F475110

General Info

Members Datasets Scaffolds Average Seq Length
685 371 1370 98

Family's Representative Sequence

Representative Sequence 3300005458|Ga0070681_10592365|Ga0070681_105923652
Length 105
Sequence VSQKGQVMATYEGKRTIDGLVVTADGKRLDEHYEVKRFTKYGFEWTYEGESPQQLALAILYDHLGDKDRAIRMSEPFMRKVVANLDNDWTLRGEDVAAFVAGAGT

Samples

Sample ID Description Type Environment
1 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
8 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
9 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
10 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
11 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
12 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
13 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
14 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
15 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
39 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
40 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
41 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
42 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
43 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
44 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
45 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
46 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
47 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
48 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
49 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
50 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
51 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
77 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
78 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
79 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
80 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
81 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
82 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
83 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
84 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
86 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
87 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
88 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
89 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
90 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
91 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
92 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
93 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
94 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
95 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
97 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
98 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
99 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
100 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
101 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
103 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
105 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
106 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
107 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
108 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
109 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
110 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
111 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
112 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
113 3300012476 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 Metagenome Rhizosphere
114 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
115 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
116 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
117 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
118 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
119 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
120 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
121 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
122 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
123 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
124 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
125 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
126 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
127 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
128 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
129 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
191 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
194 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
195 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
196 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
197 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
198 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
199 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
200 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
201 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
202 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
203 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
204 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
205 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
206 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
207 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
208 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
209 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
210 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
211 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
212 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
213 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
214 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
215 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
216 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
217 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
218 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
219 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
220 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
221 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
222 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
223 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
224 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
225 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
226 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
227 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
228 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
229 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
230 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
231 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
232 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
233 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
234 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
235 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
236 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
237 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
238 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
239 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
240 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
241 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
242 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
243 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
244 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
245 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
246 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
247 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
248 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
249 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
250 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
251 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
252 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
253 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
254 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
255 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
256 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
