F475038
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 684 | 374 | 684 | 174 |
Family's Representative Sequence
| Representative Sequence | 3300005547|Ga0070693_100617792|Ga0070693_1006177921 |
| Length | 189 |
| Sequence | VILQATRPVIGIVGWKNSGKTTLVESLVGELTRRGLRVSTIKHAHHDCEIDKPGKDSYRHRQAGAQEVIVSSAKRWALVHELDDESEPSLAGLLSHLSSCDLVLVEGMKSETFDKILVVRGKNDPPWNLCTGICAVASDEPASAGPFQSLPLNEPRVITDFLVARYQLEKRTRLARCDFSISAQSGAPT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 2 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 3 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 4 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 5 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 40 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 55 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 56 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 58 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 59 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 60 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 61 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 62 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 63 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 64 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 65 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 66 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 67 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 68 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 69 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 70 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 71 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 72 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 74 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 75 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 76 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 77 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 81 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 82 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 83 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 85 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 86 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 87 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 88 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 89 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 90 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 91 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 92 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 93 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 95 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 96 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 109 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 125 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 126 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 127 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 187 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 190 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 191 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 192 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 193 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 194 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 195 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 196 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 197 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 198 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 199 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 200 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 201 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 202 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 203 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 204 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 205 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 206 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 207 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 208 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 209 