300028379 Bacteria 2001
471 Ga0268264_10004942 3300028381 Bacteria 11291
472 Ga0268264_10143385 3300028381 Bacteria 2133
473 Ga0265323_10000500 3300028653 Bacteria 22040
474 Ga0265338_10014618 3300028800 Bacteria 8711
475 Ga0265338_10117427 3300028800 Bacteria 2129
476 Ga0265338_10135503 3300028800 Bacteria 1937
477 Ga0265338_10311645 3300028800 Bacteria 1141
478 Ga0265760_10078004 3300031090 Bacteria 1023
479 Ga0265330_10147666 3300031235 Bacteria 999
480 Ga0265332_10097923 3300031238 Bacteria 1238
481 Ga0265320_10003368 3300031240 Bacteria 10775
482 Ga0265325_10005920 3300031241 Bacteria 7493
483 Ga0265325_10135243 3300031241 Bacteria 1177
484 Ga0265340_10003837 3300031247 Bacteria 8475
485 Ga0265340_10063930 3300031247 Bacteria 1755
486 Ga0265339_10030241 3300031249 Bacteria 3068
487 Ga0265331_10013264 3300031250 Bacteria 4438
488 Ga0265331_10017666 3300031250 Bacteria 3713
489 Ga0265331_10111064 3300031250 Bacteria 1257
490 Ga0265316_10000651 3300031344 Bacteria 38560
491 Ga0265316_10032903 3300031344 Bacteria 4228
492 Ga0265316_10080433 3300031344 Bacteria 2499
493 Ga0265316_10086444 3300031344 Bacteria 2397
494 Ga0265316_10147446 3300031344 Bacteria 1764
495 Ga0265313_10012976 3300031595 Bacteria 5041
496 Ga0265314_10000978 3300031711 Bacteria 33599
497 Ga0265314_10003057 3300031711 Bacteria 16493
498 Ga0265314_10039853 3300031711 Bacteria 3379
499 Ga0265314_10098089 3300031711 Bacteria 1891
500 Ga0265314_10114972 3300031711 Bacteria 1704
501 Ga0373926_0042638 3300035083 Bacteria 1623
502 Ga0373934_0015860 3300035086 Bacteria 2862
503 Ga0373940_0097573 3300035088 Bacteria 888
504 Ga0373923_0091972 3300035111 Bacteria 1328
505 Ga0373953_0117029 3300035117 Bacteria 1130
506 Ga0373954_0012114 3300035118 Bacteria 3832
507 Ga0373954_0051025 3300035118 Bacteria 1942
508 Ga0373956_0033197 3300035119 Bacteria 2269
509 Ga0373957_0014628 3300035120 Bacteria 2686
510 Ga0373943_0041382 3300035170 Bacteria 2228
511 Ga0373943_0270249 3300035170 Bacteria 959
512 Ga0373955_0021498 3300035172 Bacteria 3258
513 Ga0373955_0049648 3300035172 Bacteria 2279
514 Ga0373955_0151081 3300035172 Bacteria 1367
515 Ga0373955_0341361 3300035172 Bacteria 906
516 Ga0373935_0024179 3300035692 Bacteria 3738
517 Ga0373935_0080836 3300035692 Bacteria 2112
518 Ga0373935_0425698 3300035692 Bacteria 956
519 Ga0373935_0581740 3300035692 Bacteria 818
520 Ga0373927_0001052 3300035695 Bacteria 21044
521 Ga0373927_0004677 3300035695 Bacteria 9546
522 Ga0373927_0241635 3300035695 Bacteria 1187
523 Ga0373947_0353758 3300035725 Bacteria 986
524 Ga0373947_0478396 3300035725 Bacteria 845
525 Ga0373937_0003169 3300036401 Bacteria 13765
526 Ga0373937_0013616 3300036401 Bacteria 7166
527 Ga0373937_0016750 3300036401 Bacteria 6514
528 Ga0373937_0027195 3300036401 Bacteria 5171
529 Ga0373937_0410632 3300036401 Bacteria 1285
530 Ga0373925_0007535 3300037068 Bacteria 7936
531 Ga0373925_0027993 3300037068 Bacteria 4127
532 Ga0373925_0179233 3300037068 Bacteria 1676
533 Ga0373925_0207423 3300037068 Bacteria 1560
534 Ga0373925_0219991 3300037068 Bacteria 1516
535 Ga0373925_0364682 3300037068 Bacteria 1175
536 Ga0395900_0142059 3300037418 Bacteria 2458
537 Ga0395900_0517851 3300037418 Bacteria 1141
538 Ga0395898_0372775 3300037466 Bacteria 1361
539 Ga0436364_0068208 3300037853 Bacteria 1137
540 Ga0436364_0092234 3300037853 Bacteria 1488
541 Ga0436364_0151982 3300037853 Bacteria 12112
542 Ga0436364_0223933 3300037853 Bacteria 4519
543 Ga0436364_0251175 3300037853 Unclassified 1119
