F475083

General Info

Members Datasets Scaffolds Average Seq Length
684 335 1368 108

Family's Representative Sequence

Representative Sequence 3300048909|Ga0496106_0159165|Ga0496106_0159165_1029_1397
Length 122
Sequence MRWNLRLTAANKGIWKASELQRSLAEHGLVISAGKMSGLWSGQPVSLKLDDLDVVCVVLGCEIGDLLIPEPEKVTPRRGDQPAGRHRVRSGPGCGPAPTGRPVAAAAVTRRERGREGRAGTS

Samples

Sample ID Description Type Environment
1 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
65 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
88 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
104 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
105 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
106 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
107 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
108 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
161 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
162 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
163 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
164 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
165 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
166 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
167 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
168 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
169 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
170 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
171 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
172 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
173 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
174 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
175 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
176 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
177 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
178 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
179 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
180 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
181 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
182 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
183 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
184 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
185 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
186 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
187 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
188 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
189 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
190 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
191 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
192 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
193 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
194 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
195 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
196 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
197 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
198 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
199 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
200 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
201 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
202 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
203 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
204 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
205 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
206 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
207 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
208 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
209 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
210 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
211 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
212 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
213 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
214 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
215 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
216 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
217 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
218 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
219 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
220 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
221 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
222 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
223 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
224 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
225 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
226 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
227 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
228 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
229 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
230 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
231 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
232 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
233 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
234 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
235 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
236 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
237 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
238 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
239 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
240 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
241 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
242 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
243 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
244 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
245 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
246 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
247 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
248 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
249 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
250 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
251 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
252 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
253 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
254 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
255 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
256 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
257 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
258 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
259 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
260 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
261 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
262 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
263 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
264 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
265 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
266 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
267 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
268 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
269 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
270 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
271 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
272 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
273 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