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 210 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 211 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 212 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 213 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 214 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 215 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 216 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 217 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 218 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 219 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 220 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 221 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 222 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 223 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 224 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 225 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 226 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 227 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 228 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 229 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 230 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 231 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 232 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 233 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 234 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 235 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 236 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 237 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 238 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 239 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 240 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 241 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 242 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 306 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 307 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 308 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 309 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 310 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 311 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 312 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 313 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 314 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 315 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 316 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 317 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 318 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 319 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 320 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 321 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 324 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 328 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 330 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 332 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 339 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 340 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 341 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 344 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 345 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 346 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 347 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 348 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 349 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 350 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 351 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 352 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 353 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 354 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 355 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 356 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 357 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 358 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 359 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 362 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 366 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 367 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 368 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 369 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 370 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 371 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 372 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 373 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 374 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.41 |
| Nodule | 0 |
| Rhizoplane | 8.33 |
| Rhizosphere | 84.21 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.05 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24750J21931_1003979 | 3300002070 | Bacteria | 1781 |
| 2 | JGI24744J21845_10009127 | 3300002077 | Bacteria | 2036 |
| 3 | JGI24751J29686_10004761 | 3300002459 | Bacteria | 2757 |
| 4 | JGI25406J46586_10027958 | 3300003203 | Bacteria | 2154 |
| 5 | Ga0065712_10122210 | 3300005290 | Bacteria | 1654 |
| 6 | Ga0070658_10351382 | 3300005327 | Bacteria | 1262 |
| 7 | Ga0070676_10138121 | 3300005328 | Bacteria | 1548 |
| 8 | Ga0070683_100270444 | 3300005329 | Bacteria | 1616 |
| 9 | Ga0070690_100041527 | 3300005330 | Bacteria | 2912 |
| 10 | Ga0070690_100380331 | 3300005330 | Bacteria | 1032 |
| 11 | Ga0070670_100026862 | 3300005331 | Bacteria | 4951 |
| 12 | Ga0070670_100053933 | 3300005331 | Bacteria | 3452 |
| 13 | Ga0070670_100411419 | 3300005331 | Bacteria | 1195 |
| 14 | Ga0070677_10043840 | 3300005333 | Bacteria | 1778 |
| 15 | Ga0070666_10072282 | 3300005335 | Bacteria | 2348 |
| 16 | Ga0070680_100019906 | 3300005336 | Bacteria | 5321 |
| 17 | Ga0070680_100220691 | 3300005336 | Bacteria | 1600 |
| 18 | Ga0068868_100004148 | 3300005338 | Bacteria | 10129 |
| 19 | Ga0068868_100238478 | 3300005338 | Bacteria | 1527 |
| 20 | Ga0070660_100034493 | 3300005339 | Bacteria | 3824 |
| 21 | Ga0070689_100004242 | 3300005340 | Bacteria | 9662 |
| 22 | Ga0070689_100122565 | 3300005340 | Bacteria | 2077 |
| 23 | Ga0070689_100383534 | 3300005340 | Bacteria | 1185 |
| 24 | Ga0070687_100145372 | 3300005343 | Bacteria | 1385 |
| 25 | Ga0070687_100152993 | 3300005343 | Bacteria | 1356 |
| 26 | Ga0070687_100423051 | 3300005343 | Bacteria | 879 |
| 27 | Ga0070661_100184432 | 3300005344 | Bacteria | 1589 |
| 28 | Ga0070661_100666805 | 3300005344 | Bacteria | 845 |
| 29 | Ga0070692_10155262 | 3300005345 | Bacteria | 1307 |
| 30 | Ga0070668_100007545 | 3300005347 | Bacteria | 8078 |
| 31 | Ga0070668_100097606 | 3300005347 | Bacteria | 2324 |
| 32 | Ga0070669_100027678 | 3300005353 | Bacteria | 4080 |
| 33 | Ga0070669_100481419 | 3300005353 | Bacteria | 1027 |
| 34 | Ga0070675_100150284 | 3300005354 | Bacteria | 1996 |
| 35 | Ga0070675_100224860 | 3300005354 | Bacteria | 1635 |
| 36 | Ga0070671_100108048 | 3300005355 | Bacteria | 2336 |
| 37 | Ga0070671_100207907 | 3300005355 | Bacteria | 1660 |
| 38 | Ga0070671_100314078 | 3300005355 | Bacteria | 1335 |
| 39 | Ga0070674_100235344 | 3300005356 | Bacteria | 1431 |
| 40 | Ga0070673_100111922 | 3300005364 | Bacteria | 2265 |
| 41 | Ga0070673_100181988 | 3300005364 | Bacteria | 1800 |
| 42 | Ga0070673_101226332 | 3300005364 | Bacteria | 703 |
| 43 | Ga0070667_100020104 | 3300005367 | Bacteria | 5543 |
| 44 | Ga0070667_100038285 | 3300005367 | Bacteria | 4020 |
| 45 | Ga0070667_100131123 | 3300005367 | Bacteria | 2188 |
| 46 | Ga0070667_100910209 | 3300005367 | Bacteria | 819 |
| 47 | Ga0070667_101027359 | 3300005367 | Bacteria | 769 |
| 48 | Ga0070667_101387234 | 3300005367 | Bacteria | 659 |
| 49 | Ga0070709_10073862 | 3300005434 | Bacteria | 2209 |
| 50 | Ga0070714_100183202 | 3300005435 | Bacteria | 1906 |
| 51 | Ga0070714_100554465 | 3300005435 | Bacteria | 1100 |
| 52 | Ga0070713_100051720 | 3300005436 | Bacteria | 3399 |
| 53 | Ga0070713_100097916 | 3300005436 | Bacteria | 2535 |
| 54 | Ga0070713_100721208 | 3300005436 | Bacteria | 953 |
| 55 | Ga0070710_10035150 | 3300005437 | Bacteria | 2731 |
| 56 | Ga0070710_10075928 | 3300005437 | Bacteria | 1948 |