544 Ga0436364_0258301 3300037853 Bacteria 9224
545 Ga0436364_0365832 3300037853 Bacteria 997
546 Ga0436364_0455762 3300037853 Bacteria 7240
547 Ga0436364_0470999 3300037853 Bacteria 5046
548 Ga0436364_0478514 3300037853 Bacteria 578677
549 Ga0436364_0716408 3300037853 Bacteria 6814
550 Ga0436364_0908431 3300037853 Bacteria 1308
551 Ga0436364_0951596 3300037853 Bacteria 37753
552 Ga0436364_1003470 3300037853 Bacteria 1670
553 Ga0436364_1286416 3300037853 Bacteria 2797
554 Ga0395901_0288722 3300038443 Bacteria 1703
555 Ga0436365_0283512 3300039437 Bacteria 3168
556 Ga0436365_0448772 3300039437 Bacteria 1161
557 Ga0436365_0607409 3300039437 Bacteria 18470
558 Ga0436365_0784658 3300039437 Bacteria 1633
559 Ga0436365_0801257 3300039437 Bacteria 6004
560 Ga0436365_0944327 3300039437 Bacteria 1279
561 Ga0436365_1077291 3300039437 Bacteria 4940
562 Ga0436365_1198503 3300039437 Unclassified 4442
563 Ga0436365_1461893 3300039437 Bacteria 1071
564 Ga0436365_1607801 3300039437 Bacteria 6655
565 Ga0436360_0523032 3300039438 Bacteria 2892
566 Ga0436360_0798526 3300039438 Bacteria 1416
567 Ga0436360_0826829 3300039438 Bacteria 2634
568 Ga0436361_0815288 3300039447 Bacteria 63464
569 Ga0436363_1312202 3300039450 Bacteria 1195
570 Ga0436363_1378468 3300039450 Bacteria 3638
571 Ga0436363_1620560 3300039450 Bacteria 2376
572 Ga0436362_0244189 3300039453 Bacteria 2951
573 Ga0436362_0556066 3300039453 Bacteria 6082
574 Ga0436362_1019307 3300039453 Bacteria 1218
575 Ga0436362_1206832 3300039453 Bacteria 2026
576 Ga0451577_0152461 3300042876 Bacteria 2080
577 Ga0466966_0043927 3300044684 Bacteria 2863
578 Ga0466966_0141057 3300044684 Bacteria 1473
579 Ga0466963_0174620 3300044694 Bacteria 1499
580 Ga0466959_0267062 3300045049 Bacteria 1177
581 Ga0466958_0051927 3300045836 Bacteria 2484
582 Ga0495651_0119628 3300046462 Bacteria 1937
583 Ga0495651_0141895 3300046462 Bacteria 1741
584 Ga0495580_0005503 3300046472 Bacteria 10463
585 Ga0495580_0012881 3300046472 Bacteria 6408
586 Ga0495580_0044863 3300046472 Bacteria 3143
587 Ga0495580_0073149 3300046472 Bacteria 2393
588 Ga0495580_0224482 3300046472 Bacteria 1290
589 Ga0495580_0312339 3300046472 Bacteria 1069
590 Ga0495582_0020610 3300046473 Bacteria 3609
591 Ga0495639_0164121 3300046475 Bacteria 1076
592 Ga0495664_0097800 3300046477 Bacteria 1767
593 Ga0495664_0228654 3300046477 Bacteria 1126
594 Ga0495594_0060616 3300046499 Bacteria 2093
595 Ga0495608_0079868 3300046511 Bacteria 2127
596 Ga0495618_0059782 3300046514 Bacteria 2416
597 Ga0495666_0143722 3300046526 Bacteria 1111
598 Ga0495652_0066489 3300046529 Bacteria 3025
599 Ga0495665_0053700 3300046531 Bacteria 2130
600 Ga0495640_0041902 3300046533 Bacteria 3197
601 Ga0495587_0005431 3300046536 Bacteria 8319
602 Ga0495587_0038527 3300046536 Bacteria 2865
603 Ga0495645_0055396 3300046543 Bacteria 2879
604 Ga0495645_0260406 3300046543 Bacteria 1149
605 Ga0495635_0222864 3300046663 Bacteria 1275
606 Ga0495657_0392919 3300046675 Bacteria 817
607 Ga0495599_0085790 3300046678 Bacteria 1966
608 Ga0495613_0069246 3300046689 Bacteria 2573
609 Ga0495636_0034560 3300047318 Bacteria 2081
610 Ga0495674_0005943 3300047319 Bacteria 11711
611 Ga0495674_0503878 3300047319 Bacteria 968
612 Ga0495675_0126841 3300047444 Bacteria 1588
613 Ga0495675_0174712 3300047444 Bacteria 1318
614 Ga0495684_0019177 3300047471 Bacteria 5265
615 Ga0495684_0022645 3300047471 Bacteria 4832
616 Ga0495684_0100719 3300047471 Bacteria 2184
617 Ga0495602_0144847 3300048088 Bacteria 1876
618 Ga0495602_0345536 3300048088 Bacteria 1075