274 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
275 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
276 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
277 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
278 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
279 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
280 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
281 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
282 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
283 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
284 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
285 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
286 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
287 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
288 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
289 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
290 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
291 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
292 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
293 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
296 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
298 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
299 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
300 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
301 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
302 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
303 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
304 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
305 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
306 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
307 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
308 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
309 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
310 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
311 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
312 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
313 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
314 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
315 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
316 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
317 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
318 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
319 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
320 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
321 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
322 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
323 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
324 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
325 2643221714 Streptomyces sp. Root264 Isolate Unclassified
326 2773857933 Frankia sp. BMG5.30 Isolate Nodule
327 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
328 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
329 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
330 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
331 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
332 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
333 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
334 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified
335 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.66
Metatranscriptomes 0.15
Isolates 2.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.02
Nodule 0.15
Rhizoplane 4.39
Rhizosphere 90.94
Stem 0
Stem Tuber 0
Unclassified 0.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496106_0159165 3300048909 Bacteria 1785
2 JGI24744J21845_10014804 3300002077 Bacteria 1563
3 JGI25404J52841_10085457 3300003659 Bacteria 659
4 JGI25405J52794_10009842 3300003911 Bacteria 1811
5 Ga0070690_100187757 3300005330 Bacteria 1431
6 Ga0070677_10389940 3300005333 Bacteria 731
7 Ga0068869_100834029 3300005334 Bacteria 794
8 Ga0070666_10273021 3300005335 Bacteria 1200
9 Ga0070682_100265497 3300005337 Bacteria 1244
10 Ga0068868_100104945 3300005338 Bacteria 2291
11 Ga0070689_100093271 3300005340 Bacteria 2376
12 Ga0070691_10017827 3300005341 Bacteria 3267
13 Ga0070687_100147178 3300005343 Bacteria 1378
14 Ga0070668_100050891 3300005347 Bacteria 3191
15 Ga0070669_100197512 3300005353 Bacteria 1581
16 Ga0070674_100028617 3300005356 Bacteria 3661
17 Ga0070688_100075312 3300005365 Bacteria 2169
18 Ga0070659_100059156 3300005366 Bacteria 3025
19 Ga0070659_100279280 3300005366 Bacteria 1389
20 Ga0070667_100775655 3300005367 Bacteria 889
21 Ga0070703_10252629 3300005406 Bacteria 716
22 Ga0070709_10007600 3300005434 Bacteria 5950
23 Ga0070709_10020381 3300005434 Bacteria 3846
24 Ga0070709_11017969 3300005434 Bacteria 659
25 Ga0070714_100108808 3300005435 Bacteria 2451
26 Ga0070714_100121994 3300005435 Bacteria 2319
27 Ga0070714_100355417 3300005435 Bacteria 1376
28 Ga0070713_100011406 3300005436 Bacteria 6472
29 Ga0070713_100135661 3300005436 Bacteria 2174
30 Ga0070713_100304115 3300005436 Bacteria 1469
31 Ga0070713_100708111 3300005436 Bacteria 961
32 Ga0070713_101300615 3300005436 Bacteria 704
33 Ga0070710_10020692 3300005437 Bacteria 3417
34 Ga0070710_10053030 3300005437 Bacteria 2283
35 Ga0070710_10088139 3300005437 Bacteria 1825
36 Ga0070710_10949094 3300005437 Bacteria 624
37 Ga0070710_11290348 3300005437 Bacteria 543
38 Ga0070701_10039722 3300005438 Bacteria 2389
39 Ga0070711_100011396 3300005439 Bacteria 5519
40 Ga0070711_100014154 3300005439 Bacteria 5021
41 Ga0070711_100288854 3300005439 Bacteria 1300
42 Ga0070705_100453280 3300005440 Bacteria 963
43 Ga0070700_100054066 3300005441 Bacteria 2508
44 Ga0070700_101280277 3300005441 Bacteria 615
45 Ga0070694_100058871 3300005444 Bacteria 2615
46 Ga0070708_100029060 3300005445 Bacteria 4764
47 Ga0070708_100276340 3300005445 Bacteria 1580
48 Ga0070663_100048775 3300005455 Bacteria 3004
49 Ga0070663_100758064 3300005455 Bacteria 829
50 Ga0070663_102169753 3300005455 Bacteria 501
51 Ga0070662_100360962 3300005457 Bacteria 1192
52 Ga0070681_10327659 3300005458 Bacteria 1441
53 Ga0068867_100033637 3300005459 Bacteria 3714
54 Ga0070706_100290584 3300005467 Bacteria 1525
55 Ga0070707_100001519 3300005468 Bacteria 22610
56 Ga0070707_100110203 3300005468 Bacteria 2669
57 Ga0070698_100013332 3300005471 Bacteria 8701
58 Ga0070698_100090904 3300005471 Bacteria 3035
59 Ga0070698_100102755 3300005471 Bacteria 2828
60 Ga0070698_100109173 3300005471 Bacteria 2734
61 Ga0070698_100142593 3300005471 Bacteria 2346
62 Ga0070699_100011244 3300005518 Bacteria 7731
63 Ga0070699_100437636 3300005518 Bacteria 1185
64 Ga0070699_100784559 3300005518 Bacteria 872
65 Ga0070699_101040185 3300005518 Bacteria 751
66 Ga0070684_100121498 3300005535 Bacteria 2350
67 Ga0070697_100125506 3300005536 Bacteria 2150
68 Ga0070697_100268288 3300005536 Bacteria 1463
69 Ga0068853_100024301 3300005539 Bacteria 5079
70 Ga0068853_101134481 3300005539 Bacteria 754
71 Ga0070672_100089985 3300005543 Bacteria 2474
72 Ga0070696_100026032 3300005546 Bacteria 3980
73 Ga0070693_100064286 3300005547 Bacteria 2141
74 Ga0070665_100196946 3300005548 Bacteria 2016
75 Ga0070665_100566157 3300005548 Bacteria 1149
76 Ga0070704_100029247 3300005549 Bacteria 3676
77 Ga0068855_100158092 3300005563 Bacteria 2574
78 Ga0068855_100271110 3300005563 Bacteria 1887
79 Ga0068857_100275235 3300005577 Bacteria 1548