| 57 | Ga0070701_10023853 | 3300005438 | Bacteria | 2952 |
| 58 | Ga0070701_10036830 | 3300005438 | Bacteria | 2467 |
| 59 | Ga0070701_10526992 | 3300005438 | Bacteria | 771 |
| 60 | Ga0070711_100898707 | 3300005439 | Bacteria | 756 |
| 61 | Ga0070705_100304212 | 3300005440 | Bacteria | 1144 |
| 62 | Ga0070705_100321457 | 3300005440 | Bacteria | 1117 |
| 63 | Ga0070700_100001737 | 3300005441 | Bacteria | 10954 |
| 64 | Ga0070694_100722551 | 3300005444 | Bacteria | 811 |
| 65 | Ga0070663_100060419 | 3300005455 | Bacteria | 2726 |
| 66 | Ga0070663_100431890 | 3300005455 | Bacteria | 1082 |
| 67 | Ga0070678_100569279 | 3300005456 | Bacteria | 1008 |
| 68 | Ga0070662_100080077 | 3300005457 | Bacteria | 2431 |
| 69 | Ga0070662_100692017 | 3300005457 | Bacteria | 862 |
| 70 | Ga0068867_100007687 | 3300005459 | Bacteria | 7626 |
| 71 | Ga0068867_100807287 | 3300005459 | Unclassified | 837 |
| 72 | Ga0070685_10007977 | 3300005466 | Bacteria | 5427 |
| 73 | Ga0070685_10406784 | 3300005466 | Bacteria | 944 |
| 74 | Ga0070707_100278025 | 3300005468 | Bacteria | 1627 |
| 75 | Ga0070698_100138153 | 3300005471 | Bacteria | 2390 |
| 76 | Ga0070698_100205702 | 3300005471 | Bacteria | 1904 |
| 77 | Ga0070698_100699697 | 3300005471 | Bacteria | 955 |
| 78 | Ga0070699_100020079 | 3300005518 | Bacteria | 5758 |
| 79 | Ga0070699_100620378 | 3300005518 | Bacteria | 986 |
| 80 | Ga0070679_100970310 | 3300005530 | Bacteria | 794 |
| 81 | Ga0070684_100075565 | 3300005535 | Bacteria | 2972 |
| 82 | Ga0070697_100009157 | 3300005536 | Bacteria | 7735 |
| 83 | Ga0070672_100075175 | 3300005543 | Bacteria | 2696 |
| 84 | Ga0070672_100525359 | 3300005543 | Bacteria | 1025 |
| 85 | Ga0070686_100465485 | 3300005544 | Bacteria | 974 |
| 86 | Ga0070686_100675000 | 3300005544 | Bacteria | 822 |
| 87 | Ga0070695_100015964 | 3300005545 | Bacteria | 4539 |
| 88 | Ga0070695_100630242 | 3300005545 | Unclassified | 845 |
| 89 | Ga0070696_100022673 | 3300005546 | Bacteria | 4267 |
| 90 | Ga0070696_100897459 | 3300005546 | Bacteria | 735 |
| 91 | Ga0070693_100617792 | 3300005547 | Unclassified | 784 |
| 92 | Ga0070704_100001844 | 3300005549 | Bacteria | 11680 |
| 93 | Ga0070704_100384246 | 3300005549 | Bacteria | 1194 |
| 94 | Ga0070704_101264767 | 3300005549 | Unclassified | 674 |
| 95 | Ga0070664_100131849 | 3300005564 | Bacteria | 2196 |
| 96 | Ga0070664_100134650 | 3300005564 | Bacteria | 2172 |
| 97 | Ga0070664_100158765 | 3300005564 | Bacteria | 1999 |
| 98 | Ga0068857_100115048 | 3300005577 | Bacteria | 2419 |
| 99 | Ga0068856_100148988 | 3300005614 | Bacteria | 2348 |
| 100 | Ga0068856_100174392 | 3300005614 | Bacteria | 2163 |
| 101 | Ga0070702_100001567 | 3300005615 | Bacteria | 9425 |
| 102 | Ga0070702_100211050 | 3300005615 | Bacteria | 1292 |
| 103 | Ga0068852_100096596 | 3300005616 | Bacteria | 2656 |
| 104 | Ga0068859_100069488 | 3300005617 | Bacteria | 3557 |
| 105 | Ga0068859_100242571 | 3300005617 | Bacteria | 1891 |
| 106 | Ga0068859_100370310 | 3300005617 | Bacteria | 1528 |
| 107 | Ga0068859_100380511 | 3300005617 | Bacteria | 1507 |
| 108 | Ga0068859_100685491 | 3300005617 | Bacteria | 1116 |
| 109 | Ga0068864_100021281 | 3300005618 | Bacteria | 5434 |
| 110 | Ga0068864_100158300 | 3300005618 | Bacteria | 2057 |
| 111 | Ga0068866_10013349 | 3300005718 | Bacteria | 3602 |
| 112 | Ga0068861_100088205 | 3300005719 | Bacteria | 2442 |
| 113 | Ga0068861_100693167 | 3300005719 | Bacteria | 946 |
| 114 | Ga0068851_10135286 | 3300005834 | Bacteria | 1336 |
| 115 | Ga0068870_10002141 | 3300005840 | Bacteria | 8175 |
| 116 | Ga0068863_100300488 | 3300005841 | Bacteria | 1557 |
| 117 | Ga0068858_100006326 | 3300005842 | Bacteria | 11531 |
| 118 | Ga0068858_100098733 | 3300005842 | Bacteria | 2722 |
| 119 | Ga0068858_100553498 | 3300005842 | Bacteria | 1114 |
| 120 | Ga0068860_100028301 | 3300005843 | Bacteria | 5394 |
| 121 | Ga0068860_100513631 | 3300005843 | Bacteria | 1197 |
| 122 | Ga0068862_100012692 | 3300005844 | Bacteria | 6972 |
| 123 | Ga0081455_10003757 | 3300005937 | Bacteria | 17335 |
| 124 | Ga0081455_10030575 | 3300005937 | Bacteria | 4890 |
| 125 | Ga0081455_10046628 | 3300005937 | Bacteria | 3758 |