619 Ga0495614_0091419 3300048089 Bacteria 1324
620 Ga0496101_0088892 3300048904 Bacteria 2295
621 Ga0496101_0300217 3300048904 Bacteria 1258
622 Ga0496102_0253561 3300048905 Bacteria 1659
623 Ga0496102_0347565 3300048905 Bacteria 1396
624 Ga0496104_0241806 3300048907 Bacteria 1717
625 Ga0496105_0341836 3300048908 Bacteria 1196
626 Ga0496106_0548632 3300048909 Bacteria 927
627 Ga0496107_0240497 3300048910 Bacteria 1347
628 Ga0496108_0215339 3300048911 Bacteria 1668
629 Ga0496109_0074655 3300048912 Bacteria 3117
630 Ga0496110_0098800 3300048913 Bacteria 2616
631 Ga0496110_0545358 3300048913 Bacteria 1054
632 Ga0496111_0087956 3300048914 Bacteria 2274
633 Ga0496112_0293343 3300048915 Bacteria 1572
634 Ga0496113_0085017 3300048916 Bacteria 2430
635 Ga0496114_0160041 3300048917 Bacteria 1957
636 Ga0496114_0401052 3300048917 Bacteria 1214
637 Ga0496115_0051941 3300048918 Unclassified 3287
638 Ga0496115_0115532 3300048918 Bacteria 2207
639 Ga0501031_0019815 3300049568 Bacteria 4384
640 Ga0501032_0001449 3300049569 Bacteria 18862
641 Ga0501033_0044977 3300049570 Bacteria 3286
642 Ga0501034_0004117 3300049571 Bacteria 16304
643 Ga0501034_0253370 3300049571 Bacteria 1704
644 Ga0501036_0000348 3300049572 Bacteria 32585
645 Ga0501037_0020752 3300049573 Bacteria 4850
646 Ga0501037_0053224 3300049573 Bacteria 2961
647 Ga0501038_0009219 3300049574 Bacteria 9053
648 Ga0501038_0371570 3300049574 Bacteria 1110
649 Ga0501039_0070841 3300049575 Bacteria 2708
650 Ga0501043_0000174 3300049579 Bacteria 57374
651 Ga0501046_0001226 3300049580 Bacteria 24842
652 Ga0501046_0411604 3300049580 Bacteria 976
653 Ga0501047_0080965 3300049581 Bacteria 3122
654 Ga0501047_0106687 3300049581 Bacteria 2682
655 Ga0501047_0107454 3300049581 Bacteria 2671
656 Ga0501048_0066144 3300049582 Bacteria 2556
657 Ga0501067_0001324 3300049583 Bacteria 13404
658 Ga0501068_0000795 3300049584 Bacteria 16328
659 Ga0501068_0155844 3300049584 Bacteria 1438
660 Ga0501069_0003845 3300049585 Bacteria 7741
661 Ga0501070_0006532 3300049586 Bacteria 9917
662 Ga0501070_0015059 3300049586 Bacteria 6509
663 Ga0501070_0258264 3300049586 Bacteria 1424
664 Ga0501072_0000291 3300049588 Bacteria 35610
665 Ga0501073_0004818 3300049589 Bacteria 10127
666 Ga0501073_0185887 3300049589 Bacteria 1438
667 Ga0501074_0012149 3300049590 Bacteria 6260
668 Ga0501076_0014769 3300049592 Bacteria 5888
669 Ga0501077_0025006 3300049593 Bacteria 3792
670 Ga0501249_003944 3300049679 Bacteria 3003
671 Ga0501079_0001684 3300049741 Bacteria 15723
672 Ga0501079_0174844 3300049741 Bacteria 1675
673 Ga0501080_0000011 3300049742 Bacteria 113928
674 Ga0501083_0075325 3300049744 Bacteria 2241
675 Ga0501035_0011313 3300049822 Bacteria 8270
676 Ga0501035_0104621 3300049822 Bacteria 2482
677 Ga0501044_0001227 3300049823 Bacteria 30468
678 Ga0501044_0007391 3300049823 Bacteria 12084
679 Ga0501044_0014511 3300049823 Bacteria 8498
680 Ga0501044_0061454 3300049823 Bacteria 3843
681 nmdc:mga09592_143918_c1 3300050508 Bacteria 2055
682 nmdc:mga0qj67_13989_c1 3300050509 Bacteria 6060
683 Ga0495601_0100676 3300053077 Bacteria 1866
684 Ga0495601_0335561 3300053077 Bacteria 984
685 Ga0501084_0001549 3300054114 Bacteria 18274
686 Ga0501082_0003248 3300060353 Bacteria 14181
687 Ga0207662_10564704
688 Ga0070658_10000619
689 Ga0070658_10094135
690 Ga0070658_10178674
691 Ga0070658_10353896
692 Ga0070658_10650758
693 Ga0070658_10702046
694 Ga0070683_100002169
695 Ga0070683_100017698
696 Ga0070683_100143762
697 Ga0070683_100151362