257 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
258 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
259 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
260 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
261 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
262 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
263 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
264 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
265 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
266 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
267 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
268 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
269 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
270 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
271 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
272 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
273 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
274 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
275 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
276 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
277 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
278 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
279 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
280 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
281 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
282 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
283 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
284 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
285 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
286 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
287 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
288 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
289 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
290 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
291 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
292 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
293 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
294 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
295 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
296 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
297 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
298 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
299 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
300 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
301 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
302 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
303 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
304 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
305 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
306 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
307 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
308 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
309 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
310 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
311 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
312 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
313 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
314 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
315 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
316 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
317 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
318 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
319 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
320 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
321 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
322 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
323 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
324 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
325 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
326 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
327 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
328 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
329 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
330 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
331 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
332 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
333 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
334 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
335 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
336 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
337 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
338 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
339 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
340 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
341 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
342 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
343 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
344 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
345 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
346 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
347 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
348 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
349 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
350 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
351 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
352 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
353 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
354 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
355 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
356 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
357 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
358 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
359 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
360 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
361 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
362 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
363 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
364 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
365 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
366 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
367 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
368 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
369 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
370 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
371 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.85
Metatranscriptomes 0.15
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.75
Nodule 0
Rhizoplane 8.47
Rhizosphere 89.64
Stem 0
Stem Tuber 0
Unclassified 15.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070681_10592365 3300005458 Bacteria 1023
2 2214881028 2209111006 Unclassified 578
3 JGI24737J22298_10083048 3300001990 Bacteria 953
4 JGI24743J22301_10025535 3300001991 Bacteria 1145
5 JGI24750J21931_1001341 3300002070 Bacteria 3090
6 JGI24738J21930_10062502 3300002075 Unclassified 765
7 JGI24749J21850_1034635 3300002076 Bacteria 731
8 JGI24744J21845_10025982 3300002077 Unclassified 1139
9 JGI24034J26672_10015667 3300002239 Unclassified 1162
10 JGI24742J22300_10001929 3300002244 Bacteria 3302
11 JGI24751J29686_10014846 3300002459 Bacteria 1607
12 JGI25153J46596_10000711 3300003215 Bacteria 20338
13 JGI25404J52841_10064658 3300003659 Bacteria 765
14 JGI25405J52794_10004873 3300003911 Bacteria 2405
15 Ga0065707_10543569 3300005295 Bacteria 726
16 Ga0070676_10567433 3300005328 Unclassified 814
17 Ga0070676_10694783 3300005328 Bacteria 742
18 Ga0070676_11339488 3300005328 Unclassified 548
19 Ga0070683_100115805 3300005329 Bacteria 2530
20 Ga0070683_100205026 3300005329 Bacteria 1873
21 Ga0070690_100050605 3300005330 Bacteria 2651
22 Ga0070670_100596065 3300005331 Unclassified 988
23 Ga0070666_10023216 3300005335 Bacteria 4036
24 Ga0070666_10129280 3300005335 Bacteria 1754
25 Ga0070680_100148475 3300005336 Bacteria 1968
26 Ga0070680_102019077 3300005336 Bacteria 500
27 Ga0068868_100173786 3300005338 Bacteria 1784