| 126 | Ga0081538_10000146 | 3300005981 | Bacteria | 73599 |
| 127 | Ga0081538_10021756 | 3300005981 | Bacteria | 4667 |
| 128 | Ga0081540_1012665 | 3300005983 | Bacteria | 5532 |
| 129 | Ga0081539_10014262 | 3300005985 | Bacteria | 5897 |
| 130 | Ga0081539_10040148 | 3300005985 | Bacteria | 2751 |
| 131 | Ga0070717_10134085 | 3300006028 | Bacteria | 2131 |
| 132 | Ga0070717_10643995 | 3300006028 | Bacteria | 962 |
| 133 | Ga0075365_10053135 | 3300006038 | Bacteria | 2682 |
| 134 | Ga0075365_10107326 | 3300006038 | Bacteria | 1917 |
| 135 | Ga0075365_10497928 | 3300006038 | Bacteria | 861 |
| 136 | Ga0075368_10080575 | 3300006042 | Bacteria | 1324 |
| 137 | Ga0075363_100171698 | 3300006048 | Bacteria | 1231 |
| 138 | Ga0075363_100350168 | 3300006048 | Bacteria | 862 |
| 139 | Ga0075363_100386543 | 3300006048 | Bacteria | 821 |
| 140 | Ga0075364_10113068 | 3300006051 | Bacteria | 1813 |
| 141 | Ga0070715_10007987 | 3300006163 | Bacteria | 3669 |
| 142 | Ga0070716_100038326 | 3300006173 | Bacteria | 2654 |
| 143 | Ga0070716_100644051 | 3300006173 | Bacteria | 803 |
| 144 | Ga0070712_100064607 | 3300006175 | Bacteria | 2596 |
| 145 | Ga0070712_100116633 | 3300006175 | Bacteria | 2003 |
| 146 | Ga0070712_100232547 | 3300006175 | Bacteria | 1464 |
| 147 | Ga0075362_10020342 | 3300006177 | Bacteria | 2772 |
| 148 | Ga0075367_10073575 | 3300006178 | Bacteria | 2059 |
| 149 | Ga0075367_10165656 | 3300006178 | Bacteria | 1375 |
| 150 | Ga0075367_10224412 | 3300006178 | Bacteria | 1176 |
| 151 | Ga0075366_10115064 | 3300006195 | Bacteria | 1619 |
| 152 | Ga0075366_10661938 | 3300006195 | Bacteria | 648 |
| 153 | Ga0097621_100010895 | 3300006237 | Bacteria | 6674 |
| 154 | Ga0075370_10026736 | 3300006353 | Bacteria | 3198 |
| 155 | Ga0068871_100271209 | 3300006358 | Bacteria | 1482 |
| 156 | Ga0075428_100085901 | 3300006844 | Bacteria | 3432 |
| 157 | Ga0075428_100861797 | 3300006844 | Bacteria | 962 |
| 158 | Ga0075430_100000583 | 3300006846 | Bacteria | 27751 |
| 159 | Ga0075430_100139470 | 3300006846 | Bacteria | 2019 |
| 160 | Ga0075430_100677643 | 3300006846 | Bacteria | 850 |
| 161 | Ga0075431_100112076 | 3300006847 | Bacteria | 2815 |
| 162 | Ga0075431_100220278 | 3300006847 | Bacteria | 1936 |
| 163 | Ga0075431_100924884 | 3300006847 | Bacteria | 841 |
| 164 | Ga0075431_101211004 | 3300006847 | Bacteria | 718 |
| 165 | Ga0075434_100010388 | 3300006871 | Bacteria | 8726 |
| 166 | Ga0075434_100164343 | 3300006871 | Bacteria | 2239 |
| 167 | Ga0075429_100153262 | 3300006880 | Bacteria | 2018 |
| 168 | Ga0075429_100892749 | 3300006880 | Bacteria | 778 |
| 169 | Ga0075429_100897059 | 3300006880 | Bacteria | 776 |
| 170 | Ga0068865_100296132 | 3300006881 | Bacteria | 1293 |
| 171 | Ga0075436_100004215 | 3300006914 | Bacteria | 9869 |
| 172 | Ga0075436_100408703 | 3300006914 | Unclassified | 984 |
| 173 | Ga0097620_100069489 | 3300006931 | Bacteria | 3557 |
| 174 | Ga0097620_100242557 | 3300006931 | Bacteria | 1891 |
| 175 | Ga0097620_100370288 | 3300006931 | Bacteria | 1528 |
| 176 | Ga0097620_100380494 | 3300006931 | Bacteria | 1507 |
| 177 | Ga0097620_100685443 | 3300006931 | Bacteria | 1116 |
| 178 | Ga0075435_100175400 | 3300007076 | Bacteria | 1810 |
| 179 | Ga0075435_101078401 | 3300007076 | Bacteria | 702 |
| 180 | Ga0099794_10060226 | 3300007265 | Bacteria | 1843 |
| 181 | Ga0105240_10180116 | 3300009093 | Bacteria | 2494 |
| 182 | Ga0105240_10272542 | 3300009093 | Bacteria | 1948 |
| 183 | Ga0111539_10013535 | 3300009094 | Bacteria | 10195 |
| 184 | Ga0111539_10211335 | 3300009094 | Bacteria | 2261 |
| 185 | Ga0111539_10231184 | 3300009094 | Bacteria | 2153 |
| 186 | Ga0111539_11321080 | 3300009094 | Bacteria | 837 |
| 187 | Ga0111539_12315861 | 3300009094 | Bacteria | 623 |
| 188 | Ga0105245_10123903 | 3300009098 | Bacteria | 2417 |
| 189 | Ga0105245_10344848 | 3300009098 | Bacteria | 1474 |
| 190 | Ga0105245_10382313 | 3300009098 | Bacteria | 1402 |
| 191 | Ga0105245_10478396 | 3300009098 | Bacteria | 1258 |
| 192 | Ga0105247_10002289 | 3300009101 | Bacteria | 13101 |
| 193 | Ga0105247_10017488 | 3300009101 | Bacteria | 4302 |
| 194 | Ga0105247_10555182 | 3300009101 | Bacteria | 845 |