698 Ga0070683_100315828
699 Ga0070683_100551759
700 Ga0070690_100555447
701 Ga0068869_100052763
702 Ga0068869_100156055
703 Ga0070666_10004136
704 Ga0070680_100002391
705 Ga0070680_100015499
706 Ga0070680_100261258
707 Ga0070682_100119457
708 Ga0070682_100260329
709 Ga0068868_100029963
710 Ga0068868_100106884
711 Ga0068868_100285112
712 Ga0070660_100041656
713 Ga0070660_100070593
714 Ga0070660_100086890
715 Ga0070660_100258952
716 Ga0070660_100266736
717 Ga0070691_10016052
718 Ga0070661_100016041
719 Ga0070661_100162082
720 Ga0070692_10025986
721 Ga0070671_100153472
722 Ga0070671_100239554
723 Ga0070674_100144701
724 Ga0070674_100401019
725 Ga0070674_100465873
726 Ga0070674_100583552
727 Ga0070673_100395593
728 Ga0070688_100337981
729 Ga0070659_100144196
730 Ga0070667_100085012
731 Ga0070667_100374090
732 Ga0070714_100005514
733 Ga0070714_100039193
734 Ga0070714_100084964
735 Ga0070713_100009385
736 Ga0070713_100054055
737 Ga0070713_100123504
738 Ga0070713_100344323
739 Ga0070713_100580833
740 Ga0070701_10129753
741 Ga0070711_100002443
742 Ga0070711_100059377
743 Ga0070711_100067101
744 Ga0070711_100253733
745 Ga0070708_100337544
746 Ga0070662_100262480
747 Ga0070681_10001496
748 Ga0070681_10007203
749 Ga0070681_10011027
750 Ga0070681_10045901
751 Ga0070681_10167210
752 Ga0070681_10364249
753 Ga0068867_100042458
754 Ga0068867_100086264
755 Ga0070679_100004686
756 Ga0070679_100021143
757 Ga0070679_100034341
758 Ga0070679_100300055
759 Ga0070679_100359295
760 Ga0070679_100407376
761 Ga0070679_100451863
762 Ga0070684_100013887
763 Ga0070684_100237551
764 Ga0070684_100405165
765 Ga0070684_100757124
766 Ga0068853_100004983
767 Ga0068853_100027705
768 Ga0068853_100432332
769 Ga0070686_100443818
770 Ga0070695_100018627
771 Ga0070693_100009305
772 Ga0070665_100005139
773 Ga0070665_100022494
774 Ga0070665_100033024
775 Ga0070665_100138148
776 Ga0068855_100010118
777 Ga0068855_100019302
778 Ga0068855_100020849
779 Ga0068855_100023548
780 Ga0068855_100029002
781 Ga0068855_100080255
782 Ga0068855_100121714
783 Ga0068855_100184103
784 Ga0068855_100283277
785 Ga0070664_100120261
786 Ga0070664_100199774
787 Ga0068857_100000790
788 Ga0068857_100004199
789 Ga0068857_100022722
790 Ga0068857_100024382
791 Ga0068856_100004149
792 Ga0068856_100005962
793 Ga0068856_100045769
794 Ga0068856_100070725
795 Ga0068856_100070760
796 Ga0068856_100403767
797 Ga0068856_100759727
798 Ga0068852_100002171
799 Ga0068852_100177490
800 Ga0068859_100206836
801 Ga0068859_100252796
802 Ga0068864_100005999
803 Ga0068864_100189039
804 Ga0068864_100471113
805 Ga0068866_10008545
806 Ga0068870_10034990
807 Ga0068863_100018731
808 Ga0068863_100354075
809 Ga0068863_100448638
810 Ga0068858_100001542
811 Ga0068858_100003877
812 Ga0068858_100006802
813 Ga0068860_100011391
814 Ga0068860_100147958
815 Ga0068860_100205706
816 Ga0081455_10015198
817 Ga0070717_10010260
818 Ga0070717_10033479
819 Ga0070717_10078483
820 Ga0070717_10182538
821 Ga0070715_10057162
822 Ga0070716_100324303
823 Ga0070712_100073892
824 Ga0097621_100005371
825 Ga0097621_100007647
826 Ga0097621_100014634
827 Ga0097621_100062449
828 Ga0068871_100012854
829 Ga0068871_100016891
830 Ga0068871_100017407
831 Ga0068871_100018950
832 Ga0075430_100043961
833 Ga0075429_100161386
834 Ga0068865_100013356
835 Ga0068865_100278970
836 Ga0068865_100319328
837 Ga0097620_100206833
838 Ga0097620_100252775
839 Ga0105240_10000274
840 Ga0105240_10002178
841 Ga0105240_10011874
842 Ga0105240_10033367
843 Ga0105240_10033878
844 Ga0105240_10040539