28 Ga0070660_100884455 3300005339 Bacteria 753
29 Ga0070660_101136214 3300005339 Bacteria 661
30 Ga0070689_100202762 3300005340 Bacteria 1620
31 Ga0070691_10034543 3300005341 Bacteria 2380
32 Ga0070687_100064706 3300005343 Bacteria 1943
33 Ga0070687_100175550 3300005343 Unclassified 1279
34 Ga0070661_100222692 3300005344 Bacteria 1448
35 Ga0070692_10038798 3300005345 Bacteria 2429
36 Ga0070668_100087445 3300005347 Bacteria 2452
37 Ga0070668_100535529 3300005347 Unclassified 1018
38 Ga0070669_100463089 3300005353 Unclassified 1047
39 Ga0070669_100967319 3300005353 Bacteria 729
40 Ga0070675_100221317 3300005354 Bacteria 1648
41 Ga0070671_100177396 3300005355 Bacteria 1803
42 Ga0070671_100778361 3300005355 Bacteria 832
43 Ga0070674_100305946 3300005356 Bacteria 1269
44 Ga0070674_100575308 3300005356 Bacteria 948
45 Ga0070673_100051409 3300005364 Bacteria 3227
46 Ga0070673_100092739 3300005364 Bacteria 2471
47 Ga0070673_101388442 3300005364 Unclassified 661
48 Ga0070688_100019755 3300005365 Bacteria 3906
49 Ga0070659_100274381 3300005366 Bacteria 1401
50 Ga0070667_100760484 3300005367 Unclassified 898
51 Ga0070703_10319443 3300005406 Bacteria 653
52 Ga0070709_10003717 3300005434 Bacteria 8199
53 Ga0070709_11426750 3300005434 Bacteria 561
54 Ga0070714_100027177 3300005435 Bacteria 4735
55 Ga0070714_100351433 3300005435 Unclassified 1385
56 Ga0070713_100004110 3300005436 Bacteria 9698
57 Ga0070713_100434942 3300005436 Bacteria 1230
58 Ga0070713_101218970 3300005436 Unclassified 728
59 Ga0070710_10005634 3300005437 Bacteria 5960
60 Ga0070710_10269330 3300005437 Bacteria 1101
61 Ga0070711_100829849 3300005439 Bacteria 785
62 Ga0070711_100911483 3300005439 Unclassified 750
63 Ga0070705_100460808 3300005440 Bacteria 956
64 Ga0070705_100762615 3300005440 Unclassified 766
65 Ga0070700_100157106 3300005441 Bacteria 1561
66 Ga0070700_100964888 3300005441 Unclassified 698
67 Ga0070694_100133382 3300005444 Bacteria 1797
68 Ga0070694_101490107 3300005444 Bacteria 572
69 Ga0070708_101890748 3300005445 Bacteria 553
70 Ga0070663_100337562 3300005455 Bacteria 1216
71 Ga0070663_100889703 3300005455 Unclassified 768
72 Ga0070678_100189872 3300005456 Bacteria 1688
73 Ga0070678_100323936 3300005456 Bacteria 1317
74 Ga0070662_100037565 3300005457 Bacteria 3434
75 Ga0070681_11996703 3300005458 Bacteria 508
76 Ga0068867_100041718 3300005459 Bacteria 3353
77 Ga0068867_100301491 3300005459 Bacteria 1321
78 Ga0070679_100161661 3300005530 Bacteria 2214
79 Ga0070679_100604774 3300005530 Bacteria 1040
80 Ga0070679_100978525 3300005530 Bacteria 790
81 Ga0070684_100126352 3300005535 Bacteria 2304
82 Ga0070684_100165924 3300005535 Bacteria 2004
83 Ga0070684_100263281 3300005535 Bacteria 1577
84 Ga0068853_100600650 3300005539 Bacteria 1045
85 Ga0068853_101156250 3300005539 Unclassified 747
86 Ga0070672_100151698 3300005543 Bacteria 1917
87 Ga0070686_100287153 3300005544 Bacteria 1215
88 Ga0070686_100448579 3300005544 Bacteria 991
89 Ga0070696_100011790 3300005546 Bacteria 5858
90 Ga0070696_101249308 3300005546 Bacteria 629
91 Ga0070693_100205167 3300005547 Unclassified 1283
92 Ga0070693_101458945 3300005547 Bacteria 533
93 Ga0070665_100210003 3300005548 Bacteria 1947
94 Ga0070704_100003037 3300005549 Bacteria 9551
95 Ga0068855_100157074 3300005563 Bacteria 2583
96 Ga0068855_100546820 3300005563 Unclassified 1254
97 Ga0070664_100018435 3300005564 Bacteria 5734
98 Ga0070664_100289865 3300005564 Bacteria 1477
99 Ga0070664_101270056 3300005564 Bacteria 695
100 Ga0068854_100071551 3300005578 Bacteria 2537
101 Ga0068856_100548702 3300005614 Bacteria 1177
102 Ga0068852_100766955 3300005616 Bacteria 977
103 Ga0068852_100777694 3300005616 Bacteria 970
104 Ga0068859_100077463 3300005617 Bacteria 3365
105 Ga0068859_100498048 3300005617 Unclassified 1313
106 Ga0068864_100005603 3300005618 Bacteria 10294
107 Ga0068864_100194705 3300005618 Bacteria 1859
108 Ga0068866_10048175 3300005718 Bacteria 2153
109 Ga0068861_100329960 3300005719 Unclassified 1331
110 Ga0068861_101625783 3300005719 Bacteria 637
111 Ga0068851_10049054 3300005834 Bacteria 2141
112 Ga0068870_10125530 3300005840 Bacteria 1484
113 Ga0068863_100090051 3300005841 Bacteria 2909
114 Ga0068863_100199880 3300005841 Bacteria 1922
115 Ga0068858_100124350 3300005842 Bacteria 2414
116 Ga0068860_100056993 3300005843 Bacteria 3713
117 Ga0068862_100123793 3300005844 Bacteria 2281
118 Ga0068862_100599485 3300005844 Bacteria 1057
119 Ga0081455_10002167 3300005937 Bacteria 23428
120 Ga0081455_10115039 3300005937 Bacteria 2130
121 Ga0081540_1000008 3300005983 Bacteria 203702
122 Ga0070717_10002524 3300006028 Bacteria 12888
123 Ga0070717_11550002 3300006028 Bacteria 601
124 Ga0070717_12148950 3300006028 Bacteria 502
125 Ga0075365_10444672 3300006038 Bacteria 915
126 Ga0070715_10035898 3300006163 Bacteria 2041
127 Ga0070715_10154817 3300006163 Unclassified 1127
128 Ga0070715_10483732 3300006163 Bacteria 705
129 Ga0070716_100243226 3300006173 Bacteria 1221
130 Ga0070716_100420967 3300006173 Bacteria 966
131 Ga0070712_100036653 3300006175 Bacteria 3339
132 Ga0070712_100112330 3300006175 Bacteria 2035
133 Ga0070712_100270553 3300006175 Bacteria 1365
134 Ga0070712_100796922 3300006175 Bacteria 810
135 Ga0070712_101540531 3300006175 Unclassified 581
136 Ga0075369_10533538 3300006186 Unclassified 559
137 Ga0097621_100239229 3300006237 Bacteria 1587
138 Ga0097621_101486726 3300006237 Unclassified 642
139 Ga0075370_10470580 3300006353 Bacteria 757
140 Ga0075370_10595282 3300006353 Unclassified 670
141 Ga0068871_100159680 3300006358 Bacteria 1927
142 Ga0068871_100575992 3300006358 Unclassified 1022
143 Ga0075428_100002840 3300006844 Bacteria 18885
144 Ga0075428_102131069 3300006844 Unclassified 579
145 Ga0075430_100094409 3300006846 Bacteria 2501
146 Ga0075431_100001610 3300006847 Bacteria 21067
147 Ga0075433_10128386 3300006852 Bacteria 2252
148 Ga0075433_11172471 3300006852 Bacteria 667
149 Ga0075434_100086382 3300006871 Bacteria 3137
150 Ga0075434_100118738 3300006871 Bacteria 2658
151 Ga0075434_100168202 3300006871 Bacteria 2212
152 Ga0075434_100381912 3300006871 Bacteria 1429
153 Ga0075429_100090555 3300006880 Bacteria 2668
154 Ga0068865_100073958 3300006881 Bacteria 2425
155 Ga0075436_101210603 3300006914 Bacteria 570
156 Ga0097620_100077464 3300006931 Bacteria 3365
157 Ga0097620_100498060 3300006931 Unclassified 1313
158 Ga0075435_100004091 3300007076 Bacteria 9987
159 Ga0075435_101175962 3300007076 Bacteria 671
160 Ga0099794_10748027 3300007265 Bacteria 522
161 Ga0105251_10034356 3300009011 Bacteria 2510
162 Ga0105250_10079947 3300009092 Bacteria 1325
163 Ga0105240_11185402 3300009093 Bacteria 809
164 Ga0111539_10003049 3300009094 Bacteria 22198
165 Ga0105247_10184604 3300009101 Bacteria 1393
166 Ga0114129_10001163 3300009147 Bacteria 34882
167 Ga0105243_10932966 3300009148 Unclassified 866
168 Ga0105241_10067576 3300009174 Bacteria 2767
169 Ga0105241_10112609 3300009174 Bacteria 2180
170 Ga0105241_10132301 3300009174 Bacteria 2021
171 Ga0105241_11355790 3300009174 Bacteria 679
172 Ga0105242_10124133 3300009176 Bacteria 2220
173 Ga0105242_10424632 3300009176 Bacteria 1246
174 Ga0105248_10247838 3300009177 Bacteria 2005
175 Ga0105248_11265892 3300009177 Unclassified 834
176 Ga0105248_12998841 3300009177 Unclassified 538
177 Ga0105237_11561853 3300009545 Bacteria 667
178 Ga0105237_12266513 3300009545 Bacteria 553
179 Ga0105238_10311325 3300009551 Bacteria 1559
180 Ga0105238_11170507 3300009551 Bacteria 793
181 Ga0105249_10000905 3300009553 Bacteria 26200
182 Ga0105249_10507336 3300009553 Unclassified 1252
183 Ga0105249_12019285 3300009553 Unclassified 649
184 Ga0105239_10220786 3300010375 Bacteria 2126
185 Ga0105239_13325708 3300010375 Bacteria 523
186 Ga0105246_10187076 3300011119 Bacteria 1599
187 Ga0105246_10412995 3300011119 Bacteria 1124
188 Ga0157344_1003810 3300012476 Unclassified 870
189 Ga0157369_11147123 3300013105 Unclassified 794
190 Ga0157369_12374675 3300013105 Unclassified 537
191 Ga0157374_10173224 3300013296 Bacteria 2106
192 Ga0157374_11002813 3300013296 Unclassified 854
193 Ga0157378_10053607 3300013297 Bacteria 3591
194 Ga0163162_10217253 3300013306 Bacteria 2042
195 Ga0163162_10433602 3300013306 Bacteria 1446
196 Ga0163162_10605755 3300013306 Bacteria 1221