| 195 | Ga0114129_10132354 | 3300009147 | Bacteria | 3424 |
| 196 | Ga0114129_10150021 | 3300009147 | Bacteria | 3191 |
| 197 | Ga0114129_10290189 | 3300009147 | Bacteria | 2183 |
| 198 | Ga0114129_10464518 | 3300009147 | Bacteria | 1658 |
| 199 | Ga0114129_11176658 | 3300009147 | Bacteria | 956 |
| 200 | Ga0114129_11256463 | 3300009147 | Bacteria | 920 |
| 201 | Ga0114129_12284742 | 3300009147 | Bacteria | 649 |
| 202 | Ga0105243_10120358 | 3300009148 | Bacteria | 2212 |
| 203 | Ga0105243_10285292 | 3300009148 | Bacteria | 1489 |
| 204 | Ga0105243_10392293 | 3300009148 | Bacteria | 1287 |
| 205 | Ga0105243_10458637 | 3300009148 | Bacteria | 1198 |
| 206 | Ga0105241_10211087 | 3300009174 | Bacteria | 1627 |
| 207 | Ga0105242_10033647 | 3300009176 | Bacteria | 4106 |
| 208 | Ga0105242_10244498 | 3300009176 | Bacteria | 1614 |
| 209 | Ga0105248_10008256 | 3300009177 | Bacteria | 11439 |
| 210 | Ga0105248_10395254 | 3300009177 | Bacteria | 1557 |
| 211 | Ga0105237_10029785 | 3300009545 | Bacteria | 5545 |
| 212 | Ga0105237_10797347 | 3300009545 | Bacteria | 951 |
| 213 | Ga0105238_10140449 | 3300009551 | Bacteria | 2392 |
| 214 | Ga0105238_10149332 | 3300009551 | Bacteria | 2312 |
| 215 | Ga0105249_10030751 | 3300009553 | Bacteria | 4854 |
| 216 | Ga0105249_10053275 | 3300009553 | Bacteria | 3698 |
| 217 | Ga0105249_10255227 | 3300009553 | Bacteria | 1740 |
| 218 | Ga0105249_10882682 | 3300009553 | Bacteria | 961 |
| 219 | Ga0105249_11892871 | 3300009553 | Bacteria | 669 |
| 220 | Ga0099796_10038454 | 3300010159 | Bacteria | 1605 |
| 221 | Ga0105239_10183580 | 3300010375 | Bacteria | 2341 |
| 222 | Ga0105239_10327719 | 3300010375 | Bacteria | 1727 |
| 223 | Ga0105246_10069686 | 3300011119 | Bacteria | 2471 |
| 224 | Ga0105246_10193564 | 3300011119 | Bacteria | 1576 |
| 225 | Ga0105246_10284799 | 3300011119 | Bacteria | 1327 |
| 226 | Ga0105246_11232165 | 3300011119 | Bacteria | 690 |
| 227 | Ga0105246_11533473 | 3300011119 | Bacteria | 627 |
| 228 | Ga0157373_10076208 | 3300013100 | Unclassified | 2367 |
| 229 | Ga0157371_10015546 | 3300013102 | Bacteria | 5708 |
| 230 | Ga0157374_10008420 | 3300013296 | Bacteria | 8811 |
| 231 | Ga0157378_10096003 | 3300013297 | Bacteria | 2701 |
| 232 | Ga0157378_10538162 | 3300013297 | Bacteria | 1172 |
| 233 | Ga0163162_10801181 | 3300013306 | Bacteria | 1059 |
| 234 | Ga0163162_10840882 | 3300013306 | Bacteria | 1033 |
| 235 | Ga0157372_10024327 | 3300013307 | Bacteria | 6577 |
| 236 | Ga0157375_10523055 | 3300013308 | Bacteria | 1349 |
| 237 | Ga0157375_10723075 | 3300013308 | Bacteria | 1148 |
| 238 | Ga0157375_12085772 | 3300013308 | Bacteria | 675 |
| 239 | Ga0163163_10071017 | 3300014325 | Bacteria | 3468 |
| 240 | Ga0163163_10192445 | 3300014325 | Bacteria | 2088 |
| 241 | Ga0163163_10303310 | 3300014325 | Bacteria | 1650 |
| 242 | Ga0157380_10208632 | 3300014326 | Bacteria | 1739 |
| 243 | Ga0157377_10005919 | 3300014745 | Bacteria | 5787 |
| 244 | Ga0157377_10266837 | 3300014745 | Bacteria | 1116 |
| 245 | Ga0157379_10020263 | 3300014968 | Bacteria | 5880 |
| 246 | Ga0157376_10017126 | 3300014969 | Bacteria | 5520 |
| 247 | Ga0163161_10086802 | 3300017792 | Bacteria | 2310 |
| 248 | Ga0163161_10260789 | 3300017792 | Bacteria | 1353 |
| 249 | Ga0213876_10004487 | 3300021384 | Bacteria | 7800 |
| 250 | Ga0213875_10000040 | 3300021388 | Bacteria | 156362 |
| 251 | Ga0224572_1044952 | 3300024225 | Bacteria | 828 |
| 252 | Ga0207656_10005379 | 3300025321 | Bacteria | 4521 |
| 253 | Ga0207682_10005543 | 3300025893 | Bacteria | 5137 |
| 254 | Ga0207692_10268360 | 3300025898 | Bacteria | 1028 |
| 255 | Ga0207692_10449511 | 3300025898 | Bacteria | 811 |
| 256 | Ga0207642_10004584 | 3300025899 | Bacteria | 4465 |
| 257 | Ga0207710_10021632 | 3300025900 | Bacteria | 2758 |
| 258 | Ga0207710_10271822 | 3300025900 | Bacteria | 851 |
| 259 | Ga0207688_10000480 | 3300025901 | Bacteria | 19126 |
| 260 | Ga0207688_10094238 | 3300025901 | Bacteria | 1722 |
| 261 | Ga0207688_10351940 | 3300025901 | Bacteria | 908 |
| 262 | Ga0207647_10045019 | 3300025904 | Bacteria | 2754 |
| 263 | Ga0207699_10896179 | 3300025906 | Bacteria | 654 |
| 264 | Ga0207645_10008758 | 3300025907 | Bacteria | 7039 |