845 Ga0105240_10061451
846 Ga0105240_10132607
847 Ga0105240_10148558
848 Ga0105240_10216889
849 Ga0105240_10272401
850 Ga0105240_10441965
851 Ga0105240_10505297
852 Ga0111539_10079758
853 Ga0105245_10000447
854 Ga0105245_10002618
855 Ga0105245_10003095
856 Ga0105245_10004761
857 Ga0105245_10014832
858 Ga0105245_10026788
859 Ga0105245_10145316
860 Ga0105245_10305158
861 Ga0105245_10412759
862 Ga0105245_10524389
863 Ga0105243_10014997
864 Ga0105243_10218389
865 Ga0105243_10316133
866 Ga0105243_10656996
867 Ga0105241_10010135
868 Ga0105241_10015583
869 Ga0105241_10077774
870 Ga0105241_10083314
871 Ga0105241_10120859
872 Ga0105241_10294275
873 Ga0105241_10352341
874 Ga0105242_10006136
875 Ga0105242_10008793
876 Ga0105242_10227334
877 Ga0105242_10984365
878 Ga0105248_10006815
879 Ga0105248_10016032
880 Ga0105248_10027868
881 Ga0105248_10027929
882 Ga0105248_10082068
883 Ga0105248_10217797
884 Ga0105237_10005350
885 Ga0105237_10011291
886 Ga0105237_10040945
887 Ga0105237_10085129
888 Ga0105237_10332264
889 Ga0105237_10655800
890 Ga0105237_10762267
891 Ga0105238_10003081
892 Ga0105238_10003237
893 Ga0105238_10018155
894 Ga0105238_10021510
895 Ga0105238_10030181
896 Ga0105238_10053924
897 Ga0105238_10102128
898 Ga0105238_10138887
899 Ga0105238_11239246
900 Ga0105239_10005776
901 Ga0105239_10005927
902 Ga0105239_10006454
903 Ga0105239_10030226
904 Ga0105239_10039005
905 Ga0105239_10161602
906 Ga0105239_10183882
907 Ga0105239_10403780
908 Ga0105239_10437265
909 Ga0105239_10784934
910 Ga0105239_11117893
911 Ga0105246_10116916
912 Ga0105246_10175491
913 Ga0157373_10030293
914 Ga0157373_10595946
915 Ga0157370_10001596
916 Ga0157370_10012149
917 Ga0157370_10017263
918 Ga0157370_10023922
919 Ga0157370_10030679
920 Ga0157370_10079855
921 Ga0157370_10105430
922 Ga0157370_10194625
923 Ga0157370_10221118
924 Ga0157369_10003036
925 Ga0157369_10003806
926 Ga0157369_10015063
927 Ga0157369_10039782
928 Ga0157369_10091021
929 Ga0157369_10129062
930 Ga0157369_10131208
931 Ga0157369_10228283
932 Ga0157369_10355649
933 Ga0157369_10457976
934 Ga0157369_10660194
935 Ga0157374_10002395
936 Ga0157374_10003800
937 Ga0157374_10024253
938 Ga0157374_10273706
939 Ga0157374_10349174
940 Ga0157374_10379267
941 Ga0157374_10871819
942 Ga0157378_10003109
943 Ga0157378_10019988
944 Ga0157378_10024916
945 Ga0163162_10006031
946 Ga0163162_10043912
947 Ga0163162_10150931
948 Ga0163162_10659789
949 Ga0157372_10007106
950 Ga0157372_10050977
951 Ga0157372_10062722
952 Ga0157372_10087181
953 Ga0157372_10136955
954 Ga0157372_10137640
955 Ga0157375_10061170
956 Ga0157375_10099261
957 Ga0157375_10241197
958 Ga0163163_10016068
959 Ga0163163_10020349
960 Ga0163163_10023966
961 Ga0163163_10030713
962 Ga0163163_10031458
963 Ga0163163_10329102
964 Ga0163163_10466879
965 Ga0157380_10187970
966 Ga0157379_10011397
967 Ga0157379_10137054
968 Ga0157379_10148857
969 Ga0157379_10376799
970 Ga0157379_10584877
971 Ga0157376_10138692
972 Ga0157376_10252438
973 Ga0197907_10859770
974 Ga0206356_10454340
975 Ga0206356_11045281
976 Ga0206355_1651917
977 Ga0213872_10001072
978 Ga0213872_10153312
979 Ga0213874_10023914
980 Ga0213874_10100895
981 Ga0213876_10012503
982 Ga0213876_10016270
983 Ga0213876_10132648
984 Ga0213876_10150904
985 Ga0213875_10000006
986 Ga0213875_10001049
987 Ga0213875_10002883
988 Ga0213875_10021508
989 Ga0213875_10035343
990 Ga0213875_10178589
991 Ga0207642_10044875
992 Ga0207680_10004668
993 Ga0207685_10013592
994 Ga0207643_10069935
995 Ga0207705_10184026
996 Ga0207705_10403704