80 Ga0068857_101639956 3300005577 Bacteria 628
81 Ga0068854_100104584 3300005578 Bacteria 2127
82 Ga0068856_100028554 3300005614 Bacteria 5447
83 Ga0068856_100080231 3300005614 Bacteria 3236
84 Ga0068856_100203788 3300005614 Bacteria 1993
85 Ga0068856_100893243 3300005614 Bacteria 907
86 Ga0070702_100079823 3300005615 Bacteria 1956
87 Ga0070702_100629734 3300005615 Bacteria 808
88 Ga0068859_100086625 3300005617 Bacteria 3180
89 Ga0068859_102607821 3300005617 Bacteria 556
90 Ga0068864_100039307 3300005618 Bacteria 4044
91 Ga0068866_10015423 3300005718 Bacteria 3395
92 Ga0068861_100168249 3300005719 Bacteria 1814
93 Ga0068851_10154154 3300005834 Bacteria 1258
94 Ga0068863_100061937 3300005841 Bacteria 3538
95 Ga0068863_100327501 3300005841 Bacteria 1489
96 Ga0068863_100584571 3300005841 Bacteria 1104
97 Ga0068858_100075454 3300005842 Bacteria 3132
98 Ga0068858_101614569 3300005842 Bacteria 640
99 Ga0068860_100051330 3300005843 Bacteria 3924
100 Ga0068862_100058773 3300005844 Bacteria 3299
101 Ga0081455_10015238 3300005937 Bacteria 7478
102 Ga0081455_10023802 3300005937 Bacteria 5691
103 Ga0081540_1000074 3300005983 Bacteria 107172
104 Ga0070717_10015073 3300006028 Bacteria 5960
105 Ga0070717_10020557 3300006028 Bacteria 5194
106 Ga0070717_10186556 3300006028 Bacteria 1810
107 Ga0070717_10298263 3300006028 Bacteria 1432
108 Ga0070717_11650023 3300006028 Bacteria 580
109 Ga0075365_10833477 3300006038 Bacteria 651
110 Ga0075365_11096964 3300006038 Bacteria 560
111 Ga0070715_10014737 3300006163 Bacteria 2902
112 Ga0070715_10095814 3300006163 Bacteria 1375
113 Ga0070715_11019773 3300006163 Bacteria 517
114 Ga0070716_100002443 3300006173 Bacteria 8562
115 Ga0070716_100070816 3300006173 Bacteria 2048
116 Ga0070716_100487156 3300006173 Bacteria 907
117 Ga0070716_100589805 3300006173 Bacteria 834
118 Ga0070716_100591202 3300006173 Bacteria 833
119 Ga0070712_100040749 3300006175 Bacteria 3185
120 Ga0070712_100050970 3300006175 Bacteria 2882
121 Ga0070712_100079945 3300006175 Bacteria 2365
122 Ga0070712_100180771 3300006175 Bacteria 1643
123 Ga0070712_100183677 3300006175 Bacteria 1631
124 Ga0070712_101325375 3300006175 Bacteria 627
125 Ga0097621_102205233 3300006237 Bacteria 527
126 Ga0075370_10826462 3300006353 Bacteria 565
127 Ga0068871_100081704 3300006358 Bacteria 2678
128 Ga0068871_100165114 3300006358 Bacteria 1895
129 Ga0075428_101117144 3300006844 Bacteria 832
130 Ga0075430_100059816 3300006846 Bacteria 3202
131 Ga0075429_100040186 3300006880 Bacteria 4071
132 Ga0068865_100018849 3300006881 Bacteria 4460
133 Ga0075436_100483903 3300006914 Bacteria 904
134 Ga0097620_100086626 3300006931 Bacteria 3180
135 Ga0097620_102606496 3300006931 Bacteria 556
136 Ga0105250_10129064 3300009092 Bacteria 1043
137 Ga0105245_10009441 3300009098 Bacteria 8508
138 Ga0105245_10054815 3300009098 Bacteria 3580
139 Ga0105245_12320606 3300009098 Bacteria 590
140 Ga0105247_10018291 3300009101 Bacteria 4204
141 Ga0105247_10028946 3300009101 Bacteria 3353
142 Ga0105247_10030278 3300009101 Bacteria 3280
143 Ga0105247_10930883 3300009101 Bacteria 673
144 Ga0105243_10050247 3300009148 Bacteria 3293
145 Ga0105248_10074398 3300009177 Bacteria 3818
146 Ga0105248_10125174 3300009177 Bacteria 2899
147 Ga0105248_11393858 3300009177 Bacteria 793
148 Ga0105237_10158869 3300009545 Bacteria 2258
149 Ga0105237_10701235 3300009545 Bacteria 1019
150 Ga0105238_11096965 3300009551 Bacteria 819
151 Ga0105238_11868688 3300009551 Bacteria 633
152 Ga0105238_12983846 3300009551 Bacteria 508
153 Ga0105249_10131937 3300009553 Bacteria 2386
154 Ga0105239_10186350 3300010375 Bacteria 2322
155 Ga0105239_10431486 3300010375 Bacteria 1494
156 Ga0105239_10666332 3300010375 Bacteria 1189
157 Ga0105239_12180091 3300010375 Bacteria 644
158 Ga0105246_10524556 3300011119 Bacteria 1010
159 Ga0157343_1021796 3300012488 Bacteria 586
160 Ga0157342_1010016 3300012507 Bacteria 963
161 Ga0157370_11654343 3300013104 Bacteria 575
162 Ga0157369_11229014 3300013105 Bacteria 764
163 Ga0157374_10078188 3300013296 Bacteria 3133
164 Ga0157374_10724681 3300013296 Bacteria 1008
165 Ga0157378_10065423 3300013297 Bacteria 3254
166 Ga0157378_12216024 3300013297 Bacteria 601
167 Ga0163162_10140231 3300013306 Bacteria 2530
168 Ga0157372_10364856 3300013307 Bacteria 1683
169 Ga0157372_10432419 3300013307 Bacteria 1534
170 Ga0157375_10076633 3300013308 Bacteria 3371
171 Ga0163163_10045170 3300014325 Bacteria 4324
172 Ga0163163_11979473 3300014325 Bacteria 642
173 Ga0157380_10054757 3300014326 Bacteria 3167
174 Ga0157377_10494821 3300014745 Bacteria 853
175 Ga0157377_10724563 3300014745 Bacteria 725
176 Ga0157379_10009698 3300014968 Bacteria 8385
177 Ga0157379_10111779 3300014968 Bacteria 2454
178 Ga0157379_10115832 3300014968 Bacteria 2410
179 Ga0157379_10648848 3300014968 Bacteria 988
180 Ga0157376_10085515 3300014969 Bacteria 2717
181 Ga0157376_10384413 3300014969 Bacteria 1353
182 Ga0163161_10076571 3300017792 Bacteria 2456
183 Ga0206356_10827333 3300020070 Bacteria 552
184 Ga0213873_10222206 3300021358 Bacteria 591
185 Ga0213872_10108402 3300021361 Bacteria 1234
186 Ga0213875_10106173 3300021388 Unclassified 1311
187 Ga0224572_1073042 3300024225 Bacteria 633
188 Ga0228598_1017514 3300024227 Bacteria 1413
189 Ga0228598_1019865 3300024227 Bacteria 1323
190 Ga0207696_1151770 3300025711 Bacteria 618
191 Ga0207682_10335625 3300025893 Bacteria 711
192 Ga0207692_10030454 3300025898 Bacteria 2574
193 Ga0207692_10054866 3300025898 Bacteria 2037
194 Ga0207692_10295180 3300025898 Bacteria 985
195 Ga0207692_10455250 3300025898 Bacteria 806
196 Ga0207642_10015499 3300025899 Bacteria 2842
197 Ga0207710_10014932 3300025900 Bacteria 3280
198 Ga0207710_10090589 3300025900 Bacteria 1430
199 Ga0207688_10027522 3300025901 Bacteria 3127
200 Ga0207680_11200143 3300025903 Bacteria 541
201 Ga0207647_10113474 3300025904 Bacteria 1602
202 Ga0207685_10009987 3300025905 Bacteria 2781
203 Ga0207685_10070769 3300025905 Bacteria 1413
204 Ga0207685_10278943 3300025905 Bacteria 819
205 Ga0207699_10036207 3300025906 Bacteria 2812
206 Ga0207699_10074536 3300025906 Bacteria 2085
207 Ga0207699_10138218 3300025906 Bacteria 1598
208 Ga0207699_10742218 3300025906 Bacteria 720
209 Ga0207645_10103018 3300025907 Bacteria 1842
210 Ga0207684_10012078 3300025910 Bacteria 7520
211 Ga0207684_10020164 3300025910 Bacteria 5694
212 Ga0207684_10097762 3300025910 Bacteria 2507
213 Ga0207684_10130553 3300025910 Bacteria 2156
214 Ga0207684_10159160 3300025910 Bacteria 1944
215 Ga0207707_10333497 3300025912 Bacteria 1308
216 Ga0207707_10451860 3300025912 Bacteria 1099
217 Ga0207707_11218017 3300025912 Bacteria 608
218 Ga0207671_10439857 3300025914 Bacteria 1038
219 Ga0207671_10573999 3300025914 Bacteria 899
220 Ga0207693_10031701 3300025915 Bacteria 4176
221 Ga0207693_10059849 3300025915 Bacteria 2984
222 Ga0207693_10290982 3300025915 Bacteria 1280
223 Ga0207693_11407591 3300025915 Bacteria 517
224 Ga0207663_10007612 3300025916 Bacteria 5626
225 Ga0207663_10013514 3300025916 Bacteria 4440
226 Ga0207663_10121994 3300025916 Bacteria 1786
227 Ga0207663_10967585 3300025916 Bacteria 682
228 Ga0207649_10045121 3300025920 Bacteria 2701
229 Ga0207646_10002035 3300025922 Bacteria 24292
230 Ga0207646_10073929 3300025922 Bacteria 3045
231 Ga0207646_10561840 3300025922 Bacteria 1025
232 Ga0207681_10057859 3300025923 Bacteria 2652
233 Ga0207687_10048416 3300025927 Bacteria 2951
234 Ga0207700_10003273 3300025928 Bacteria 9370