197 Ga0157375_11418558 3300013308 Unclassified 818
198 Ga0163163_10056522 3300014325 Bacteria 3879
199 Ga0163163_11210663 3300014325 Unclassified 818
200 Ga0157380_10363205 3300014326 Unclassified 1359
201 Ga0157380_10644661 3300014326 Bacteria 1055
202 Ga0157380_12533079 3300014326 Bacteria 579
203 Ga0182008_10252942 3300014497 Bacteria 909
204 Ga0157377_10018475 3300014745 Bacteria 3624
205 Ga0157377_10088941 3300014745 Bacteria 1820
206 Ga0157379_10171571 3300014968 Bacteria 1958
207 Ga0157379_10551277 3300014968 Bacteria 1073
208 Ga0157376_10277065 3300014969 Unclassified 1578
209 Ga0157376_10898082 3300014969 Unclassified 904
210 Ga0157376_11512421 3300014969 Bacteria 704
211 Ga0163161_11205958 3300017792 Unclassified 654
212 Ga0197907_11230264 3300020069 Bacteria 577
213 Ga0209758_1000373 3300025297 Bacteria 78698
214 Ga0207426_1139105 3300025302 Bacteria 579
215 Ga0207656_10229552 3300025321 Bacteria 904
216 Ga0207713_1046555 3300025735 Bacteria 1763
217 Ga0207682_10114400 3300025893 Bacteria 1190
218 Ga0207692_10027430 3300025898 Bacteria 2683
219 Ga0207692_10183794 3300025898 Bacteria 1219
220 Ga0207642_10239780 3300025899 Unclassified 1023
221 Ga0207710_10020902 3300025900 Bacteria 2802
222 Ga0207710_10035279 3300025900 Bacteria 2201
223 Ga0207688_10002291 3300025901 Bacteria 10295
224 Ga0207688_10170276 3300025901 Bacteria 1295
225 Ga0207680_10161096 3300025903 Bacteria 1504
226 Ga0207647_10023557 3300025904 Bacteria 4070
227 Ga0207685_10019025 3300025905 Bacteria 2255
228 Ga0207685_10036859 3300025905 Bacteria 1797
229 Ga0207685_10495790 3300025905 Bacteria 642
230 Ga0207699_10001254 3300025906 Bacteria 12078
231 Ga0207699_10525795 3300025906 Bacteria 856
232 Ga0207645_10062167 3300025907 Bacteria 2385
233 Ga0207645_10357608 3300025907 Bacteria 978
234 Ga0207643_10024520 3300025908 Bacteria 3329
235 Ga0207654_10033105 3300025911 Bacteria 2862
236 Ga0207654_10299084 3300025911 Unclassified 1094
237 Ga0207707_11166412 3300025912 Bacteria 625
238 Ga0207671_11472425 3300025914 Bacteria 526
239 Ga0207693_10033262 3300025915 Bacteria 4069
240 Ga0207693_10047415 3300025915 Bacteria 3376
241 Ga0207693_10128967 3300025915 Bacteria 1988
242 Ga0207693_10451968 3300025915 Bacteria 1004
243 Ga0207693_10877279 3300025915 Bacteria 689
244 Ga0207663_10496535 3300025916 Unclassified 947
245 Ga0207663_11596646 3300025916 Unclassified 525
246 Ga0207663_11720471 3300025916 Unclassified 504
247 Ga0207660_10212170 3300025917 Bacteria 1517
248 Ga0207660_11308975 3300025917 Unclassified 588
249 Ga0207662_10003397 3300025918 Bacteria 8187
250 Ga0207662_11192377 3300025918 Bacteria 541
251 Ga0207657_10048757 3300025919 Bacteria 3696
252 Ga0207657_10413513 3300025919 Bacteria 1060
253 Ga0207649_10567042 3300025920 Unclassified 870
254 Ga0207652_10439677 3300025921 Bacteria 1176
255 Ga0207694_10485853 3300025924 Bacteria 1033
256 Ga0207694_11465133 3300025924 Bacteria 576
257 Ga0207650_10230663 3300025925 Bacteria 1493
258 Ga0207659_10254859 3300025926 Bacteria 1425
259 Ga0207687_10873675 3300025927 Bacteria 769
260 Ga0207700_10001346 3300025928 Bacteria 13937
261 Ga0207700_10472414 3300025928 Bacteria 1107
262 Ga0207664_10034782 3300025929 Bacteria 3883
263 Ga0207664_11124598 3300025929 Bacteria 702
264 Ga0207644_10555613 3300025931 Unclassified 950
265 Ga0207690_10538355 3300025932 Unclassified 948
266 Ga0207706_10047303 3300025933 Bacteria 3807
267 Ga0207706_10074129 3300025933 Bacteria 2993
268 Ga0207706_11601959 3300025933 Unclassified 527
269 Ga0207686_10118332 3300025934 Bacteria 1799
270 Ga0207686_10593998 3300025934 Bacteria 870
271 Ga0207709_10359365 3300025935 Unclassified 1102
272 Ga0207709_11059281 3300025935 Bacteria 665
273 Ga0207670_10104197 3300025936 Bacteria 2031
274 Ga0207670_11601493 3300025936 Bacteria 554
275 Ga0207669_10028791 3300025937 Bacteria 3061
276 Ga0207704_10047933 3300025938 Bacteria 2558
277 Ga0207665_10004253 3300025939 Bacteria 9516
278 Ga0207665_10055173 3300025939 Bacteria 2680
279 Ga0207691_10015850 3300025940 Bacteria 7163
280 Ga0207711_10273311 3300025941 Bacteria 1555
281 Ga0207711_10873998 3300025941 Bacteria 836
282 Ga0207689_10113511 3300025942 Bacteria 2227
283 Ga0207661_10555000 3300025944 Bacteria 1052
284 Ga0207679_10265519 3300025945 Bacteria 1466
285 Ga0207667_10050154 3300025949 Bacteria 4405
286 Ga0207667_11605900 3300025949 Bacteria 619
287 Ga0207651_10024143 3300025960 Bacteria 3755
288 Ga0207651_11172561 3300025960 Unclassified 689
289 Ga0207712_10004862 3300025961 Bacteria 8494
290 Ga0207712_10121746 3300025961 Bacteria 1975
291 Ga0207712_10283870 3300025961 Unclassified 1352
292 Ga0207668_10115721 3300025972 Bacteria 2020
293 Ga0207668_10379657 3300025972 Bacteria 1189
294 Ga0207668_10529973 3300025972 Bacteria 1017
295 Ga0207640_10722042 3300025981 Unclassified 856
296 Ga0207658_10278849 3300025986 Bacteria 1432
297 Ga0207658_11219868 3300025986 Bacteria 688
298 Ga0207677_10055397 3300026023 Bacteria 2711
299 Ga0207677_11425546 3300026023 Unclassified 638
300 Ga0207703_10012740 3300026035 Bacteria 6557
301 Ga0207703_10894394 3300026035 Bacteria 850
302 Ga0207639_10364778 3300026041 Bacteria 1293
303 Ga0207639_10367285 3300026041 Bacteria 1289
304 Ga0207678_10038146 3300026067 Bacteria 4176
305 Ga0207708_10030243 3300026075 Bacteria 4107
306 Ga0207708_11071894 3300026075 Unclassified 702
307 Ga0207702_10037988 3300026078 Bacteria 4033
308 Ga0207702_11557536 3300026078 Unclassified 654
309 Ga0207641_10515635 3300026088 Bacteria 1162
310 Ga0207648_10012760 3300026089 Bacteria 7852
311 Ga0207648_10243918 3300026089 Bacteria 1600
312 Ga0207676_10047716 3300026095 Bacteria 3320
313 Ga0207674_10250716 3300026116 Bacteria 1717
314 Ga0207675_100002876 3300026118 Bacteria 16923
315 Ga0207675_100068525 3300026118 Bacteria 3316
316 Ga0207675_101621546 3300026118 Bacteria 667
317 Ga0207683_10023595 3300026121 Bacteria 5291
318 Ga0207683_10658365 3300026121 Unclassified 970
319 Ga0207428_10005326 3300027907 Bacteria 11998
320 Ga0268266_10045805 3300028379 Bacteria 3743
321 Ga0268266_10369073 3300028379 Bacteria 1351
322 Ga0268265_10027056 3300028380 Bacteria 4088
323 Ga0268265_11191083 3300028380 Bacteria 759
324 Ga0265332_10278017 3300031238 Bacteria 692
325 Ga0265340_10296913 3300031247 Bacteria 717
326 Ga0265339_10142168 3300031249 Bacteria 1220
327 Ga0265331_10071212 3300031250 Bacteria 1627
328 Ga0265316_10101358 3300031344 Bacteria 2187
329 Ga0307408_101153673 3300031548 Bacteria 721
330 Ga0307405_11497847 3300031731 Unclassified 593
331 Ga0307410_10239231 3300031852 Bacteria 1406
332 Ga0307406_10662292 3300031901 Unclassified 868
333 Ga0307407_10230380 3300031903 Unclassified 1258
334 Ga0307409_101428041 3300031995 Bacteria 719
335 Ga0307416_101619248 3300032002 Bacteria 753
336 Ga0307411_10756025 3300032005 Bacteria 852
337 Ga0373926_0006770 3300035083 Bacteria 3808
338 Ga0373926_0067171 3300035083 Unclassified 1314
339 Ga0373926_0117565 3300035083 Bacteria 1001
340 Ga0373934_0109789 3300035086 Bacteria 1118
341 Ga0373940_0021083 3300035088 Bacteria 1662
342 Ga0373944_0001887 3300035089 Bacteria 5300
343 Ga0373944_0009056 3300035089 Bacteria 2693
344 Ga0373951_0072830 3300035091 Bacteria 878
345 Ga0373923_0004951 3300035111 Bacteria 4477
346 Ga0373923_0028384 3300035111 Bacteria 2238
347 Ga0373932_0427568 3300035112 Unclassified 516
348 Ga0373936_0003385 3300035113 Bacteria 5976
349 Ga0373936_0102318 3300035113 Bacteria 1209
350 Ga0373945_0001184 3300035116 Bacteria 7928
351 Ga0373945_0004059 3300035116 Bacteria 4633
352 Ga0373945_0055860 3300035116 Bacteria 1463
353 Ga0373953_0092979 3300035117 Bacteria 1263
354 Ga0373954_0017433 3300035118 Bacteria 3226
355 Ga0373954_0176850 3300035118 Bacteria 1046
356 Ga0373957_0023742 3300035120 Bacteria 2196
357 Ga0373943_0007904 3300035170 Bacteria 4773
358 Ga0373943_0018338 3300035170 Bacteria 3213
359 Ga0373943_0089848 3300035170 Bacteria 1589
360 Ga0373943_0308759 3300035170 Bacteria 899
361 Ga0373943_0677614 3300035170 Unclassified 610
362 Ga0373946_0001037 3300035171 Bacteria 9550
363 Ga0373946_0001521 3300035171 Bacteria 8060
364 Ga0373946_0008101 3300035171 Bacteria 3858
365 Ga0373946_0380143 3300035171 Unclassified 710
366 Ga0373955_0023108 3300035172 Bacteria 3163