997 Ga0207705_10467180
998 Ga0207654_10022542
999 Ga0207654_10030168
1000 Ga0207654_10046425
1001 Ga0207654_10158078
1002 Ga0207707_10001047
1003 Ga0207707_10018363
1004 Ga0207707_10031591
1005 Ga0207707_10169283
1006 Ga0207707_10197043
1007 Ga0207695_10005000
1008 Ga0207695_10006447
1009 Ga0207695_10006718
1010 Ga0207695_10009409
1011 Ga0207695_10014848
1012 Ga0207695_10048028
1013 Ga0207695_10055897
1014 Ga0207695_10069951
1015 Ga0207695_10111782
1016 Ga0207695_10132873
1017 Ga0207671_10009331
1018 Ga0207671_10021312
1019 Ga0207671_10027811
1020 Ga0207671_10115990
1021 Ga0207671_10584694
1022 Ga0207693_10112286
1023 Ga0207663_10007117
1024 Ga0207660_10011922
1025 Ga0207660_10108377
1026 Ga0207660_10193946
1027 Ga0207660_10276528
1028 Ga0207657_10003906
1029 Ga0207657_10043809
1030 Ga0207657_10046709
1031 Ga0207657_10050491
1032 Ga0207657_10082339
1033 Ga0207649_10035332
1034 Ga0207649_10070152
1035 Ga0207649_10089753
1036 Ga0207649_10315723
1037 Ga0207652_10019881
1038 Ga0207652_10020936
1039 Ga0207652_10033109
1040 Ga0207652_10057173
1041 Ga0207652_10067919
1042 Ga0207652_10205405
1043 Ga0207652_10361914
1044 Ga0207652_10686346
1045 Ga0207681_10209431
1046 Ga0207681_10473654
1047 Ga0207694_10001067
1048 Ga0207694_10002799
1049 Ga0207694_10004825
1050 Ga0207694_10097408
1051 Ga0207694_10171605
1052 Ga0207687_10000964
1053 Ga0207687_10006530
1054 Ga0207687_10009132
1055 Ga0207687_10019358
1056 Ga0207687_10029031
1057 Ga0207687_10122848
1058 Ga0207687_10169854
1059 Ga0207687_10238784
1060 Ga0207687_10252271
1061 Ga0207687_10268261
1062 Ga0207687_10415385
1063 Ga0207700_10000943
1064 Ga0207700_10043288
1065 Ga0207700_10236719
1066 Ga0207700_10305242
1067 Ga0207700_10489829
1068 Ga0207664_10004685
1069 Ga0207664_10040983
1070 Ga0207664_10184273
1071 Ga0207644_10043393
1072 Ga0207644_10183215
1073 Ga0207690_10053424
1074 Ga0207690_10330986
1075 Ga0207706_10318078
1076 Ga0207686_10004152
1077 Ga0207686_10014133
1078 Ga0207686_10034017
1079 Ga0207686_10075425
1080 Ga0207686_10261218
1081 Ga0207686_10311698
1082 Ga0207709_10146685
1083 Ga0207709_10150652
1084 Ga0207709_10259239
1085 Ga0207669_10196928
1086 Ga0207704_10097129
1087 Ga0207704_10151142
1088 Ga0207665_10077784
1089 Ga0207711_10001158
1090 Ga0207711_10031660
1091 Ga0207711_10095633
1092 Ga0207711_10255279
1093 Ga0207711_10537110
1094 Ga0207689_10021053
1095 Ga0207689_10055248
1096 Ga0207661_10011740
1097 Ga0207661_10014575
1098 Ga0207661_10037925
1099 Ga0207661_10050300
1100 Ga0207661_10065181
1101 Ga0207661_10249220
1102 Ga0207661_10342394
1103 Ga0207661_10538105
1104 Ga0207679_10078634
1105 Ga0207679_10312172
1106 Ga0207667_10001521
1107 Ga0207667_10012021
1108 Ga0207667_10024359
1109 Ga0207667_10026176
1110 Ga0207667_10029301
1111 Ga0207667_10084121
1112 Ga0207667_10085681
1113 Ga0207667_10456845
1114 Ga0207667_10772070
1115 Ga0207658_10011177
1116 Ga0207677_10083635
1117 Ga0207677_10336594
1118 Ga0207703_10006165
1119 Ga0207703_10311305
1120 Ga0207639_10013984
1121 Ga0207639_10027271
1122 Ga0207639_10148663
1123 Ga0207639_10229075
1124 Ga0207678_10126725
1125 Ga0207678_10670162
1126 Ga0207702_10012636
1127 Ga0207702_10016559
1128 Ga0207702_10030519
1129 Ga0207702_10034261
1130 Ga0207702_10047756
1131 Ga0207702_10060519
1132 Ga0207702_10102411
1133 Ga0207702_10185951
1134 Ga0207702_10359159
1135 Ga0207702_10374270
1136 Ga0207641_10032025
1137 Ga0207641_10096674
1138 Ga0207641_10427467
1139 Ga0207648_10006646
1140 Ga0207648_10031660
1141 Ga0207648_10106099
1142 Ga0207676_10012856