235 Ga0207700_10008500 3300025928 Bacteria 6365
236 Ga0207700_10562469 3300025928 Bacteria 1013
237 Ga0207664_10040054 3300025929 Bacteria 3640
238 Ga0207664_10089370 3300025929 Bacteria 2522
239 Ga0207664_10255893 3300025929 Bacteria 1530
240 Ga0207664_10328073 3300025929 Bacteria 1351
241 Ga0207664_10347820 3300025929 Bacteria 1312
242 Ga0207690_10199440 3300025932 Bacteria 1519
243 Ga0207690_10278486 3300025932 Bacteria 1302
244 Ga0207706_10134102 3300025933 Bacteria 2178
245 Ga0207709_10057225 3300025935 Bacteria 2417
246 Ga0207670_10067433 3300025936 Bacteria 2462
247 Ga0207669_10027252 3300025937 Bacteria 3124
248 Ga0207704_10030625 3300025938 Bacteria 3019
249 Ga0207665_10013839 3300025939 Bacteria 5306
250 Ga0207665_10034149 3300025939 Bacteria 3375
251 Ga0207665_10311921 3300025939 Bacteria 1178
252 Ga0207665_10817018 3300025939 Bacteria 737
253 Ga0207691_10555603 3300025940 Bacteria 973
254 Ga0207711_10224161 3300025941 Bacteria 1720
255 Ga0207711_11527436 3300025941 Bacteria 611
256 Ga0207689_10976090 3300025942 Bacteria 715
257 Ga0207661_10637550 3300025944 Bacteria 979
258 Ga0207667_10156850 3300025949 Bacteria 2342
259 Ga0207667_10265080 3300025949 Bacteria 1757
260 Ga0207712_10202506 3300025961 Bacteria 1575
261 Ga0207668_10036422 3300025972 Bacteria 3283
262 Ga0207640_10076296 3300025981 Bacteria 2274
263 Ga0207658_10031381 3300025986 Bacteria 3772
264 Ga0207677_10684480 3300026023 Bacteria 908
265 Ga0207677_11290441 3300026023 Bacteria 670
266 Ga0207703_10089057 3300026035 Bacteria 2591
267 Ga0207703_10718717 3300026035 Bacteria 951
268 Ga0207639_10196766 3300026041 Bacteria 1726
269 Ga0207639_10309692 3300026041 Bacteria 1398
270 Ga0207639_12225351 3300026041 Bacteria 509
271 Ga0207678_10105789 3300026067 Bacteria 2401
272 Ga0207678_11759900 3300026067 Bacteria 543
273 Ga0207678_11772830 3300026067 Bacteria 541
274 Ga0207708_10071420 3300026075 Bacteria 2659
275 Ga0207702_10020072 3300026078 Bacteria 5537
276 Ga0207702_10054460 3300026078 Bacteria 3390
277 Ga0207702_10081485 3300026078 Bacteria 2810
278 Ga0207702_11940470 3300026078 Bacteria 580
279 Ga0207641_10211396 3300026088 Bacteria 1794
280 Ga0207641_10565460 3300026088 Bacteria 1110
281 Ga0207648_10103359 3300026089 Bacteria 2498
282 Ga0207676_10107608 3300026095 Bacteria 2326
283 Ga0207674_12056755 3300026116 Bacteria 536
284 Ga0207683_10063408 3300026121 Bacteria 3255
285 Ga0268266_10173543 3300028379 Bacteria 1958
286 Ga0268266_10230913 3300028379 Bacteria 1704
287 Ga0268265_10117517 3300028380 Bacteria 2184
288 Ga0268264_10876061 3300028381 Bacteria 900
289 Ga0268264_11123413 3300028381 Bacteria 795
290 Ga0265337_1021073 3300028556 Bacteria 2036
291 Ga0307517_10120551 3300028786 Bacteria 1941
292 Ga0307511_10260818 3300030521 Bacteria 822
293 Ga0265340_10001866 3300031247 Bacteria 12001
294 Ga0307513_10350567 3300031456 Bacteria 1224
295 Ga0307509_10290817 3300031507 Bacteria 1388
296 Ga0307408_100259375 3300031548 Bacteria 1438
297 Ga0307508_10218222 3300031616 Bacteria 1507
298 Ga0307508_10390223 3300031616 Bacteria 983
299 Ga0307508_10893741 3300031616 Bacteria 514
300 Ga0307406_11718775 3300031901 Bacteria 556
301 Ga0307507_10087541 3300033179 Bacteria 2693
302 Ga0307507_10219018 3300033179 Bacteria 1283
303 Ga0373926_0013107 3300035083 Bacteria 2808
304 Ga0373934_0041083 3300035086 Bacteria 1825
305 Ga0373934_0457639 3300035086 Bacteria 535
306 Ga0373944_0006712 3300035089 Bacteria 3060
307 Ga0373923_0000160 3300035111 Bacteria 13162
308 Ga0373923_0052797 3300035111 Bacteria 1708
309 Ga0373936_0020584 3300035113 Bacteria 2563
310 Ga0373945_0010780 3300035116 Bacteria 3012
311 Ga0373945_0079923 3300035116 Bacteria 1251
312 Ga0373945_0153969 3300035116 Bacteria 933
313 Ga0373953_0043555 3300035117 Bacteria 1792
314 Ga0373953_0167111 3300035117 Bacteria 946
315 Ga0373954_0041531 3300035118 Bacteria 2145
316 Ga0373954_0076870 3300035118 Bacteria 1592
317 Ga0373956_0068377 3300035119 Bacteria 1618
318 Ga0373957_0037596 3300035120 Bacteria 1809
319 Ga0373957_0080540 3300035120 Bacteria 1285
320 Ga0373957_0470033 3300035120 Bacteria 545
321 Ga0373943_0020570 3300035170 Bacteria 3043
322 Ga0373943_0203465 3300035170 Bacteria 1097
323 Ga0373946_0015367 3300035171 Bacteria 2901
324 Ga0373946_0050581 3300035171 Bacteria 1736
325 Ga0373955_0088259 3300035172 Bacteria 1763
326 Ga0373955_0200352 3300035172 Bacteria 1188
327 Ga0373955_0637132 3300035172 Bacteria 653
328 Ga0373924_0001818 3300035410 Bacteria 7051
329 Ga0373924_0137201 3300035410 Bacteria 1066
330 Ga0373931_0815186 3300035691 Bacteria 623
331 Ga0373935_0039209 3300035692 Bacteria 2969
332 Ga0373935_0119021 3300035692 Bacteria 1762
333 Ga0373935_0363941 3300035692 Bacteria 1033
334 Ga0373927_0020960 3300035695 Bacteria 4284
335 Ga0373927_0118836 3300035695 Bacteria 1725
336 Ga0373927_0209376 3300035695 Bacteria 1281
337 Ga0373927_0603772 3300035695 Bacteria 725
338 Ga0373933_0001586 3300035724 Bacteria 13310
339 Ga0373933_0078904 3300035724 Bacteria 2015
340 Ga0373933_0080086 3300035724 Bacteria 2001
341 Ga0373933_0086940 3300035724 Bacteria 1924
342 Ga0373933_0193629 3300035724 Bacteria 1299
343 Ga0373933_0427629 3300035724 Bacteria 865
344 Ga0373947_0013331 3300035725 Bacteria 4709
345 Ga0373947_0350554 3300035725 Bacteria 990
346 Ga0373947_1205507 3300035725 Bacteria 515
347 Ga0373937_0045584 3300036401 Bacteria 4007
348 Ga0373937_0056568 3300036401 Bacteria 3602
349 Ga0373937_0152795 3300036401 Bacteria 2162
350 Ga0373937_0160663 3300036401 Bacteria 2106
351 Ga0373937_1962030 3300036401 Bacteria 531
352 Ga0373925_0042503 3300037068 Bacteria 3371
353 Ga0373925_0086657 3300037068 Bacteria 2389
354 Ga0373925_0179449 3300037068 Bacteria 1675
355 Ga0373925_0287431 3300037068 Bacteria 1325
356 Ga0373925_0666877 3300037068 Bacteria 857
357 Ga0436364_0172442 3300037853 Unclassified 2410
358 Ga0436364_1389394 3300037853 Bacteria 576
359 Ga0436361_1195163 3300039447 Bacteria 4286
360 Ga0436362_0957546 3300039453 Bacteria 3724
361 Ga0451797_1415164 3300041453 Bacteria 1137
362 Ga0451849_0956835 3300041505 Bacteria 1102
363 Ga0451851_0891529 3300041507 Bacteria 1128
364 Ga0451843_1736962 3300041509 Bacteria 667
365 Ga0451853_2249425 3300041512 Bacteria 681
366 Ga0451853_2361238 3300041512 Bacteria 7361
367 Ga0451853_3731733 3300041512 Bacteria 645
368 Ga0439442_000644 3300042002 Bacteria 7428
369 Ga0439448_0018039 3300042005 Bacteria 2158
370 Ga0439432_009455 3300042006 Bacteria 3398
371 Ga0439449_0060420 3300042007 Bacteria 1399
372 Ga0450899_003576 3300042135 Bacteria 1671
373 Ga0439459_0007367 3300042438 Bacteria 1857
374 Ga0439464_0023056 3300042439 Bacteria 1717
375 Ga0439460_0010799 3300042461 Bacteria 2345
376 Ga0466969_0132280 3300044656 Bacteria 1156
377 Ga0466965_0008522 3300044683 Bacteria 4742
378 Ga0466966_0012287 3300044684 Bacteria 5674
379 Ga0466961_0026711 3300044693 Bacteria 3712
380 Ga0466963_0033383 3300044694 Bacteria 3340
381 Ga0466964_0027324 3300044706 Bacteria 2240
382 Ga0466971_0007549 3300044719 Bacteria 4740
383 Ga0466968_0116834 3300044735 Bacteria 1204
384 Ga0466970_0003355 3300044765 Bacteria 7789
385 Ga0466957_0016014 3300044842 Bacteria 4381
386 Ga0466960_1039455 3300044901 Bacteria 504
387 Ga0466959_0010704 3300045049 Bacteria 6568
388 Ga0466958_0007333 3300045836 Bacteria 6058
389 Ga0466967_0008073 3300045976 Bacteria 7677
390 Ga0466967_2601303 3300045976 Bacteria 501