367 Ga0373962_0140516 3300035242 Bacteria 784
368 Ga0373924_0002712 3300035410 Bacteria 5976
369 Ga0373924_0053467 3300035410 Bacteria 1678
370 Ga0373924_0413962 3300035410 Unclassified 603
371 Ga0373931_0004834 3300035691 Bacteria 6188
372 Ga0373935_0001406 3300035692 Bacteria 13337
373 Ga0373935_0014243 3300035692 Bacteria 4799
374 Ga0373935_0035255 3300035692 Bacteria 3122
375 Ga0373935_0281159 3300035692 Bacteria 1172
376 Ga0373935_0359194 3300035692 Bacteria 1040
377 Ga0373927_0000892 3300035695 Bacteria 22721
378 Ga0373927_0003933 3300035695 Bacteria 10535
379 Ga0373927_0038572 3300035695 Bacteria 3101
380 Ga0373927_0072933 3300035695 Bacteria 2223
381 Ga0373927_0161516 3300035695 Bacteria 1468
382 Ga0373927_0208007 3300035695 Bacteria 1285
383 Ga0373933_0023914 3300035724 Bacteria 3495
384 Ga0373947_0000629 3300035725 Bacteria 20890
385 Ga0373947_0003263 3300035725 Bacteria 9619
386 Ga0373947_0007599 3300035725 Bacteria 6272
387 Ga0373947_0190914 3300035725 Bacteria 1337
388 Ga0373947_0639401 3300035725 Bacteria 725
389 Ga0373947_0904139 3300035725 Unclassified 603
390 Ga0373947_1125483 3300035725 Unclassified 535
391 Ga0373947_1267644 3300035725 Unclassified 502
392 Ga0373937_0084788 3300036401 Bacteria 2931
393 Ga0373925_0003681 3300037068 Bacteria 11791
394 Ga0373925_0017905 3300037068 Bacteria 5142
395 Ga0373925_0075656 3300037068 Bacteria 2552
396 Ga0373925_0079818 3300037068 Bacteria 2486
397 Ga0373925_0165413 3300037068 Bacteria 1744
398 Ga0373925_0422570 3300037068 Unclassified 1089
399 Ga0395898_0324414 3300037466 Bacteria 1469
400 Ga0395898_1979984 3300037466 Unclassified 502
401 Ga0395901_0079286 3300038443 Bacteria 3429
402 Ga0451793_0517916 3300041452 Bacteria 516
403 Ga0439464_0076514 3300042439 Bacteria 995
404 Ga0466960_0428184 3300044901 Unclassified 766
405 Ga0466958_0591265 3300045836 Bacteria 722
406 Ga0495617_037668 3300046452 Bacteria 1619
407 Ga0495592_0052256 3300046454 Bacteria 3034
408 Ga0495603_0036999 3300046455 Bacteria 2929
409 Ga0495603_0056534 3300046455 Bacteria 2322
410 Ga0495591_073226 3300046458 Bacteria 886
411 Ga0495591_099477 3300046458 Bacteria 722
412 Ga0495629_0014941 3300046459 Bacteria 5579
413 Ga0495629_0026104 3300046459 Bacteria 4151
414 Ga0495629_0844630 3300046459 Bacteria 602
415 Ga0495629_0967854 3300046459 Unclassified 555
416 Ga0495641_0041321 3300046461 Bacteria 2143
417 Ga0495651_0016437 3300046462 Bacteria 5731
418 Ga0495653_0005878 3300046463 Bacteria 10041
419 Ga0495653_0129270 3300046463 Bacteria 1790
420 Ga0495580_0053925 3300046472 Bacteria 2837
421 Ga0495580_0059600 3300046472 Bacteria 2682
422 Ga0495580_0352741 3300046472 Unclassified 996
423 Ga0495582_0099607 3300046473 Bacteria 1626
424 Ga0495582_0603397 3300046473 Bacteria 635
425 Ga0495639_0005083 3300046475 Bacteria 5652
426 Ga0495639_0075971 3300046475 Bacteria 1558
427 Ga0495639_0196684 3300046475 Unclassified 986
428 Ga0495662_0018751 3300046476 Bacteria 3349
429 Ga0495662_0087217 3300046476 Bacteria 1520
430 Ga0495662_0343201 3300046476 Bacteria 734
431 Ga0495664_0001034 3300046477 Bacteria 14381
432 Ga0495664_0061834 3300046477 Bacteria 2229
433 Ga0495664_0437337 3300046477 Bacteria 784
434 Ga0495584_0010382 3300046491 Bacteria 4787
435 Ga0495584_0133481 3300046491 Bacteria 1260
436 Ga0495585_0002702 3300046492 Bacteria 12423
437 Ga0495594_0084341 3300046499 Bacteria 1776
438 Ga0495596_0207950 3300046500 Bacteria 760
439 Ga0495607_0043119 3300046501 Bacteria 2670
440 Ga0495583_0331447 3300046506 Bacteria 602
441 Ga0495608_0023329 3300046511 Bacteria 4240
442 Ga0495618_0005416 3300046514 Bacteria 7782
443 Ga0495618_0009681 3300046514 Bacteria 5818
444 Ga0495618_0017145 3300046514 Bacteria 4438
445 Ga0495628_0023643 3300046516 Bacteria 5042
446 Ga0495628_0160286 3300046516 Bacteria 1710
447 Ga0495630_0014775 3300046517 Bacteria 5693
448 Ga0495630_0026988 3300046517 Bacteria 4256
449 Ga0495630_0116373 3300046517 Bacteria 2026
450 Ga0495644_0000510 3300046523 Bacteria 16598
451 Ga0495666_0004543 3300046526 Bacteria 7014
452 Ga0495666_0153262 3300046526 Bacteria 1071
453 Ga0495652_0012180 3300046529 Bacteria 7768
454 Ga0495652_0018127 3300046529 Bacteria 6283
455 Ga0495652_0106455 3300046529 Bacteria 2265
456 Ga0495665_0002324 3300046531 Bacteria 10269
457 Ga0495665_0085230 3300046531 Bacteria 1660
458 Ga0495665_0168889 3300046531 Bacteria 1139
459 Ga0495665_0362674 3300046531 Bacteria 737
460 Ga0495640_0008356 3300046533 Bacteria 8120
461 Ga0495640_0021657 3300046533 Bacteria 4711
462 Ga0495640_0058303 3300046533 Bacteria 2633
463 Ga0495640_0108868 3300046533 Bacteria 1812
464 Ga0495586_0012180 3300046535 Bacteria 4566
465 Ga0495587_0009020 3300046536 Bacteria 6402
466 Ga0495598_0001168 3300046537 Bacteria 5074
467 Ga0495609_0040488 3300046538 Bacteria 2097
468 Ga0495645_0015262 3300046543 Bacteria 5463
469 Ga0495645_0258761 3300046543 Bacteria 1154
470 Ga0495622_0028237 3300046557 Bacteria 2619
471 Ga0495633_0005507 3300046558 Bacteria 7705
472 Ga0495667_0004324 3300046559 Bacteria 9586
473 Ga0495656_0215066 3300046615 Bacteria 959
474 Ga0495634_0007278 3300046642 Bacteria 8338
475 Ga0495634_0018647 3300046642 Bacteria 4936
476 Ga0495634_0069154 3300046642 Bacteria 2330
477 Ga0495634_0182003 3300046642 Bacteria 1315
478 Ga0495634_0208915 3300046642 Bacteria 1209
479 Ga0495611_0004254 3300046648 Bacteria 6229
480 Ga0495625_0258092 3300046660 Bacteria 1129
481 Ga0495635_0007226 3300046663 Bacteria 7758
482 Ga0495635_0092738 3300046663 Bacteria 2065
483 Ga0495635_0162211 3300046663 Bacteria 1521
484 Ga0495635_1077575 3300046663 Unclassified 509
485 Ga0495661_0085906 3300046665 Bacteria 1802
486 Ga0495588_0001938 3300046674 Bacteria 8837
487 Ga0495599_0025038 3300046678 Bacteria 3734
488 Ga0495599_0037081 3300046678 Bacteria 3063
489 Ga0495623_0516505 3300046679 Unclassified 629
490 Ga0495646_0061436 3300046680 Bacteria 2238
491 Ga0495646_0075503 3300046680 Bacteria 1976
492 Ga0495647_0037492 3300046681 Bacteria 1830
493 Ga0495647_0107629 3300046681 Bacteria 1160
494 Ga0495647_0251045 3300046681 Bacteria 787
495 Ga0495647_0413171 3300046681 Unclassified 621
496 Ga0495658_0035402 3300046683 Bacteria 2746
497 Ga0495658_0055302 3300046683 Bacteria 2260
498 Ga0495658_0260796 3300046683 Bacteria 1091
499 Ga0495658_0971465 3300046683 Unclassified 542
500 Ga0495669_0282768 3300046684 Bacteria 798
501 Ga0495613_0024550 3300046689 Bacteria 4491
502 Ga0495613_0043387 3300046689 Bacteria 3327
503 Ga0495613_0162977 3300046689 Bacteria 1585
504 Ga0495613_0688658 3300046689 Bacteria 674
505 Ga0495613_1064924 3300046689 Unclassified 517
506 Ga0495624_0003037 3300046690 Bacteria 12571
507 Ga0495624_0027240 3300046690 Bacteria 3743
508 Ga0495624_0099022 3300046690 Bacteria 1795
509 Ga0495670_0003427 3300046691 Bacteria 7793
510 Ga0495649_0059244 3300046694 Bacteria 2062
511 Ga0495589_0042744 3300046794 Bacteria 2258
512 Ga0495589_0103827 3300046794 Bacteria 1374
513 Ga0495600_0000758 3300046809 Bacteria 17034
514 Ga0495581_0002122 3300047315 Bacteria 11179
515 Ga0495581_0008625 3300047315 Bacteria 5905
516 Ga0495581_0055853 3300047315 Bacteria 2279
517 Ga0495581_0274980 3300047315 Unclassified 985
518 Ga0495604_0006519 3300047317 Bacteria 9249
519 Ga0495636_0322726 3300047318 Bacteria 725
520 Ga0495674_0003621 3300047319 Bacteria 15039
521 Ga0495674_0025009 3300047319 Bacteria 5479
522 Ga0495674_0094472 3300047319 Bacteria 2550
523 Ga0495672_0250442 3300047320 Unclassified 860
524 Ga0495676_0074467 3300047321 Bacteria 2600
525 Ga0495676_0090087 3300047321 Bacteria 2296
526 Ga0495680_0006335 3300047322 Bacteria 11014
527 Ga0495680_0192123 3300047322 Bacteria 1468
528 Ga0495683_0207585 3300047323 Bacteria 880
529 Ga0495675_0063137 3300047444 Bacteria 2344
530 Ga0495677_0139985 3300047445 Unclassified 929
531 Ga0495679_009932 3300047446 Bacteria 3772
532 Ga0495681_0104800 3300047470 Bacteria 1232
533 Ga0495684_0002702 3300047471 Bacteria 14043
534 Ga0495684_0035642 3300047471 Bacteria 3814
535 Ga0495684_0107676 3300047471 Bacteria 2105
536 Ga0495684_0489647 3300047471 Bacteria 847
537 Ga0495593_0010234 3300047673 Bacteria 5423
538 Ga0495593_0029008 3300047673 Bacteria 3037
539 Ga0495593_0133338 3300047673 Bacteria 1260
540 Ga0495602_0122404 3300048088 Bacteria 2091