1143 Ga0207676_10407317
1144 Ga0207674_10002017
1145 Ga0207674_10005796
1146 Ga0207674_10007190
1147 Ga0207674_10014561
1148 Ga0207674_10014679
1149 Ga0207674_10325564
1150 Ga0207683_10632683
1151 Ga0207698_10006849
1152 Ga0207698_10067586
1153 Ga0207698_10231458
1154 Ga0268266_10019797
1155 Ga0268266_10095386
1156 Ga0268266_10165912
1157 Ga0268264_10004942
1158 Ga0268264_10143385
1159 Ga0265323_10000500
1160 Ga0265338_10014618
1161 Ga0265338_10117427
1162 Ga0265338_10135503
1163 Ga0265338_10311645
1164 Ga0265760_10078004
1165 Ga0265330_10147666
1166 Ga0265332_10097923
1167 Ga0265320_10003368
1168 Ga0265325_10005920
1169 Ga0265325_10135243
1170 Ga0265340_10003837
1171 Ga0265340_10063930
1172 Ga0265339_10030241
1173 Ga0265331_10013264
1174 Ga0265331_10017666
1175 Ga0265331_10111064
1176 Ga0265316_10000651
1177 Ga0265316_10032903
1178 Ga0265316_10080433
1179 Ga0265316_10086444
1180 Ga0265316_10147446
1181 Ga0265313_10012976
1182 Ga0265314_10000978
1183 Ga0265314_10003057
1184 Ga0265314_10039853
1185 Ga0265314_10098089
1186 Ga0265314_10114972
1187 Ga0373926_0042638
1188 Ga0373934_0015860
1189 Ga0373940_0097573
1190 Ga0373923_0091972
1191 Ga0373953_0117029
1192 Ga0373954_0012114
1193 Ga0373954_0051025
1194 Ga0373956_0033197
1195 Ga0373957_0014628
1196 Ga0373943_0041382
1197 Ga0373943_0270249
1198 Ga0373955_0021498
1199 Ga0373955_0049648
1200 Ga0373955_0151081
1201 Ga0373955_0341361
1202 Ga0373935_0024179
1203 Ga0373935_0080836
1204 Ga0373935_0425698
1205 Ga0373935_0581740
1206 Ga0373927_0001052
1207 Ga0373927_0004677
1208 Ga0373927_0241635
1209 Ga0373947_0353758
1210 Ga0373947_0478396
1211 Ga0373937_0003169
1212 Ga0373937_0013616
1213 Ga0373937_0016750
1214 Ga0373937_0027195
1215 Ga0373937_0410632
1216 Ga0373925_0007535
1217 Ga0373925_0027993
1218 Ga0373925_0179233
1219 Ga0373925_0207423
1220 Ga0373925_0219991
1221 Ga0373925_0364682
1222 Ga0395900_0142059
1223 Ga0395900_0517851
1224 Ga0395898_0372775
1225 Ga0436364_0068208
1226 Ga0436364_0092234
1227 Ga0436364_0151982
1228 Ga0436364_0223933
1229 Ga0436364_0251175
1230 Ga0436364_0258301
1231 Ga0436364_0365832
1232 Ga0436364_0455762
1233 Ga0436364_0470999
1234 Ga0436364_0478514
1235 Ga0436364_0716408
1236 Ga0436364_0908431
1237 Ga0436364_0951596
1238 Ga0436364_1003470
1239 Ga0436364_1286416
1240 Ga0395901_0288722
1241 Ga0436365_0283512
1242 Ga0436365_0448772
1243 Ga0436365_0607409
1244 Ga0436365_0784658
1245 Ga0436365_0801257
1246 Ga0436365_0944327
1247 Ga0436365_1077291
1248 Ga0436365_1198503
1249 Ga0436365_1461893
1250 Ga0436365_1607801
1251 Ga0436360_0523032
1252 Ga0436360_0798526
1253 Ga0436360_0826829
1254 Ga0436361_0815288
1255 Ga0436363_1312202
1256 Ga0436363_1378468
1257 Ga0436363_1620560
1258 Ga0436362_0244189
1259 Ga0436362_0556066
1260 Ga0436362_1019307
1261 Ga0436362_1206832
1262 Ga0451577_0152461
1263 Ga0466966_0043927
1264 Ga0466966_0141057
1265 Ga0466963_0174620
1266 Ga0466959_0267062
1267 Ga0466958_0051927
1268 Ga0495651_0119628
1269 Ga0495651_0141895
1270 Ga0495580_0005503
1271 Ga0495580_0012881
1272 Ga0495580_0044863
1273 Ga0495580_0073149
1274 Ga0495580_0224482
1275 Ga0495580_0312339
1276 Ga0495582_0020610
1277 Ga0495639_0164121
1278 Ga0495664_0097800
1279 Ga0495664_0228654
1280 Ga0495594_0060616
1281 Ga0495608_0079868
1282 Ga0495618_0059782
1283 Ga0495666_0143722
1284 Ga0495652_0066489
1285 Ga0495665_0053700
1286 Ga0495640_0041902
1287 Ga0495587_0005431
1288 Ga0495587_0038527
1289 Ga0495645_0055396
1290 Ga0495645_0260406
1291 Ga0495635_0222864
1292 Ga0495657_0392919
1293 Ga0495599_0085790