| 265 | Ga0207645_10107807 | 3300025907 | Bacteria | 1802 |
| 266 | Ga0207643_10017874 | 3300025908 | Bacteria | 3883 |
| 267 | Ga0207643_10444541 | 3300025908 | Bacteria | 824 |
| 268 | Ga0207705_10231510 | 3300025909 | Bacteria | 1405 |
| 269 | Ga0207705_10321200 | 3300025909 | Bacteria | 1190 |
| 270 | Ga0207684_10060236 | 3300025910 | Bacteria | 3224 |
| 271 | Ga0207707_10009131 | 3300025912 | Bacteria | 8611 |
| 272 | Ga0207695_10700158 | 3300025913 | Bacteria | 894 |
| 273 | Ga0207695_10870733 | 3300025913 | Bacteria | 781 |
| 274 | Ga0207671_10105646 | 3300025914 | Bacteria | 2137 |
| 275 | Ga0207671_10896894 | 3300025914 | Bacteria | 701 |
| 276 | Ga0207671_11033018 | 3300025914 | Bacteria | 647 |
| 277 | Ga0207693_10067103 | 3300025915 | Bacteria | 2809 |
| 278 | Ga0207693_10100053 | 3300025915 | Bacteria | 2273 |
| 279 | Ga0207693_10190573 | 3300025915 | Bacteria | 1613 |
| 280 | Ga0207660_10270496 | 3300025917 | Bacteria | 1346 |
| 281 | Ga0207662_10012537 | 3300025918 | Bacteria | 4723 |
| 282 | Ga0207662_10092315 | 3300025918 | Bacteria | 1864 |
| 283 | Ga0207662_10143468 | 3300025918 | Bacteria | 1514 |
| 284 | Ga0207662_10219512 | 3300025918 | Bacteria | 1237 |
| 285 | Ga0207657_10021920 | 3300025919 | Bacteria | 5998 |
| 286 | Ga0207649_10118655 | 3300025920 | Bacteria | 1780 |
| 287 | Ga0207649_10145433 | 3300025920 | Bacteria | 1627 |
| 288 | Ga0207646_10230750 | 3300025922 | Bacteria | 1672 |
| 289 | Ga0207681_10028773 | 3300025923 | Bacteria | 3603 |
| 290 | Ga0207681_10581104 | 3300025923 | Bacteria | 924 |
| 291 | Ga0207694_10227434 | 3300025924 | Bacteria | 1523 |
| 292 | Ga0207650_10027777 | 3300025925 | Bacteria | 4053 |
| 293 | Ga0207650_10029398 | 3300025925 | Bacteria | 3951 |
| 294 | Ga0207659_10027691 | 3300025926 | Bacteria | 3841 |
| 295 | Ga0207659_10355930 | 3300025926 | Bacteria | 1216 |
| 296 | Ga0207659_10463029 | 3300025926 | Bacteria | 1069 |
| 297 | Ga0207687_10020079 | 3300025927 | Bacteria | 4431 |
| 298 | Ga0207687_10083433 | 3300025927 | Bacteria | 2314 |
| 299 | Ga0207687_10330381 | 3300025927 | Bacteria | 1236 |
| 300 | Ga0207700_10037724 | 3300025928 | Bacteria | 3502 |
| 301 | Ga0207700_10414313 | 3300025928 | Bacteria | 1182 |
| 302 | Ga0207644_10152425 | 3300025931 | Bacteria | 1790 |
| 303 | Ga0207644_10350061 | 3300025931 | Bacteria | 1199 |
| 304 | Ga0207644_10930257 | 3300025931 | Bacteria | 729 |
| 305 | Ga0207690_10006529 | 3300025932 | Bacteria | 6916 |
| 306 | Ga0207706_10005860 | 3300025933 | Bacteria | 11430 |
| 307 | Ga0207706_10059462 | 3300025933 | Bacteria | 3365 |
| 308 | Ga0207686_10652957 | 3300025934 | Bacteria | 832 |
| 309 | Ga0207709_10029425 | 3300025935 | Bacteria | 3186 |
| 310 | Ga0207709_10617326 | 3300025935 | Unclassified | 860 |
| 311 | Ga0207670_10008610 | 3300025936 | Bacteria | 5769 |
| 312 | Ga0207670_10133149 | 3300025936 | Bacteria | 1824 |
| 313 | Ga0207670_10289599 | 3300025936 | Bacteria | 1279 |
| 314 | Ga0207669_10043006 | 3300025937 | Bacteria | 2642 |
| 315 | Ga0207669_10118992 | 3300025937 | Bacteria | 1788 |
| 316 | Ga0207704_10882628 | 3300025938 | Bacteria | 751 |
| 317 | Ga0207665_10016432 | 3300025939 | Bacteria | 4859 |
| 318 | Ga0207691_10082085 | 3300025940 | Bacteria | 2896 |
| 319 | Ga0207691_10142907 | 3300025940 | Bacteria | 2108 |
| 320 | Ga0207691_10254298 | 3300025940 | Bacteria | 1516 |
| 321 | Ga0207711_10014189 | 3300025941 | Bacteria | 6618 |
| 322 | Ga0207711_10610964 | 3300025941 | Bacteria | 1017 |
| 323 | Ga0207689_10033455 | 3300025942 | Bacteria | 4271 |
| 324 | Ga0207689_10250916 | 3300025942 | Bacteria | 1463 |
| 325 | Ga0207661_10019047 | 3300025944 | Bacteria | 5109 |
| 326 | Ga0207679_10241223 | 3300025945 | Bacteria | 1531 |
| 327 | Ga0207651_10285439 | 3300025960 | Bacteria | 1366 |
| 328 | Ga0207651_10525958 | 3300025960 | Bacteria | 1025 |
| 329 | Ga0207712_10003449 | 3300025961 | Bacteria | 9990 |
| 330 | Ga0207712_10250865 | 3300025961 | Bacteria | 1430 |
| 331 | Ga0207668_10071058 | 3300025972 | Bacteria | 2485 |
| 332 | Ga0207668_10847575 | 3300025972 | Bacteria | 811 |
| 333 | Ga0207658_10438028 | 3300025986 | Bacteria | 1155 |