541 Ga0495614_0063042 3300048089 Bacteria 1593
542 Ga0495626_0170403 3300048091 Bacteria 908
543 Ga0496100_0004121 3300048903 Bacteria 7665
544 Ga0496100_0018910 3300048903 Bacteria 4099
545 Ga0496101_0002301 3300048904 Bacteria 11683
546 Ga0496101_0022121 3300048904 Bacteria 4374
547 Ga0496101_0174536 3300048904 Bacteria 1652
548 Ga0496101_0474792 3300048904 Bacteria 987
549 Ga0496102_0001907 3300048905 Bacteria 17978
550 Ga0496102_0211431 3300048905 Bacteria 1828
551 Ga0496102_0636578 3300048905 Bacteria 989
552 Ga0496103_0005408 3300048906 Bacteria 7645
553 Ga0496103_0031406 3300048906 Bacteria 3235
554 Ga0496103_0090853 3300048906 Bacteria 1926
555 Ga0496104_0003321 3300048907 Bacteria 13883
556 Ga0496104_0113207 3300048907 Unclassified 2602
557 Ga0496104_0259799 3300048907 Bacteria 1649
558 Ga0496104_0605768 3300048907 Unclassified 1005
559 Ga0496105_0005879 3300048908 Bacteria 9354
560 Ga0496105_0011008 3300048908 Bacteria 7130
561 Ga0496105_0143115 3300048908 Bacteria 1967
562 Ga0496106_0001903 3300048909 Bacteria 15629
563 Ga0496106_0050355 3300048909 Bacteria 3139
564 Ga0496106_0168933 3300048909 Bacteria 1732
565 Ga0496107_0000742 3300048910 Bacteria 18683
566 Ga0496107_0048198 3300048910 Bacteria 3068
567 Ga0496107_0067308 3300048910 Bacteria 2598
568 Ga0496108_0005149 3300048911 Bacteria 10570
569 Ga0496108_0012312 3300048911 Bacteria 6957
570 Ga0496108_0170760 3300048911 Bacteria 1881
571 Ga0496108_0223913 3300048911 Bacteria 1634
572 Ga0496109_0002185 3300048912 Bacteria 16231
573 Ga0496109_0013309 3300048912 Bacteria 7128
574 Ga0496109_0045609 3300048912 Bacteria 3978
575 Ga0496109_0075548 3300048912 Bacteria 3098
576 Ga0496109_0087085 3300048912 Bacteria 2884
577 Ga0496110_0001267 3300048913 Bacteria 18072
578 Ga0496110_0001439 3300048913 Bacteria 17212
579 Ga0496110_0148733 3300048913 Bacteria 2119
580 Ga0496110_1290329 3300048913 Bacteria 639
581 Ga0496111_0005865 3300048914 Bacteria 7920
582 Ga0496111_0006191 3300048914 Bacteria 7749
583 Ga0496111_0198510 3300048914 Bacteria 1491
584 Ga0496111_0213186 3300048914 Bacteria 1434
585 Ga0496112_0002066 3300048915 Bacteria 15919
586 Ga0496112_0019496 3300048915 Bacteria 6403
587 Ga0496112_0126841 3300048915 Bacteria 2522
588 Ga0496112_0192675 3300048915 Bacteria 1999
589 Ga0496113_0068732 3300048916 Bacteria 2688
590 Ga0496113_0085245 3300048916 Unclassified 2426
591 Ga0496113_0167417 3300048916 Bacteria 1739
592 Ga0496114_0060481 3300048917 Bacteria 3166
593 Ga0496114_0067365 3300048917 Bacteria 3003
594 Ga0496114_0269161 3300048917 Unclassified 1501
595 Ga0496114_0405911 3300048917 Bacteria 1206
596 Ga0496115_0183612 3300048918 Bacteria 1728
597 Ga0496115_0336407 3300048918 Bacteria 1232
598 Ga0496115_0400705 3300048918 Unclassified 1113
599 Ga0496115_0704442 3300048918 Unclassified 793
600 Ga0496126_0923403 3300048929 Bacteria 660
601 Ga0501031_0050661 3300049568 Bacteria 2705
602 Ga0501031_0055109 3300049568 Bacteria 2591
603 Ga0501032_0022579 3300049569 Bacteria 4360
604 Ga0501033_0125882 3300049570 Bacteria 1858
605 Ga0501034_0000032 3300049571 Bacteria 243763
606 Ga0501034_0053224 3300049571 Bacteria 4077
607 Ga0501034_0167100 3300049571 Bacteria 2168
608 Ga0501036_0004475 3300049572 Bacteria 11297
609 Ga0501036_0026331 3300049572 Bacteria 4908
610 Ga0501036_0833797 3300049572 Bacteria 758
611 Ga0501037_0025692 3300049573 Bacteria 4350
612 Ga0501037_0086237 3300049573 Bacteria 2273
613 Ga0501038_0010512 3300049574 Bacteria 8465
614 Ga0501038_0202241 3300049574 Bacteria 1593
615 Ga0501038_0342947 3300049574 Unclassified 1165
616 Ga0501039_0030967 3300049575 Bacteria 4125
617 Ga0501039_0708378 3300049575 Bacteria 787
618 Ga0501040_0574537 3300049576 Unclassified 814
619 Ga0501043_0022339 3300049579 Bacteria 4963
620 Ga0501043_0068702 3300049579 Bacteria 2782
621 Ga0501046_0281789 3300049580 Bacteria 1217
622 Ga0501047_0000100 3300049581 Bacteria 105717
623 Ga0501047_0040658 3300049581 Bacteria 4496
624 Ga0501048_0000083 3300049582 Bacteria 49621
625 Ga0501068_0368335 3300049584 Bacteria 924
626 Ga0501069_0248815 3300049585 Bacteria 1037
627 Ga0501070_0009312 3300049586 Bacteria 8307
628 Ga0501070_0439238 3300049586 Bacteria 1053
629 Ga0501070_1039113 3300049586 Unclassified 634
630 Ga0501071_0084581 3300049587 Bacteria 2325
631 Ga0501073_0085335 3300049589 Bacteria 2197
632 Ga0501073_0129310 3300049589 Bacteria 1750
633 Ga0501074_0048380 3300049590 Bacteria 3072
634 Ga0501074_0064991 3300049590 Bacteria 2626
635 Ga0501075_0027790 3300049591 Bacteria 4171
636 Ga0501076_0011514 3300049592 Bacteria 6593
637 Ga0501076_0477887 3300049592 Unclassified 1027
638 Ga0501077_0232710 3300049593 Unclassified 1171
639 Ga0501079_0086821 3300049741 Bacteria 2421
640 Ga0501080_0000030 3300049742 Bacteria 87736
641 Ga0501080_0003855 3300049742 Bacteria 13252
642 Ga0501080_0003899 3300049742 Bacteria 13209
643 Ga0501080_1035702 3300049742 Bacteria 711
644 Ga0501083_0022286 3300049744 Bacteria 4395
645 Ga0501083_0272399 3300049744 Bacteria 1101
646 Ga0501035_0211044 3300049822 Bacteria 1661
647 Ga0501044_0000587 3300049823 Bacteria 44137
648 Ga0501044_0017933 3300049823 Bacteria 7591
649 Ga0501044_1408195 3300049823 Bacteria 563
650 nmdc:mga03n38_359880_c1 3300050490 Bacteria 793
651 nmdc:mga07m45_228300_c2 3300050496 Unclassified 670
652 nmdc:mga05p37_928_c1 3300050507 Bacteria 33059
653 nmdc:mga09592_38098_c1 3300050508 Bacteria 4035
654 nmdc:mga0qj67_32315_c1 3300050509 Bacteria 4080
655 nmdc:mga06r32_795_c1 3300050510 Bacteria 27918
656 nmdc:mga08y16_2587_c1 3300050511 Bacteria 18610
657 nmdc:mga0n895_169692_c1 3300050512 Bacteria 2214
658 nmdc:mga0n895_342855_c1 3300050512 Bacteria 1513
659 nmdc:mga0n895_385564_c1 3300050512 Bacteria 1418
660 nmdc:mga0n895_94584_c1 3300050512 Bacteria 2992
661 nmdc:mga0rr50_12010_c1 3300050513 Bacteria 5575
662 nmdc:mga0rr50_139729_c1 3300050513 Bacteria 1947
663 nmdc:mga08x19_188283_c1 3300050514 Bacteria 1411
664 nmdc:mga0a205_388535_c1 3300050515 Bacteria 1260
665 Ga0495601_0000489 3300053077 Bacteria 20787
666 Ga0495601_0000886 3300053077 Bacteria 16328
667 Ga0495601_0024445 3300053077 Bacteria 3720
668 Ga0495612_0003322 3300053078 Bacteria 6669
669 Ga0495612_0004147 3300053078 Bacteria 6003
670 Ga0495612_0094419 3300053078 Bacteria 1269
671 Ga0495595_0005839 3300053084 Bacteria 4986
672 Ga0495595_0397820 3300053084 Bacteria 698
673 Ga0495619_0000918 3300053085 Bacteria 19328
674 Ga0495619_0036833 3300053085 Bacteria 3187
675 Ga0495619_0209324 3300053085 Bacteria 1350
676 Ga0495619_0287657 3300053085 Bacteria 1139
677 Ga0500566_0077295 3300053094 Bacteria 1859
678 Ga0500642_0245807 3300053130 Bacteria 823
679 Ga0500652_085912 3300053131 Bacteria 1312
680 Ga0501084_0177788 3300054114 Unclassified 1796
681 Ga0501084_1270286 3300054114 Unclassified 617
682 Ga0501082_0099629 3300060353 Bacteria 2513
683 Ga0501082_0105261 3300060353 Bacteria 2441
684 Ga0501082_0391088 3300060353 Bacteria 1213
685 Ga0501082_0590491 3300060353 Bacteria 972
686 Ga0070681_10592365
687 2214881028
688 JGI24737J22298_10083048
689 JGI24743J22301_10025535
690 JGI24750J21931_1001341
691 JGI24738J21930_10062502
692 JGI24749J21850_1034635
693 JGI24744J21845_10025982
694 JGI24034J26672_10015667
695 JGI24742J22300_10001929
696 JGI24751J29686_10014846
697 JGI25153J46596_10000711
698 JGI25404J52841_10064658
699 JGI25405J52794_10004873
700 Ga0065707_10543569
701 Ga0070676_10567433
702 Ga0070676_10694783
703 Ga0070676_11339488
704 Ga0070683_100115805
705 Ga0070683_100205026
706 Ga0070690_100050605
707 Ga0070670_100596065
708 Ga0070666_10023216
709 Ga0070666_10129280
710 Ga0070680_100148475
711 Ga0070680_102019077
712 Ga0068868_100173786
713 Ga0070660_100884455
714 Ga0070660_101136214
715 Ga0070689_100202762
716 Ga0070691_10034543
717 Ga0070687_100064706
718 Ga0070687_100175550
719 Ga0070661_100222692
720 Ga0070692_10038798
721 Ga0070668_100087445
722 Ga0070668_100535529
723 Ga0070669_100463089
724 Ga0070669_100967319
725 Ga0070675_100221317
726 Ga0070671_100177396
727 Ga0070671_100778361
728 Ga0070674_100305946
729 Ga0070674_100575308
730 Ga0070673_100051409
731 Ga0070673_100092739
732 Ga0070673_101388442
733 Ga0070688_100019755
734 Ga0070659_100274381
735 Ga0070667_100760484
736 Ga0070703_10319443