1294 Ga0495613_0069246
1295 Ga0495636_0034560
1296 Ga0495674_0005943
1297 Ga0495674_0503878
1298 Ga0495675_0126841
1299 Ga0495675_0174712
1300 Ga0495684_0019177
1301 Ga0495684_0022645
1302 Ga0495684_0100719
1303 Ga0495602_0144847
1304 Ga0495602_0345536
1305 Ga0495614_0091419
1306 Ga0496101_0088892
1307 Ga0496101_0300217
1308 Ga0496102_0253561
1309 Ga0496102_0347565
1310 Ga0496104_0241806
1311 Ga0496105_0341836
1312 Ga0496106_0548632
1313 Ga0496107_0240497
1314 Ga0496108_0215339
1315 Ga0496109_0074655
1316 Ga0496110_0098800
1317 Ga0496110_0545358
1318 Ga0496111_0087956
1319 Ga0496112_0293343
1320 Ga0496113_0085017
1321 Ga0496114_0160041
1322 Ga0496114_0401052
1323 Ga0496115_0051941
1324 Ga0496115_0115532
1325 Ga0501031_0019815
1326 Ga0501032_0001449
1327 Ga0501033_0044977
1328 Ga0501034_0004117
1329 Ga0501034_0253370
1330 Ga0501036_0000348
1331 Ga0501037_0020752
1332 Ga0501037_0053224
1333 Ga0501038_0009219
1334 Ga0501038_0371570
1335 Ga0501039_0070841
1336 Ga0501043_0000174
1337 Ga0501046_0001226
1338 Ga0501046_0411604
1339 Ga0501047_0080965
1340 Ga0501047_0106687
1341 Ga0501047_0107454
1342 Ga0501048_0066144
1343 Ga0501067_0001324
1344 Ga0501068_0000795
1345 Ga0501068_0155844
1346 Ga0501069_0003845
1347 Ga0501070_0006532
1348 Ga0501070_0015059
1349 Ga0501070_0258264
1350 Ga0501072_0000291
1351 Ga0501073_0004818
1352 Ga0501073_0185887
1353 Ga0501074_0012149
1354 Ga0501076_0014769
1355 Ga0501077_0025006
1356 Ga0501249_003944
1357 Ga0501079_0001684
1358 Ga0501079_0174844
1359 Ga0501080_0000011
1360 Ga0501083_0075325
1361 Ga0501035_0011313
1362 Ga0501035_0104621
1363 Ga0501044_0001227
1364 Ga0501044_0007391
1365 Ga0501044_0014511
1366 Ga0501044_0061454
1367 nmdc:mga09592_143918_c1
1368 nmdc:mga0qj67_13989_c1
1369 Ga0495601_0100676
1370 Ga0495601_0335561
1371 Ga0501084_0001549
1372 Ga0501082_0003248

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

3

113

0.99

PF00486

Trans_reg_C

Transcriptional regulatory protein, C terminal

147

222

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ifh-assembly1.cif.gz_A unphosphorylated spo0f from paenisporosarcina sp. tg-14 0.9679 2 117
2zwm-assembly1.cif.gz_B crystal structure of yycf receiver domain from bacillus subtilis 0.9674 2 118
1nxt-assembly1.cif.gz_A-2 micarec ph 4.0 0.9654 1 118
2a9r-assembly1.cif.gz_A-2 rr02-rec phosphate in the active site 0.9642 1 118
8fk2-assembly1.cif.gz_B the n-terminal vicr from streptococcus mutans 0.9635 2 118
ID Description Score Start End Superfamily
af_P14375_1_129_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9722 1 119 3.40.50.2300
3dzdB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9702 1 119 3.40.50.2300
af_P9WGN1_2_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.968 1 79 3.40.50.2300
af_Q2FXN6_3_86_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9674 1 83 3.40.50.2300
af_Q06065_2_134_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9662 2 118 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A1I3Y7T0-F1-model_v4 Diguanylate cyclase (GGDEF) domain-containing protein 0.9826 2 119 GO:0000160
GO:0052621
AF-A0A0G3EDR7-F1-model_v4 Fis family transcriptional regulator 0.9758 2 119 GO:0000160
GO:0005524
GO:0006355
GO:0016887
GO:0043565
AF-A0A251W874-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.9707 3 119 GO:0000155
AF-A0A6G7PXV4-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.9707 2 120 GO:0000155
AF-K1YT49-F1-model_v4 Sigma-54 dependent DNA-binding response regulator 0.9707 2 118 GO:0000160
GO:0003677

Map