391 Ga0495592_0034189 3300046454 Bacteria 3833
392 Ga0495592_0040041 3300046454 Bacteria 3517
393 Ga0495592_0054360 3300046454 Bacteria 2967
394 Ga0495592_0099574 3300046454 Bacteria 2073
395 Ga0495592_0298168 3300046454 Bacteria 1049
396 Ga0495592_0380988 3300046454 Bacteria 897
397 Ga0495603_0020166 3300046455 Bacteria 4040
398 Ga0495603_0070016 3300046455 Bacteria 2062
399 Ga0495590_0380981 3300046457 Bacteria 539
400 Ga0495629_0001629 3300046459 Bacteria 17643
401 Ga0495629_0027461 3300046459 Bacteria 4040
402 Ga0495629_0085635 3300046459 Bacteria 2199
403 Ga0495629_0258946 3300046459 Bacteria 1196
404 Ga0495641_0026417 3300046461 Bacteria 2832
405 Ga0495641_0030840 3300046461 Bacteria 2566
406 Ga0495641_0082472 3300046461 Bacteria 1440
407 Ga0495651_0023437 3300046462 Bacteria 4798
408 Ga0495651_0033881 3300046462 Bacteria 3982
409 Ga0495651_0287401 3300046462 Bacteria 1108
410 Ga0495651_0495375 3300046462 Bacteria 783
411 Ga0495651_0576473 3300046462 Bacteria 712
412 Ga0495651_0885091 3300046462 Bacteria 547
413 Ga0495651_0993877 3300046462 Bacteria 509
414 Ga0495653_0003059 3300046463 Bacteria 13419
415 Ga0495653_0049058 3300046463 Bacteria 3255
416 Ga0495653_0132972 3300046463 Bacteria 1758
417 Ga0495653_0158121 3300046463 Bacteria 1576
418 Ga0495653_0199789 3300046463 Bacteria 1358
419 Ga0495653_0232126 3300046463 Bacteria 1234
420 Ga0495653_0319687 3300046463 Bacteria 1006
421 Ga0495653_0946253 3300046463 Bacteria 511
422 Ga0495580_0003255 3300046472 Bacteria 13886
423 Ga0495582_0001453 3300046473 Bacteria 13388
424 Ga0495582_0108973 3300046473 Bacteria 1555
425 Ga0495639_0000771 3300046475 Bacteria 14549
426 Ga0495639_0365746 3300046475 Bacteria 725
427 Ga0495662_0008688 3300046476 Bacteria 4992
428 Ga0495662_0017852 3300046476 Bacteria 3434
429 Ga0495662_0028411 3300046476 Bacteria 2699
430 Ga0495662_0069802 3300046476 Bacteria 1702
431 Ga0495662_0277509 3300046476 Bacteria 825
432 Ga0495664_0001167 3300046477 Bacteria 13677
433 Ga0495664_0003016 3300046477 Bacteria 9115
434 Ga0495664_0022676 3300046477 Bacteria 3641
435 Ga0495664_0103991 3300046477 Bacteria 1712
436 Ga0495664_0152323 3300046477 Bacteria 1402
437 Ga0495664_0337728 3300046477 Bacteria 908
438 Ga0495664_0345504 3300046477 Bacteria 896
439 Ga0495585_0152321 3300046492 Bacteria 1205
440 Ga0495594_0192221 3300046499 Bacteria 1163
441 Ga0495594_0212053 3300046499 Bacteria 1104
442 Ga0495583_0115196 3300046506 Bacteria 1136
443 Ga0495608_0002277 3300046511 Bacteria 13845
444 Ga0495608_0067651 3300046511 Bacteria 2337
445 Ga0495608_0094422 3300046511 Bacteria 1932
446 Ga0495608_0103548 3300046511 Bacteria 1834
447 Ga0495618_0025255 3300046514 Bacteria 3686
448 Ga0495618_0027389 3300046514 Bacteria 3547
449 Ga0495618_0055502 3300046514 Bacteria 2508
450 Ga0495618_0585061 3300046514 Bacteria 665
451 Ga0495620_0113051 3300046515 Bacteria 1075
452 Ga0495628_0003209 3300046516 Bacteria 14660
453 Ga0495628_0026851 3300046516 Bacteria 4687
454 Ga0495628_0060100 3300046516 Bacteria 2983
455 Ga0495628_0303001 3300046516 Bacteria 1182
456 Ga0495628_0383989 3300046516 Bacteria 1028
457 Ga0495628_0395218 3300046516 Bacteria 1011
458 Ga0495628_0460104 3300046516 Bacteria 923
459 Ga0495628_0510046 3300046516 Bacteria 867
460 Ga0495630_0002884 3300046517 Bacteria 11948
461 Ga0495630_0191224 3300046517 Bacteria 1561
462 Ga0495630_0465946 3300046517 Bacteria 968
463 Ga0495630_1200771 3300046517 Bacteria 573
464 Ga0495666_0000769 3300046526 Bacteria 14805
465 Ga0495666_0193365 3300046526 Bacteria 937
466 Ga0495652_0039327 3300046529 Bacteria 4090
467 Ga0495652_0049887 3300046529 Bacteria 3581
468 Ga0495652_0053530 3300046529 Bacteria 3439
469 Ga0495652_0358655 3300046529 Bacteria 1042
470 Ga0495665_0000819 3300046531 Bacteria 16316
471 Ga0495665_0057680 3300046531 Bacteria 2050
472 Ga0495665_0199817 3300046531 Bacteria 1036
473 Ga0495640_0001445 3300046533 Bacteria 18717
474 Ga0495640_0100148 3300046533 Bacteria 1903
475 Ga0495640_0103253 3300046533 Bacteria 1869
476 Ga0495640_0497085 3300046533 Bacteria 742
477 Ga0495640_0656461 3300046533 Bacteria 631
478 Ga0495586_0008837 3300046535 Bacteria 5366
479 Ga0495586_0144148 3300046535 Bacteria 1338
480 Ga0495587_0027787 3300046536 Bacteria 3444
481 Ga0495587_0056353 3300046536 Bacteria 2312
482 Ga0495587_0064870 3300046536 Bacteria 2133
483 Ga0495587_0161238 3300046536 Bacteria 1276
484 Ga0495645_0197645 3300046543 Bacteria 1366
485 Ga0495645_0431552 3300046543 Bacteria 834
486 Ga0495645_0567769 3300046543 Bacteria 701
487 Ga0495645_0642114 3300046543 Bacteria 649
488 Ga0495667_0001695 3300046559 Bacteria 14631
489 Ga0495667_0104798 3300046559 Bacteria 1828
490 Ga0495667_0177556 3300046559 Bacteria 1367
491 Ga0495667_0187393 3300046559 Bacteria 1326
492 Ga0495668_0019967 3300046616 Bacteria 3854
493 Ga0495634_0004435 3300046642 Bacteria 11022
494 Ga0495634_0117513 3300046642 Bacteria 1705
495 Ga0495634_0181789 3300046642 Bacteria 1316
496 Ga0495611_0000372 3300046648 Bacteria 28848
497 Ga0495625_0058569 3300046660 Bacteria 2737
498 Ga0495635_0002057 3300046663 Bacteria 13625
499 Ga0495635_0015327 3300046663 Bacteria 5361
500 Ga0495635_0019883 3300046663 Bacteria 4679
501 Ga0495635_0025480 3300046663 Bacteria 4120
502 Ga0495635_0066027 3300046663 Bacteria 2482
503 Ga0495635_0315801 3300046663 Bacteria 1046
504 Ga0495657_0002078 3300046675 Bacteria 17006
505 Ga0495657_0064253 3300046675 Bacteria 2418
506 Ga0495657_0137423 3300046675 Bacteria 1526
507 Ga0495657_0186110 3300046675 Bacteria 1271
508 Ga0495657_0187619 3300046675 Bacteria 1265
509 Ga0495657_0677342 3300046675 Bacteria 594
510 Ga0495657_0813151 3300046675 Bacteria 534
511 Ga0495657_0835060 3300046675 Bacteria 525
512 Ga0495599_0000692 3300046678 Bacteria 19080
513 Ga0495599_0016134 3300046678 Bacteria 4636
514 Ga0495599_0349784 3300046678 Bacteria 886
515 Ga0495623_0158343 3300046679 Bacteria 1333
516 Ga0495646_0002698 3300046680 Bacteria 10978
517 Ga0495646_0011628 3300046680 Bacteria 5593
518 Ga0495646_0022052 3300046680 Bacteria 4020
519 Ga0495646_0038317 3300046680 Bacteria 2960
520 Ga0495646_0067721 3300046680 Bacteria 2110
521 Ga0495646_0119136 3300046680 Bacteria 1495
522 Ga0495646_0514529 3300046680 Bacteria 614
523 Ga0495647_0003522 3300046681 Bacteria 5012
524 Ga0495647_0005795 3300046681 Bacteria 4064
525 Ga0495647_0139894 3300046681 Bacteria 1031
526 Ga0495658_0065633 3300046683 Bacteria 2094
527 Ga0495613_0016459 3300046689 Bacteria 5507
528 Ga0495613_0031898 3300046689 Bacteria 3913
529 Ga0495613_0094291 3300046689 Bacteria 2166
530 Ga0495613_0211346 3300046689 Bacteria 1364
531 Ga0495613_0255180 3300046689 Bacteria 1223
532 Ga0495613_0690177 3300046689 Bacteria 673
533 Ga0495624_0002357 3300046690 Bacteria 14343
534 Ga0495624_0438090 3300046690 Bacteria 783
535 Ga0495624_0682299 3300046690 Bacteria 610
536 Ga0495624_0876362 3300046690 Bacteria 529
537 Ga0495624_0957573 3300046690 Bacteria 503
538 Ga0495649_0101272 3300046694 Bacteria 1531
539 Ga0495600_0001205 3300046809 Bacteria 14166
540 Ga0495600_0005714 3300046809 Bacteria 7515
541 Ga0495600_0207026 3300046809 Bacteria 1258
542 Ga0495600_0390423 3300046809 Bacteria 867
543 Ga0495660_0364645 3300046810 Bacteria 640
544 Ga0495581_0001419 3300047315 Bacteria 13284
545 Ga0495581_0102240 3300047315 Bacteria 1665
546 Ga0495581_0135625 3300047315 Bacteria 1435
547 Ga0495581_0203809 3300047315 Bacteria 1157
548 Ga0495604_0032065 3300047317 Bacteria 4165