737 Ga0070709_10003717
738 Ga0070709_11426750
739 Ga0070714_100027177
740 Ga0070714_100351433
741 Ga0070713_100004110
742 Ga0070713_100434942
743 Ga0070713_101218970
744 Ga0070710_10005634
745 Ga0070710_10269330
746 Ga0070711_100829849
747 Ga0070711_100911483
748 Ga0070705_100460808
749 Ga0070705_100762615
750 Ga0070700_100157106
751 Ga0070700_100964888
752 Ga0070694_100133382
753 Ga0070694_101490107
754 Ga0070708_101890748
755 Ga0070663_100337562
756 Ga0070663_100889703
757 Ga0070678_100189872
758 Ga0070678_100323936
759 Ga0070662_100037565
760 Ga0070681_11996703
761 Ga0068867_100041718
762 Ga0068867_100301491
763 Ga0070679_100161661
764 Ga0070679_100604774
765 Ga0070679_100978525
766 Ga0070684_100126352
767 Ga0070684_100165924
768 Ga0070684_100263281
769 Ga0068853_100600650
770 Ga0068853_101156250
771 Ga0070672_100151698
772 Ga0070686_100287153
773 Ga0070686_100448579
774 Ga0070696_100011790
775 Ga0070696_101249308
776 Ga0070693_100205167
777 Ga0070693_101458945
778 Ga0070665_100210003
779 Ga0070704_100003037
780 Ga0068855_100157074
781 Ga0068855_100546820
782 Ga0070664_100018435
783 Ga0070664_100289865
784 Ga0070664_101270056
785 Ga0068854_100071551
786 Ga0068856_100548702
787 Ga0068852_100766955
788 Ga0068852_100777694
789 Ga0068859_100077463
790 Ga0068859_100498048
791 Ga0068864_100005603
792 Ga0068864_100194705
793 Ga0068866_10048175
794 Ga0068861_100329960
795 Ga0068861_101625783
796 Ga0068851_10049054
797 Ga0068870_10125530
798 Ga0068863_100090051
799 Ga0068863_100199880
800 Ga0068858_100124350
801 Ga0068860_100056993
802 Ga0068862_100123793
803 Ga0068862_100599485
804 Ga0081455_10002167
805 Ga0081455_10115039
806 Ga0081540_1000008
807 Ga0070717_10002524
808 Ga0070717_11550002
809 Ga0070717_12148950
810 Ga0075365_10444672
811 Ga0070715_10035898
812 Ga0070715_10154817
813 Ga0070715_10483732
814 Ga0070716_100243226
815 Ga0070716_100420967
816 Ga0070712_100036653
817 Ga0070712_100112330
818 Ga0070712_100270553
819 Ga0070712_100796922
820 Ga0070712_101540531
821 Ga0075369_10533538
822 Ga0097621_100239229
823 Ga0097621_101486726
824 Ga0075370_10470580
825 Ga0075370_10595282
826 Ga0068871_100159680
827 Ga0068871_100575992
828 Ga0075428_100002840
829 Ga0075428_102131069
830 Ga0075430_100094409
831 Ga0075431_100001610
832 Ga0075433_10128386
833 Ga0075433_11172471
834 Ga0075434_100086382
835 Ga0075434_100118738
836 Ga0075434_100168202
837 Ga0075434_100381912
838 Ga0075429_100090555
839 Ga0068865_100073958
840 Ga0075436_101210603
841 Ga0097620_100077464
842 Ga0097620_100498060
843 Ga0075435_100004091
844 Ga0075435_101175962
845 Ga0099794_10748027
846 Ga0105251_10034356
847 Ga0105250_10079947
848 Ga0105240_11185402
849 Ga0111539_10003049
850 Ga0105247_10184604
851 Ga0114129_10001163
852 Ga0105243_10932966
853 Ga0105241_10067576
854 Ga0105241_10112609
855 Ga0105241_10132301
856 Ga0105241_11355790
857 Ga0105242_10124133
858 Ga0105242_10424632
859 Ga0105248_10247838
860 Ga0105248_11265892
861 Ga0105248_12998841
862 Ga0105237_11561853
863 Ga0105237_12266513
864 Ga0105238_10311325
865 Ga0105238_11170507
866 Ga0105249_10000905
867 Ga0105249_10507336
868 Ga0105249_12019285
869 Ga0105239_10220786
870 Ga0105239_13325708
871 Ga0105246_10187076
872 Ga0105246_10412995
873 Ga0157344_1003810
874 Ga0157369_11147123
875 Ga0157369_12374675
876 Ga0157374_10173224
877 Ga0157374_11002813
878 Ga0157378_10053607
879 Ga0163162_10217253
880 Ga0163162_10433602
881 Ga0163162_10605755
882 Ga0157375_11418558
883 Ga0163163_10056522
884 Ga0163163_11210663
885 Ga0157380_10363205
886 Ga0157380_10644661
887 Ga0157380_12533079
888 Ga0182008_10252942
889 Ga0157377_10018475
890 Ga0157377_10088941
891 Ga0157379_10171571
892 Ga0157379_10551277
893 Ga0157376_10277065
894 Ga0157376_10898082
895 Ga0157376_11512421
896 Ga0163161_11205958
897 Ga0197907_11230264
898 Ga0209758_1000373
899 Ga0207426_1139105
900 Ga0207656_10229552
901 Ga0207713_1046555
902 Ga0207682_10114400
903 Ga0207692_10027430
904 Ga0207692_10183794
905 Ga0207642_10239780
906 Ga0207710_10020902
907 Ga0207710_10035279
908 Ga0207688_10002291
909 Ga0207688_10170276
910 Ga0207680_10161096
911 Ga0207647_10023557
912 Ga0207685_10019025
913 Ga0207685_10036859
914 Ga0207685_10495790
915 Ga0207699_10001254
916 Ga0207699_10525795
917 Ga0207645_10062167
918 Ga0207645_10357608
919 Ga0207643_10024520
920 Ga0207654_10033105
921 Ga0207654_10299084
922 Ga0207707_11166412
923 Ga0207671_11472425
924 Ga0207693_10033262
925 Ga0207693_10047415
926 Ga0207693_10128967
927 Ga0207693_10451968
928 Ga0207693_10877279
929 Ga0207663_10496535
930 Ga0207663_11596646
931 Ga0207663_11720471
932 Ga0207660_10212170
933 Ga0207660_11308975
934 Ga0207662_10003397
935 Ga0207662_11192377
936 Ga0207657_10048757
937 Ga0207657_10413513
938 Ga0207649_10567042
939 Ga0207652_10439677
940 Ga0207694_10485853
941 Ga0207694_11465133
942 Ga0207650_10230663
943 Ga0207659_10254859
944 Ga0207687_10873675
945 Ga0207700_10001346
946 Ga0207700_10472414
947 Ga0207664_10034782
948 Ga0207664_11124598
949 Ga0207644_10555613
950 Ga0207690_10538355
951 Ga0207706_10047303
952 Ga0207706_10074129
953 Ga0207706_11601959
954 Ga0207686_10118332
955 Ga0207686_10593998
956 Ga0207709_10359365
957 Ga0207709_11059281
958 Ga0207670_10104197
959 Ga0207670_11601493
960 Ga0207669_10028791
961 Ga0207704_10047933
962 Ga0207665_10004253
963 Ga0207665_10055173
964 Ga0207691_10015850
965 Ga0207711_10273311
966 Ga0207711_10873998
967 Ga0207689_10113511
968 Ga0207661_10555000
969 Ga0207679_10265519
970 Ga0207667_10050154
971 Ga0207667_11605900
972 Ga0207651_10024143
973 Ga0207651_11172561
974 Ga0207712_10004862
975 Ga0207712_10121746
976 Ga0207712_10283870
977 Ga0207668_10115721
978 Ga0207668_10379657
979 Ga0207668_10529973
980 Ga0207640_10722042
981 Ga0207658_10278849
982 Ga0207658_11219868
983 Ga0207677_10055397
984 Ga0207677_11425546
985 Ga0207703_10012740
986 Ga0207703_10894394
987 Ga0207639_10364778
988 Ga0207639_10367285
989 Ga0207678_10038146
990 Ga0207708_10030243
991 Ga0207708_11071894
992 Ga0207702_10037988
993 Ga0207702_11557536
994 Ga0207641_10515635
995 Ga0207648_10012760
996 Ga0207648_10243918
997 Ga0207676_10047716
998 Ga0207674_10250716
999 Ga0207675_100002876
1000 Ga0207675_100068525
1001 Ga0207675_101621546
1002 Ga0207683_10023595
1003 Ga0207683_10658365
1004 Ga0207428_10005326
1005 Ga0268266_10045805
1006 Ga0268266_10369073
1007 Ga0268265_10027056
1008 Ga0268265_11191083
1009 Ga0265332_10278017
1010 Ga0265340_10296913
1011 Ga0265339_10142168
1012 Ga0265331_10071212
1013 Ga0265316_10101358
1014 Ga0307408_101153673
1015 Ga0307405_11497847
1016 Ga0307410_10239231
1017 Ga0307406_10662292
1018 Ga0307407_10230380
1019 Ga0307409_101428041
1020 Ga0307416_101619248
1021 Ga0307411_10756025
1022 Ga0373926_0006770
1023 Ga0373926_0067171
1024 Ga0373926_0117565
1025 Ga0373934_0109789
1026 Ga0373940_0021083
1027 Ga0373944_0001887
1028 Ga0373944_0009056
1029 Ga0373951_0072830
1030 Ga0373923_0004951
1031 Ga0373923_0028384
1032 Ga0373932_0427568
1033 Ga0373936_0003385
1034 Ga0373936_0102318
1035 Ga0373945_0001184
1036 Ga0373945_0004059
1037 Ga0373945_0055860
1038 Ga0373953_0092979
1039 Ga0373954_0017433
1040 Ga0373954_0176850
1041 Ga0373957_0023742
1042 Ga0373943_0007904
1043 Ga0373943_0018338
1044 Ga0373943_0089848
1045 Ga0373943_0308759
1046 Ga0373943_0677614
1047 Ga0373946_0001037
1048 Ga0373946_0001521
1049 Ga0373946_0008101
1050 Ga0373946_0380143
1051 Ga0373955_0023108
1052 Ga0373962_0140516
1053 Ga0373924_0002712
1054 Ga0373924_0053467
1055 Ga0373924_0413962
1056 Ga0373931_0004834
1057 Ga0373935_0001406
1058 Ga0373935_0014243
1059 Ga0373935_0035255
1060 Ga0373935_0281159
1061 Ga0373935_0359194
1062 Ga0373927_0000892
1063 Ga0373927_0003933
1064 Ga0373927_0038572
1065 Ga0373927_0072933
1066 Ga0373927_0161516
1067 Ga0373927_0208007
1068 Ga0373933_0023914
1069 Ga0373947_0000629
1070 Ga0373947_0003263
1071 Ga0373947_0007599
1072 Ga0373947_0190914
1073 Ga0373947_0639401
1074 Ga0373947_0904139
1075 Ga0373947_1125483
1076 Ga0373947_1267644
1077 Ga0373937_0084788
1078 Ga0373925_0003681
1079 Ga0373925_0017905
1080 Ga0373925_0075656
1081 Ga0373925_0079818
1082 Ga0373925_0165413
1083 Ga0373925_0422570
1084 Ga0395898_0324414
1085 Ga0395898_1979984
1086 Ga0395901_0079286
1087 Ga0451793_0517916
1088 Ga0439464_0076514