549 Ga0495604_0079992 3300047317 Bacteria 2450
550 Ga0495604_0157402 3300047317 Bacteria 1608
551 Ga0495604_0339036 3300047317 Bacteria 1001
552 Ga0495604_0511115 3300047317 Bacteria 778
553 Ga0495604_0901817 3300047317 Bacteria 552
554 Ga0495674_0000296 3300047319 Bacteria 43131
555 Ga0495674_0004512 3300047319 Bacteria 13390
556 Ga0495674_0019338 3300047319 Bacteria 6320
557 Ga0495674_0073869 3300047319 Bacteria 2938
558 Ga0495674_0343281 3300047319 Bacteria 1213
559 Ga0495676_0004076 3300047321 Bacteria 13316
560 Ga0495676_0052277 3300047321 Bacteria 3262
561 Ga0495676_0218357 3300047321 Bacteria 1315
562 Ga0495676_0318943 3300047321 Bacteria 1044
563 Ga0495676_0331693 3300047321 Bacteria 1020
564 Ga0495676_0482447 3300047321 Bacteria 815
565 Ga0495680_0004163 3300047322 Bacteria 13901
566 Ga0495680_0026303 3300047322 Bacteria 4800
567 Ga0495680_0032573 3300047322 Bacteria 4228
568 Ga0495680_0065345 3300047322 Bacteria 2786
569 Ga0495680_0074270 3300047322 Bacteria 2582
570 Ga0495680_0125147 3300047322 Bacteria 1894
571 Ga0495683_0029069 3300047323 Bacteria 2825
572 Ga0495687_031587 3300047443 Bacteria 2427
573 Ga0495675_0043477 3300047444 Bacteria 2862
574 Ga0495675_0203250 3300047444 Bacteria 1205
575 Ga0495685_106246 3300047447 Bacteria 926
576 Ga0495684_0025608 3300047471 Bacteria 4532
577 Ga0495684_0047862 3300047471 Bacteria 3269
578 Ga0495684_0094263 3300047471 Bacteria 2267
579 Ga0495684_0142133 3300047471 Bacteria 1799
580 Ga0495684_0213795 3300047471 Bacteria 1416
581 Ga0495684_0819687 3300047471 Bacteria 606
582 Ga0495593_0023093 3300047673 Bacteria 3460
583 Ga0495593_0039455 3300047673 Bacteria 2546
584 Ga0495593_0085088 3300047673 Bacteria 1632
585 Ga0495593_0400422 3300047673 Bacteria 686
586 Ga0495593_0530066 3300047673 Bacteria 590
587 Ga0495602_0054157 3300048088 Bacteria 3545
588 Ga0495602_0098120 3300048088 Bacteria 2412
589 Ga0495602_0350355 3300048088 Bacteria 1066
590 Ga0495602_0939836 3300048088 Bacteria 573
591 Ga0495614_0009084 3300048089 Bacteria 4404
592 Ga0495614_0213476 3300048089 Bacteria 875
593 Ga0496100_0035704 3300048903 Bacteria 3129
594 Ga0496101_0159614 3300048904 Bacteria 1729
595 Ga0496102_0059648 3300048905 Bacteria 3489
596 Ga0496102_0148366 3300048905 Bacteria 2202
597 Ga0496102_1114237 3300048905 Bacteria 709
598 Ga0496103_0059447 3300048906 Bacteria 2374
599 Ga0496104_0051810 3300048907 Bacteria 3875
600 Ga0496104_0368518 3300048907 Bacteria 1349
601 Ga0496104_1135246 3300048907 Bacteria 685
602 Ga0496105_0046180 3300048908 Bacteria 3595
603 Ga0496106_0019591 3300048909 Bacteria 5019
604 Ga0496106_0045262 3300048909 Bacteria 3305
605 Ga0496106_0089102 3300048909 Bacteria 2379
606 Ga0496107_0043887 3300048910 Bacteria 3213
607 Ga0496108_0058968 3300048911 Bacteria 3227
608 Ga0496108_0212671 3300048911 Bacteria 1679
609 Ga0496108_1635865 3300048911 Bacteria 532
610 Ga0496109_0007679 3300048912 Bacteria 9142
611 Ga0496110_0032676 3300048913 Bacteria 4497
612 Ga0496110_0880533 3300048913 Bacteria 801
613 Ga0496112_0003194 3300048915 Bacteria 13482
614 Ga0496112_0048576 3300048915 Bacteria 4161
615 Ga0496112_0555532 3300048915 Bacteria 1082
616 Ga0496113_0002974 3300048916 Bacteria 10026
617 Ga0496113_0281984 3300048916 Bacteria 1329
618 Ga0496113_1034440 3300048916 Bacteria 646
619 Ga0496114_0154139 3300048917 Bacteria 1994
620 Ga0496115_0181071 3300048918 Bacteria 1742
621 Ga0496120_0002598 3300048923 Bacteria 17922
622 Ga0501031_0055053 3300049568 Bacteria 2592
623 Ga0501032_0003377 3300049569 Bacteria 12244
624 Ga0501032_0010863 3300049569 Bacteria 6550
625 Ga0501033_0032032 3300049570 Bacteria 3947
626 Ga0501034_0065352 3300049571 Bacteria 3650
627 Ga0501034_0116681 3300049571 Bacteria 2657
628 Ga0501037_0063259 3300049573 Bacteria 2697
629 Ga0501037_0148340 3300049573 Bacteria 1677
630 Ga0501039_0929652 3300049575 Bacteria 677
631 Ga0501041_0457897 3300049577 Bacteria 810
632 Ga0501042_0007628 3300049578 Bacteria 7098
633 Ga0501043_0119858 3300049579 Bacteria 2063
634 Ga0501043_0289033 3300049579 Bacteria 1255
635 Ga0501047_0018035 3300049581 Bacteria 6764
636 Ga0501047_0117502 3300049581 Bacteria 2541
637 Ga0501070_0068347 3300049586 Bacteria 2941
638 Ga0501070_0473460 3300049586 Bacteria 1008
639 Ga0501070_0552916 3300049586 Bacteria 921
640 Ga0501071_1616793 3300049587 Bacteria 500
641 Ga0501079_1145846 3300049741 Bacteria 613
642 Ga0501035_0009500 3300049822 Bacteria 9042
643 Ga0501035_0034826 3300049822 Bacteria 4574
644 Ga0501035_0680860 3300049822 Bacteria 831
645 Ga0501035_1349811 3300049822 Bacteria 548
646 Ga0501044_0014539 3300049823 Bacteria 8491
647 Ga0501044_0031363 3300049823 Bacteria 5594
648 Ga0501045_0723303 3300049824 Bacteria 734
649 nmdc:mga0yw44_776204_c1 3300050492 Bacteria 651
650 nmdc:mga07m45_335164_c1 3300050496 Bacteria 565
651 nmdc:mga09592_39054_c1 3300050508 Bacteria 3987
652 nmdc:mga0qj67_173741_c1 3300050509 Unclassified 1750
653 nmdc:mga06r32_3311_c1 3300050510 Bacteria 14440
654 nmdc:mga0n895_1826372_c1 3300050512 Bacteria 568
655 Ga0495601_0024766 3300053077 Bacteria 3695
656 Ga0495601_0052694 3300053077 Bacteria 2570
657 Ga0495601_0108737 3300053077 Bacteria 1794
658 Ga0495601_0226450 3300053077 Bacteria 1221
659 Ga0495601_0746119 3300053077 Bacteria 623
660 Ga0495612_0000770 3300053078 Bacteria 13048
661 Ga0495612_0106135 3300053078 Bacteria 1199
662 Ga0495612_0400190 3300053078 Bacteria 624
663 Ga0495595_0030308 3300053084 Bacteria 2426
664 Ga0495619_0079555 3300053085 Bacteria 2205
665 Ga0495619_0951369 3300053085 Bacteria 576
666 Ga0495619_1095429 3300053085 Bacteria 530
667 Ga0500553_057976 3300053101 Bacteria 1830
668 Ga0500553_253297 3300053101 Bacteria 533
669 Ga0466962_0008583 3300061719 Bacteria 4896
670 2515723164 2515154129 Bacteria 5584369
671 2515758737 2515154137 Bacteria 5711575
672 2516084818 2515154202 Bacteria 5471270
673 2616906681 2616644941 Bacteria 8510691
674 2644626160 2643221714 Bacteria 9015452
675 2774904751 2773857933 Bacteria 5818019
676 2811846019 2808606982 Bacteria 7791042
677 2870730304 2870721527 Bacteria 9689237
678 2895452686 2895442618 Bacteria 11027144
679 2954003803 2954002825 Bacteria 9173742
680 2990067885 2990059506 Bacteria 9321252
681 8025485417 8025478263 Bacteria 8209203
682 8048129013 8048127548 Bacteria 11053136
683 8055173342 8055172936 Bacteria 9305943
684 8056449140 8056447290 Bacteria 7680491
685 Ga0496106_0159165
686 JGI24744J21845_10014804
687 JGI25404J52841_10085457
688 JGI25405J52794_10009842
689 Ga0070690_100187757
690 Ga0070677_10389940
691 Ga0068869_100834029
692 Ga0070666_10273021
693 Ga0070682_100265497
694 Ga0068868_100104945
695 Ga0070689_100093271
696 Ga0070691_10017827
697 Ga0070687_100147178
698 Ga0070668_100050891
699 Ga0070669_100197512
700 Ga0070674_100028617
701 Ga0070688_100075312
702 Ga0070659_100059156
703 Ga0070659_100279280
704 Ga0070667_100775655
705 Ga0070703_10252629
706 Ga0070709_10007600
707 Ga0070709_10020381
708 Ga0070709_11017969
709 Ga0070714_100108808
710 Ga0070714_100121994
711 Ga0070714_100355417
712 Ga0070713_100011406
713 Ga0070713_100135661
714 Ga0070713_100304115
715 Ga0070713_100708111
716 Ga0070713_101300615
717 Ga0070710_10020692
718 Ga0070710_10053030
719 Ga0070710_10088139
720 Ga0070710_10949094
721 Ga0070710_11290348
722 Ga0070701_10039722
723 Ga0070711_100011396
724 Ga0070711_100014154
725 Ga0070711_100288854
726 Ga0070705_100453280
727 Ga0070700_100054066
728 Ga0070700_101280277