1089 Ga0466960_0428184
1090 Ga0466958_0591265
1091 Ga0495617_037668
1092 Ga0495592_0052256
1093 Ga0495603_0036999
1094 Ga0495603_0056534
1095 Ga0495591_073226
1096 Ga0495591_099477
1097 Ga0495629_0014941
1098 Ga0495629_0026104
1099 Ga0495629_0844630
1100 Ga0495629_0967854
1101 Ga0495641_0041321
1102 Ga0495651_0016437
1103 Ga0495653_0005878
1104 Ga0495653_0129270
1105 Ga0495580_0053925
1106 Ga0495580_0059600
1107 Ga0495580_0352741
1108 Ga0495582_0099607
1109 Ga0495582_0603397
1110 Ga0495639_0005083
1111 Ga0495639_0075971
1112 Ga0495639_0196684
1113 Ga0495662_0018751
1114 Ga0495662_0087217
1115 Ga0495662_0343201
1116 Ga0495664_0001034
1117 Ga0495664_0061834
1118 Ga0495664_0437337
1119 Ga0495584_0010382
1120 Ga0495584_0133481
1121 Ga0495585_0002702
1122 Ga0495594_0084341
1123 Ga0495596_0207950
1124 Ga0495607_0043119
1125 Ga0495583_0331447
1126 Ga0495608_0023329
1127 Ga0495618_0005416
1128 Ga0495618_0009681
1129 Ga0495618_0017145
1130 Ga0495628_0023643
1131 Ga0495628_0160286
1132 Ga0495630_0014775
1133 Ga0495630_0026988
1134 Ga0495630_0116373
1135 Ga0495644_0000510
1136 Ga0495666_0004543
1137 Ga0495666_0153262
1138 Ga0495652_0012180
1139 Ga0495652_0018127
1140 Ga0495652_0106455
1141 Ga0495665_0002324
1142 Ga0495665_0085230
1143 Ga0495665_0168889
1144 Ga0495665_0362674
1145 Ga0495640_0008356
1146 Ga0495640_0021657
1147 Ga0495640_0058303
1148 Ga0495640_0108868
1149 Ga0495586_0012180
1150 Ga0495587_0009020
1151 Ga0495598_0001168
1152 Ga0495609_0040488
1153 Ga0495645_0015262
1154 Ga0495645_0258761
1155 Ga0495622_0028237
1156 Ga0495633_0005507
1157 Ga0495667_0004324
1158 Ga0495656_0215066
1159 Ga0495634_0007278
1160 Ga0495634_0018647
1161 Ga0495634_0069154
1162 Ga0495634_0182003
1163 Ga0495634_0208915
1164 Ga0495611_0004254
1165 Ga0495625_0258092
1166 Ga0495635_0007226
1167 Ga0495635_0092738
1168 Ga0495635_0162211
1169 Ga0495635_1077575
1170 Ga0495661_0085906
1171 Ga0495588_0001938
1172 Ga0495599_0025038
1173 Ga0495599_0037081
1174 Ga0495623_0516505
1175 Ga0495646_0061436
1176 Ga0495646_0075503
1177 Ga0495647_0037492
1178 Ga0495647_0107629
1179 Ga0495647_0251045
1180 Ga0495647_0413171
1181 Ga0495658_0035402
1182 Ga0495658_0055302
1183 Ga0495658_0260796
1184 Ga0495658_0971465
1185 Ga0495669_0282768
1186 Ga0495613_0024550
1187 Ga0495613_0043387
1188 Ga0495613_0162977
1189 Ga0495613_0688658
1190 Ga0495613_1064924
1191 Ga0495624_0003037
1192 Ga0495624_0027240
1193 Ga0495624_0099022
1194 Ga0495670_0003427
1195 Ga0495649_0059244
1196 Ga0495589_0042744
1197 Ga0495589_0103827
1198 Ga0495600_0000758
1199 Ga0495581_0002122
1200 Ga0495581_0008625
1201 Ga0495581_0055853
1202 Ga0495581_0274980
1203 Ga0495604_0006519
1204 Ga0495636_0322726
1205 Ga0495674_0003621
1206 Ga0495674_0025009
1207 Ga0495674_0094472
1208 Ga0495672_0250442
1209 Ga0495676_0074467
1210 Ga0495676_0090087
1211 Ga0495680_0006335
1212 Ga0495680_0192123
1213 Ga0495683_0207585
1214 Ga0495675_0063137
1215 Ga0495677_0139985
1216 Ga0495679_009932
1217 Ga0495681_0104800
1218 Ga0495684_0002702
1219 Ga0495684_0035642
1220 Ga0495684_0107676
1221 Ga0495684_0489647
1222 Ga0495593_0010234
1223 Ga0495593_0029008
1224 Ga0495593_0133338
1225 Ga0495602_0122404
1226 Ga0495614_0063042
1227 Ga0495626_0170403
1228 Ga0496100_0004121
1229 Ga0496100_0018910
1230 Ga0496101_0002301
1231 Ga0496101_0022121
1232 Ga0496101_0174536
1233 Ga0496101_0474792
1234 Ga0496102_0001907
1235 Ga0496102_0211431
1236 Ga0496102_0636578
1237 Ga0496103_0005408
1238 Ga0496103_0031406
1239 Ga0496103_0090853
1240 Ga0496104_0003321
1241 Ga0496104_0113207
1242 Ga0496104_0259799
1243 Ga0496104_0605768
1244 Ga0496105_0005879
1245 Ga0496105_0011008
1246 Ga0496105_0143115
1247 Ga0496106_0001903
1248 Ga0496106_0050355
1249 Ga0496106_0168933
1250 Ga0496107_0000742
1251 Ga0496107_0048198
1252 Ga0496107_0067308
1253 Ga0496108_0005149
1254 Ga0496108_0012312
1255 Ga0496108_0170760
1256 Ga0496108_0223913
1257 Ga0496109_0002185
1258 Ga0496109_0013309
1259 Ga0496109_0045609
1260 Ga0496109_0075548
1261 Ga0496109_0087085
1262 Ga0496110_0001267
1263 Ga0496110_0001439
1264 Ga0496110_0148733
1265 Ga0496110_1290329
1266 Ga0496111_0005865
1267 Ga0496111_0006191
1268 Ga0496111_0198510
1269 Ga0496111_0213186
1270 Ga0496112_0002066
1271 Ga0496112_0019496
1272 Ga0496112_0126841
1273 Ga0496112_0192675
1274 Ga0496113_0068732
1275 Ga0496113_0085245
1276 Ga0496113_0167417
1277 Ga0496114_0060481
1278 Ga0496114_0067365
1279 Ga0496114_0269161
1280 Ga0496114_0405911
1281 Ga0496115_0183612
1282 Ga0496115_0336407
1283 Ga0496115_0400705
1284 Ga0496115_0704442
1285 Ga0496126_0923403
1286 Ga0501031_0050661
1287 Ga0501031_0055109
1288 Ga0501032_0022579
1289 Ga0501033_0125882
1290 Ga0501034_0000032
1291 Ga0501034_0053224
1292 Ga0501034_0167100
1293 Ga0501036_0004475
1294 Ga0501036_0026331
1295 Ga0501036_0833797
1296 Ga0501037_0025692
1297 Ga0501037_0086237
1298 Ga0501038_0010512
1299 Ga0501038_0202241
1300 Ga0501038_0342947
1301 Ga0501039_0030967
1302 Ga0501039_0708378
1303 Ga0501040_0574537
1304 Ga0501043_0022339
1305 Ga0501043_0068702
1306 Ga0501046_0281789
1307 Ga0501047_0000100
1308 Ga0501047_0040658
1309 Ga0501048_0000083
1310 Ga0501068_0368335
1311 Ga0501069_0248815
1312 Ga0501070_0009312
1313 Ga0501070_0439238
1314 Ga0501070_1039113
1315 Ga0501071_0084581
1316 Ga0501073_0085335
1317 Ga0501073_0129310
1318 Ga0501074_0048380
1319 Ga0501074_0064991
1320 Ga0501075_0027790
1321 Ga0501076_0011514
1322 Ga0501076_0477887
1323 Ga0501077_0232710
1324 Ga0501079_0086821
1325 Ga0501080_0000030
1326 Ga0501080_0003855
1327 Ga0501080_0003899
1328 Ga0501080_1035702
1329 Ga0501083_0022286
1330 Ga0501083_0272399
1331 Ga0501035_0211044
1332 Ga0501044_0000587
1333 Ga0501044_0017933
1334 Ga0501044_1408195
1335 nmdc:mga03n38_359880_c1
1336 nmdc:mga07m45_228300_c2
1337 nmdc:mga05p37_928_c1
1338 nmdc:mga09592_38098_c1
1339 nmdc:mga0qj67_32315_c1
1340 nmdc:mga06r32_795_c1
1341 nmdc:mga08y16_2587_c1
1342 nmdc:mga0n895_169692_c1
1343 nmdc:mga0n895_342855_c1
1344 nmdc:mga0n895_385564_c1
1345 nmdc:mga0n895_94584_c1
1346 nmdc:mga0rr50_12010_c1
1347 nmdc:mga0rr50_139729_c1
1348 nmdc:mga08x19_188283_c1
1349 nmdc:mga0a205_388535_c1
1350 Ga0495601_0000489
1351 Ga0495601_0000886
1352 Ga0495601_0024445
1353 Ga0495612_0003322
1354 Ga0495612_0004147
1355 Ga0495612_0094419
1356 Ga0495595_0005839
1357 Ga0495595_0397820
1358 Ga0495619_0000918
1359 Ga0495619_0036833
1360 Ga0495619_0209324
1361 Ga0495619_0287657
1362 Ga0500566_0077295
1363 Ga0500642_0245807
1364 Ga0500652_085912
1365 Ga0501084_0177788
1366 Ga0501084_1270286
1367 Ga0501082_0099629
1368 Ga0501082_0105261
1369 Ga0501082_0391088
1370 Ga0501082_0590491

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19663

DUF6166

Family of unknown function (DUF6166)

11

102

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2lo0-assembly1.cif.gz_B solution structure of the get5 carboxyl domain from a. fumigatus 0.7008 37 69
1r6o-assembly2.cif.gz_D atp-dependent clp protease atp-binding subunit clpa/atp-dependent clp protease adaptor protein clps 0.6596 35 64
1mbx-assembly1.cif.gz_C crystal structure analysis of clpsn with transition metal ion bound 0.5965 32 64
7xxs-assembly1.cif.gz_A hapr mutant i141v 0.5631 37 65
6vz0-assembly1.cif.gz_A c-terminal domain of mouse surfactant protein b crystallized at high ph 0.538 37 87
ID Description Score Start End Superfamily
af_Q9VDR4_1380_1622_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7137 35 62 3.40.50.300
1tfeA02 Mainly Alpha;Orthogonal Bundle;GTP Cyclohydrolase I; Chain A, domain 1; 0.7054 36 69 1.10.286.20
1aipC02 Mainly Alpha;Orthogonal Bundle;GTP Cyclohydrolase I; Chain A, domain 1; 0.7042 37 69 1.10.286.20
2lo0B00 Mainly Alpha;Orthogonal Bundle;GTP Cyclohydrolase I; Chain A, domain 1;Get5 dimerization domain 0.7008 37 69 1.10.286.70
af_Q9C8W7_33_125_3.30.70.80 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Peptidase S8 propeptide/proteinase inhibitor I9 0.684 27 54 3.30.70.80
ID Description Score Start End GO Terms
AF-X1RWV0-F1-model_v4 Uncharacterized protein 0.9429 39 89
AF-F7QRK1-F1-model_v4 Uncharacterized protein 0.8475 38 90
AF-A0A2D6X9W4-F1-model_v4 Uncharacterized protein 0.8267 27 89
AF-A0A5C7PP70-F1-model_v4 Uncharacterized protein 0.8206 27 89
AF-F7QRK1-F1-model_v4 Uncharacterized protein 0.82 38 90

Map