729 Ga0070694_100058871
730 Ga0070708_100029060
731 Ga0070708_100276340
732 Ga0070663_100048775
733 Ga0070663_100758064
734 Ga0070663_102169753
735 Ga0070662_100360962
736 Ga0070681_10327659
737 Ga0068867_100033637
738 Ga0070706_100290584
739 Ga0070707_100001519
740 Ga0070707_100110203
741 Ga0070698_100013332
742 Ga0070698_100090904
743 Ga0070698_100102755
744 Ga0070698_100109173
745 Ga0070698_100142593
746 Ga0070699_100011244
747 Ga0070699_100437636
748 Ga0070699_100784559
749 Ga0070699_101040185
750 Ga0070684_100121498
751 Ga0070697_100125506
752 Ga0070697_100268288
753 Ga0068853_100024301
754 Ga0068853_101134481
755 Ga0070672_100089985
756 Ga0070696_100026032
757 Ga0070693_100064286
758 Ga0070665_100196946
759 Ga0070665_100566157
760 Ga0070704_100029247
761 Ga0068855_100158092
762 Ga0068855_100271110
763 Ga0068857_100275235
764 Ga0068857_101639956
765 Ga0068854_100104584
766 Ga0068856_100028554
767 Ga0068856_100080231
768 Ga0068856_100203788
769 Ga0068856_100893243
770 Ga0070702_100079823
771 Ga0070702_100629734
772 Ga0068859_100086625
773 Ga0068859_102607821
774 Ga0068864_100039307
775 Ga0068866_10015423
776 Ga0068861_100168249
777 Ga0068851_10154154
778 Ga0068863_100061937
779 Ga0068863_100327501
780 Ga0068863_100584571
781 Ga0068858_100075454
782 Ga0068858_101614569
783 Ga0068860_100051330
784 Ga0068862_100058773
785 Ga0081455_10015238
786 Ga0081455_10023802
787 Ga0081540_1000074
788 Ga0070717_10015073
789 Ga0070717_10020557
790 Ga0070717_10186556
791 Ga0070717_10298263
792 Ga0070717_11650023
793 Ga0075365_10833477
794 Ga0075365_11096964
795 Ga0070715_10014737
796 Ga0070715_10095814
797 Ga0070715_11019773
798 Ga0070716_100002443
799 Ga0070716_100070816
800 Ga0070716_100487156
801 Ga0070716_100589805
802 Ga0070716_100591202
803 Ga0070712_100040749
804 Ga0070712_100050970
805 Ga0070712_100079945
806 Ga0070712_100180771
807 Ga0070712_100183677
808 Ga0070712_101325375
809 Ga0097621_102205233
810 Ga0075370_10826462
811 Ga0068871_100081704
812 Ga0068871_100165114
813 Ga0075428_101117144
814 Ga0075430_100059816
815 Ga0075429_100040186
816 Ga0068865_100018849
817 Ga0075436_100483903
818 Ga0097620_100086626
819 Ga0097620_102606496
820 Ga0105250_10129064
821 Ga0105245_10009441
822 Ga0105245_10054815
823 Ga0105245_12320606
824 Ga0105247_10018291
825 Ga0105247_10028946
826 Ga0105247_10030278
827 Ga0105247_10930883
828 Ga0105243_10050247
829 Ga0105248_10074398
830 Ga0105248_10125174
831 Ga0105248_11393858
832 Ga0105237_10158869
833 Ga0105237_10701235
834 Ga0105238_11096965
835 Ga0105238_11868688
836 Ga0105238_12983846
837 Ga0105249_10131937
838 Ga0105239_10186350
839 Ga0105239_10431486
840 Ga0105239_10666332
841 Ga0105239_12180091
842 Ga0105246_10524556
843 Ga0157343_1021796
844 Ga0157342_1010016
845 Ga0157370_11654343
846 Ga0157369_11229014
847 Ga0157374_10078188
848 Ga0157374_10724681
849 Ga0157378_10065423
850 Ga0157378_12216024
851 Ga0163162_10140231
852 Ga0157372_10364856
853 Ga0157372_10432419
854 Ga0157375_10076633
855 Ga0163163_10045170
856 Ga0163163_11979473
857 Ga0157380_10054757
858 Ga0157377_10494821
859 Ga0157377_10724563
860 Ga0157379_10009698
861 Ga0157379_10111779
862 Ga0157379_10115832
863 Ga0157379_10648848
864 Ga0157376_10085515
865 Ga0157376_10384413
866 Ga0163161_10076571
867 Ga0206356_10827333
868 Ga0213873_10222206
869 Ga0213872_10108402
870 Ga0213875_10106173
871 Ga0224572_1073042
872 Ga0228598_1017514
873 Ga0228598_1019865
874 Ga0207696_1151770
875 Ga0207682_10335625
876 Ga0207692_10030454
877 Ga0207692_10054866
878 Ga0207692_10295180
879 Ga0207692_10455250
880 Ga0207642_10015499
881 Ga0207710_10014932
882 Ga0207710_10090589
883 Ga0207688_10027522
884 Ga0207680_11200143
885 Ga0207647_10113474
886 Ga0207685_10009987
887 Ga0207685_10070769
888 Ga0207685_10278943
889 Ga0207699_10036207
890 Ga0207699_10074536
891 Ga0207699_10138218
892 Ga0207699_10742218
893 Ga0207645_10103018
894 Ga0207684_10012078
895 Ga0207684_10020164
896 Ga0207684_10097762
897 Ga0207684_10130553
898 Ga0207684_10159160
899 Ga0207707_10333497
900 Ga0207707_10451860
901 Ga0207707_11218017
902 Ga0207671_10439857
903 Ga0207671_10573999
904 Ga0207693_10031701
905 Ga0207693_10059849
906 Ga0207693_10290982
907 Ga0207693_11407591
908 Ga0207663_10007612
909 Ga0207663_10013514
910 Ga0207663_10121994
911 Ga0207663_10967585
912 Ga0207649_10045121
913 Ga0207646_10002035
914 Ga0207646_10073929
915 Ga0207646_10561840
916 Ga0207681_10057859
917 Ga0207687_10048416
918 Ga0207700_10003273
919 Ga0207700_10008500
920 Ga0207700_10562469
921 Ga0207664_10040054
922 Ga0207664_10089370
923 Ga0207664_10255893
924 Ga0207664_10328073
925 Ga0207664_10347820
926 Ga0207690_10199440
927 Ga0207690_10278486
928 Ga0207706_10134102
929 Ga0207709_10057225
930 Ga0207670_10067433
931 Ga0207669_10027252
932 Ga0207704_10030625
933 Ga0207665_10013839
934 Ga0207665_10034149
935 Ga0207665_10311921
936 Ga0207665_10817018
937 Ga0207691_10555603
938 Ga0207711_10224161
939 Ga0207711_11527436
940 Ga0207689_10976090
941 Ga0207661_10637550
942 Ga0207667_10156850
943 Ga0207667_10265080
944 Ga0207712_10202506
945 Ga0207668_10036422
946 Ga0207640_10076296
947 Ga0207658_10031381
948 Ga0207677_10684480
949 Ga0207677_11290441
950 Ga0207703_10089057
951 Ga0207703_10718717
952 Ga0207639_10196766
953 Ga0207639_10309692
954 Ga0207639_12225351
955 Ga0207678_10105789
956 Ga0207678_11759900
957 Ga0207678_11772830
958 Ga0207708_10071420
959 Ga0207702_10020072
960 Ga0207702_10054460
961 Ga0207702_10081485
962 Ga0207702_11940470
963 Ga0207641_10211396
964 Ga0207641_10565460
965 Ga0207648_10103359
966 Ga0207676_10107608
967 Ga0207674_12056755
968 Ga0207683_10063408
969 Ga0268266_10173543
970 Ga0268266_10230913
971 Ga0268265_10117517
972 Ga0268264_10876061
973 Ga0268264_11123413
974 Ga0265337_1021073
975 Ga0307517_10120551
976 Ga0307511_10260818
977 Ga0265340_10001866
978 Ga0307513_10350567
979 Ga0307509_10290817
980 Ga0307408_100259375
981 Ga0307508_10218222
982 Ga0307508_10390223
983 Ga0307508_10893741
984 Ga0307406_11718775
985 Ga0307507_10087541
986 Ga0307507_10219018
987 Ga0373926_0013107
988 Ga0373934_0041083
989 Ga0373934_0457639
990 Ga0373944_0006712
991 Ga0373923_0000160
992 Ga0373923_0052797
993 Ga0373936_0020584
994 Ga0373945_0010780
995 Ga0373945_0079923
996 Ga0373945_0153969
997 Ga0373953_0043555
998 Ga0373953_0167111
999 Ga0373954_0041531
1000 Ga0373954_0076870
1001 Ga0373956_0068377
1002 Ga0373957_0037596
1003 Ga0373957_0080540
1004 Ga0373957_0470033
1005 Ga0373943_0020570
1006 Ga0373943_0203465
1007 Ga0373946_0015367
1008 Ga0373946_0050581
1009 Ga0373955_0088259
1010 Ga0373955_0200352
1011 Ga0373955_0637132
1012 Ga0373924_0001818
1013 Ga0373924_0137201
1014 Ga0373931_0815186
1015 Ga0373935_0039209
1016 Ga0373935_0119021
1017 Ga0373935_0363941
1018 Ga0373927_0020960
1019 Ga0373927_0118836
1020 Ga0373927_0209376
1021 Ga0373927_0603772
1022 Ga0373933_0001586
1023 Ga0373933_0078904
1024 Ga0373933_0080086
1025 Ga0373933_0086940
1026 Ga0373933_0193629
1027 Ga0373933_0427629
1028 Ga0373947_0013331
1029 Ga0373947_0350554
1030 Ga0373947_1205507
1031 Ga0373937_0045584
1032 Ga0373937_0056568
1033 Ga0373937_0152795
1034 Ga0373937_0160663
1035 Ga0373937_1962030
1036 Ga0373925_0042503
1037 Ga0373925_0086657
1038 Ga0373925_0179449
1039 Ga0373925_0287431
1040 Ga0373925_0666877
1041 Ga0436364_0172442
1042 Ga0436364_1389394
1043 Ga0436361_1195163
1044 Ga0436362_0957546
1045 Ga0451797_1415164
1046 Ga0451849_0956835
1047 Ga0451851_0891529
1048 Ga0451843_1736962
1049 Ga0451853_2249425
1050 Ga0451853_2361238
1051 Ga0451853_3731733
1052 Ga0439442_000644
1053 Ga0439448_0018039
1054 Ga0439432_009455
1055 Ga0439449_0060420
1056 Ga0450899_003576
1057 Ga0439459_0007367
1058 Ga0439464_0023056
1059 Ga0439460_0010799
1060 Ga0466969_0132280
1061 Ga0466965_0008522
1062 Ga0466966_0012287
1063 Ga0466961_0026711
1064 Ga0466963_0033383
1065 Ga0466964_0027324
1066 Ga0466971_0007549
1067 Ga0466968_0116834
1068 Ga0466970_0003355
1069 Ga0466957_0016014
1070 Ga0466960_1039455
1071 Ga0466959_0010704
1072 Ga0466958_0007333
1073 Ga0466967_0008073
1074 Ga0466967_2601303
1075 Ga0495592_0034189
1076 Ga0495592_0040041
1077 Ga0495592_0054360
1078 Ga0495592_0099574
1079 Ga0495592_0298168
1080 Ga0495592_0380988
1081 Ga0495603_0020166
1082 Ga0495603_0070016
1083 Ga0495590_0380981
1084 Ga0495629_0001629
1085 Ga0495629_0027461
1086 Ga0495629_0085635
1087 Ga0495629_0258946
1088 Ga0495641_0026417
1089 Ga0495641_0030840
1090 Ga0495641_0082472
1091 Ga0495651_0023437
1092 Ga0495651_0033881
1093 Ga0495651_0287401
1094 Ga0495651_0495375
1095 Ga0495651_0576473
1096 Ga0495651_0885091
1097 Ga0495651_0993877
1098 Ga0495653_0003059
1099 Ga0495653_0049058
1100 Ga0495653_0132972
1101 Ga0495653_0158121
1102 Ga0495653_0199789
1103 Ga0495653_0232126
1104 Ga0495653_0319687
1105 Ga0495653_0946253
1106 Ga0495580_0003255
1107 Ga0495582_0001453
1108 Ga0495582_0108973
1109 Ga0495639_0000771
1110 Ga0495639_0365746
1111 Ga0495662_0008688
1112 Ga0495662_0017852
1113 Ga0495662_0028411
1114 Ga0495662_0069802
1115 Ga0495662_0277509
1116 Ga0495664_0001167
1117 Ga0495664_0003016
1118 Ga0495664_0022676
1119 Ga0495664_0103991
1120 Ga0495664_0152323
1121 Ga0495664_0337728
1122 Ga0495664_0345504
1123 Ga0495585_0152321
1124 Ga0495594_0192221
1125 Ga0495594_0212053
1126 Ga0495583_0115196
1127 Ga0495608_0002277
1128 Ga0495608_0067651
1129 Ga0495608_0094422
1130 Ga0495608_0103548
1131 Ga0495618_0025255
1132 Ga0495618_0027389
1133 Ga0495618_0055502
1134 Ga0495618_0585061
1135 Ga0495620_0113051
1136 Ga0495628_0003209
1137 Ga0495628_0026851
1138 Ga0495628_0060100
1139 Ga0495628_0303001
1140 Ga0495628_0383989
1141 Ga0495628_0395218
1142 Ga0495628_0460104
1143 Ga0495628_0510046
1144 Ga0495630_0002884
1145 Ga0495630_0191224
1146 Ga0495630_0465946
1147 Ga0495630_1200771
1148 Ga0495666_0000769
1149 Ga0495666_0193365
1150 Ga0495652_0039327
1151 Ga0495652_0049887
1152 Ga0495652_0053530
1153 Ga0495652_0358655
1154 Ga0495665_0000819
1155 Ga0495665_0057680
1156 Ga0495665_0199817
1157 Ga0495640_0001445
1158 Ga0495640_0100148
1159 Ga0495640_0103253
1160 Ga0495640_0497085
1161 Ga0495640_0656461
1162 Ga0495586_0008837
1163 Ga0495586_0144148
1164 Ga0495587_0027787
1165 Ga0495587_0056353
1166 Ga0495587_0064870
1167 Ga0495587_0161238
1168 Ga0495645_0197645
1169 Ga0495645_0431552
1170 Ga0495645_0567769
1171 Ga0495645_0642114
1172 Ga0495667_0001695
1173 Ga0495667_0104798
1174 Ga0495667_0177556
1175 Ga0495667_0187393
1176 Ga0495668_0019967
1177 Ga0495634_0004435
1178 Ga0495634_0117513
1179 Ga0495634_0181789
1180 Ga0495611_0000372
1181 Ga0495625_0058569
1182 Ga0495635_0002057
1183 Ga0495635_0015327
1184 Ga0495635_0019883
1185 Ga0495635_0025480
1186 Ga0495635_0066027
1187 Ga0495635_0315801
1188 Ga0495657_0002078
1189 Ga0495657_0064253
1190 Ga0495657_0137423
1191 Ga0495657_0186110
1192 Ga0495657_0187619
1193 Ga0495657_0677342
1194 Ga0495657_0813151
1195 Ga0495657_0835060
1196 Ga0495599_0000692
1197 Ga0495599_0016134
1198 Ga0495599_0349784
1199 Ga0495623_0158343
1200 Ga0495646_0002698
1201 Ga0495646_0011628
1202 Ga0495646_0022052
1203 Ga0495646_0038317
1204 Ga0495646_0067721
1205 Ga0495646_0119136
1206 Ga0495646_0514529
1207 Ga0495647_0003522
1208 Ga0495647_0005795
1209 Ga0495647_0139894
1210 Ga0495658_0065633
1211 Ga0495613_0016459
1212 Ga0495613_0031898
1213 Ga0495613_0094291
1214 Ga0495613_0211346
1215 Ga0495613_0255180
1216 Ga0495613_0690177
1217 Ga0495624_0002357
1218 Ga0495624_0438090
1219 Ga0495624_0682299
1220 Ga0495624_0876362
1221 Ga0495624_0957573
1222 Ga0495649_0101272
1223 Ga0495600_0001205
1224 Ga0495600_0005714
1225 Ga0495600_0207026
1226 Ga0495600_0390423
1227 Ga0495660_0364645
1228 Ga0495581_0001419
1229 Ga0495581_0102240
1230 Ga0495581_0135625
1231 Ga0495581_0203809
1232 Ga0495604_0032065
1233 Ga0495604_0079992
1234 Ga0495604_0157402
1235 Ga0495604_0339036
1236 Ga0495604_0511115
1237 Ga0495604_0901817
1238 Ga0495674_0000296
1239 Ga0495674_0004512
1240 Ga0495674_0019338
1241 Ga0495674_0073869
1242 Ga0495674_0343281
1243 Ga0495676_0004076
1244 Ga0495676_0052277
1245 Ga0495676_0218357
1246 Ga0495676_0318943
1247 Ga0495676_0331693
1248 Ga0495676_0482447
1249 Ga0495680_0004163
1250 Ga0495680_0026303
1251 Ga0495680_0032573
1252 Ga0495680_0065345
1253 Ga0495680_0074270
1254 Ga0495680_0125147
1255 Ga0495683_0029069
1256 Ga0495687_031587
1257 Ga0495675_0043477
1258 Ga0495675_0203250
1259 Ga0495685_106246
1260 Ga0495684_0025608
1261 Ga0495684_0047862
1262 Ga0495684_0094263
1263 Ga0495684_0142133
1264 Ga0495684_0213795
1265 Ga0495684_0819687
1266 Ga0495593_0023093
1267 Ga0495593_0039455
1268 Ga0495593_0085088
1269 Ga0495593_0400422
1270 Ga0495593_0530066
1271 Ga0495602_0054157
1272 Ga0495602_0098120
1273 Ga0495602_0350355
1274 Ga0495602_0939836
1275 Ga0495614_0009084
1276 Ga0495614_0213476
1277 Ga0496100_0035704
1278 Ga0496101_0159614
1279 Ga0496102_0059648
1280 Ga0496102_0148366
1281 Ga0496102_1114237
1282 Ga0496103_0059447
1283 Ga0496104_0051810
1284 Ga0496104_0368518
1285 Ga0496104_1135246
1286 Ga0496105_0046180
1287 Ga0496106_0019591
1288 Ga0496106_0045262
1289 Ga0496106_0089102
1290 Ga0496107_0043887
1291 Ga0496108_0058968
1292 Ga0496108_0212671
1293 Ga0496108_1635865
1294 Ga0496109_0007679
1295 Ga0496110_0032676
1296 Ga0496110_0880533
1297 Ga0496112_0003194
1298 Ga0496112_0048576
1299 Ga0496112_0555532
1300 Ga0496113_0002974
1301 Ga0496113_0281984
1302 Ga0496113_1034440
1303 Ga0496114_0154139
1304 Ga0496115_0181071
1305 Ga0496120_0002598
1306 Ga0501031_0055053
1307 Ga0501032_0003377
1308 Ga0501032_0010863
1309 Ga0501033_0032032
1310 Ga0501034_0065352
1311 Ga0501034_0116681
1312 Ga0501037_0063259
1313 Ga0501037_0148340
1314 Ga0501039_0929652
1315 Ga0501041_0457897
1316 Ga0501042_0007628
1317 Ga0501043_0119858
1318 Ga0501043_0289033
1319 Ga0501047_0018035
1320 Ga0501047_0117502
1321 Ga0501070_0068347
1322 Ga0501070_0473460
1323 Ga0501070_0552916
1324 Ga0501071_1616793
1325 Ga0501079_1145846
1326 Ga0501035_0009500
1327 Ga0501035_0034826
1328 Ga0501035_0680860
1329 Ga0501035_1349811
1330 Ga0501044_0014539
1331 Ga0501044_0031363
1332 Ga0501045_0723303
1333 nmdc:mga0yw44_776204_c1
1334 nmdc:mga07m45_335164_c1
1335 nmdc:mga09592_39054_c1
1336 nmdc:mga0qj67_173741_c1
1337 nmdc:mga06r32_3311_c1
1338 nmdc:mga0n895_1826372_c1
1339 Ga0495601_0024766
1340 Ga0495601_0052694
1341 Ga0495601_0108737
1342 Ga0495601_0226450
1343 Ga0495601_0746119
1344 Ga0495612_0000770
1345 Ga0495612_0106135
1346 Ga0495612_0400190
1347 Ga0495595_0030308
1348 Ga0495619_0079555
1349 Ga0495619_0951369
1350 Ga0495619_1095429
1351 Ga0500553_057976
1352 Ga0500553_253297
1353 Ga0466962_0008583
1354 2515723164
1355 2515758737
1356 2516084818
1357 2616906681
1358 2644626160
1359 2774904751
1360 2811846019
1361 2870730304
1362 2895452686
1363 2954003803
1364 2990067885
1365 8025485417
1366 8048129013
1367 8055173342
1368 8056449140

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13443

HTH_26

Cro/C1-type HTH DNA-binding domain

4

72

0.9

Map