| 334 | Ga0207658_10989844 | 3300025986 | Bacteria | 767 |
| 335 | Ga0207677_10222820 | 3300026023 | Bacteria | 1514 |
| 336 | Ga0207677_10746693 | 3300026023 | Bacteria | 872 |
| 337 | Ga0207703_10005201 | 3300026035 | Bacteria | 10517 |
| 338 | Ga0207703_10147337 | 3300026035 | Bacteria | 2049 |
| 339 | Ga0207639_10023555 | 3300026041 | Bacteria | 4446 |
| 340 | Ga0207639_10263378 | 3300026041 | Bacteria | 1509 |
| 341 | Ga0207639_10538913 | 3300026041 | Bacteria | 1070 |
| 342 | Ga0207678_10028564 | 3300026067 | Bacteria | 4868 |
| 343 | Ga0207678_10311129 | 3300026067 | Bacteria | 1354 |
| 344 | Ga0207678_10582836 | 3300026067 | Bacteria | 980 |
| 345 | Ga0207708_10002098 | 3300026075 | Bacteria | 14671 |
| 346 | Ga0207708_10830621 | 3300026075 | Bacteria | 797 |
| 347 | Ga0207702_10114467 | 3300026078 | Bacteria | 2404 |
| 348 | Ga0207702_10119257 | 3300026078 | Bacteria | 2359 |
| 349 | Ga0207641_10210699 | 3300026088 | Bacteria | 1797 |
| 350 | Ga0207648_10004699 | 3300026089 | Bacteria | 13964 |
| 351 | Ga0207648_10085705 | 3300026089 | Bacteria | 2748 |
| 352 | Ga0207676_10006485 | 3300026095 | Bacteria | 8265 |
| 353 | Ga0207676_11437041 | 3300026095 | Bacteria | 686 |
| 354 | Ga0207674_10009568 | 3300026116 | Bacteria | 11059 |
| 355 | Ga0207675_100031234 | 3300026118 | Bacteria | 4961 |
| 356 | Ga0207675_100423152 | 3300026118 | Bacteria | 1316 |
| 357 | Ga0207683_10000979 | 3300026121 | Bacteria | 26185 |
| 358 | Ga0207683_10269810 | 3300026121 | Bacteria | 1554 |
| 359 | Ga0207683_10521694 | 3300026121 | Bacteria | 1098 |
| 360 | Ga0209179_1035642 | 3300027512 | Bacteria | 1034 |
| 361 | Ga0209588_1026172 | 3300027671 | Bacteria | 1850 |
| 362 | Ga0207428_10023410 | 3300027907 | Bacteria | 5194 |
| 363 | Ga0207428_10104950 | 3300027907 | Bacteria | 2180 |
| 364 | Ga0268265_10114982 | 3300028380 | Bacteria | 2204 |
| 365 | Ga0268265_11099290 | 3300028380 | Bacteria | 789 |
| 366 | Ga0268264_10509037 | 3300028381 | Bacteria | 1175 |
| 367 | Ga0268264_11524949 | 3300028381 | Bacteria | 679 |
| 368 | Ga0265324_10052386 | 3300029957 | Bacteria | 1402 |
| 369 | Ga0265332_10017008 | 3300031238 | Bacteria | 3208 |
| 370 | Ga0265325_10095672 | 3300031241 | Bacteria | 1459 |
| 371 | Ga0265340_10011593 | 3300031247 | Bacteria | 4680 |
| 372 | Ga0265340_10026015 | 3300031247 | Bacteria | 2961 |
| 373 | Ga0265340_10047664 | 3300031247 | Bacteria | 2086 |
| 374 | Ga0265340_10237550 | 3300031247 | Bacteria | 814 |
| 375 | Ga0265340_10387648 | 3300031247 | Bacteria | 616 |
| 376 | Ga0265339_10001375 | 3300031249 | Bacteria | 18163 |
| 377 | Ga0265331_10053640 | 3300031250 | Bacteria | 1922 |
| 378 | Ga0265316_10070448 | 3300031344 | Bacteria | 2697 |
| 379 | Ga0265342_10000569 | 3300031712 | Bacteria | 38956 |
| 380 | Ga0307415_100656512 | 3300032126 | Bacteria | 941 |
| 381 | Ga0373948_0041482 | 3300034817 | Bacteria | 964 |
| 382 | Ga0373958_0040803 | 3300034819 | Bacteria | 948 |
| 383 | Ga0373926_0059622 | 3300035083 | Bacteria | 1389 |
| 384 | Ga0373926_0281402 | 3300035083 | Bacteria | 648 |
| 385 | Ga0373928_0040031 | 3300035084 | Bacteria | 1073 |
| 386 | Ga0373949_0016924 | 3300035090 | Bacteria | 1639 |
| 387 | Ga0373923_0003583 | 3300035111 | Bacteria | 5002 |
| 388 | Ga0373932_0165899 | 3300035112 | Bacteria | 767 |
| 389 | Ga0373936_0004843 | 3300035113 | Bacteria | 5076 |
| 390 | Ga0373936_0087025 | 3300035113 | Bacteria | 1306 |
| 391 | Ga0373941_0097299 | 3300035115 | Bacteria | 1019 |
| 392 | Ga0373945_0043778 | 3300035116 | Bacteria | 1625 |
| 393 | Ga0373953_0007533 | 3300035117 | Bacteria | 3651 |
| 394 | Ga0373954_0001419 | 3300035118 | Bacteria | 9708 |
| 395 | Ga0373943_0006089 | 3300035170 | Bacteria | 5421 |
| 396 | Ga0373943_0033990 | 3300035170 | Bacteria | 2431 |
| 397 | Ga0373946_0001531 | 3300035171 | Bacteria | 8036 |
| 398 | Ga0373955_0002037 | 3300035172 | Bacteria | 8698 |
| 399 | Ga0373962_0152550 | 3300035242 | Bacteria | 757 |
| 400 | Ga0373924_0218599 | 3300035410 | Bacteria | 842 |
| 401 | Ga0373931_0020363 | 3300035691 | Bacteria | 3319 |
| 402 | Ga0373931_0022068 | 3300035691 | Bacteria | 3200 |
| 403 | Ga0373935_0000246 | 3300035692 | Bacteria | 26648 |
| 404 | Ga0373935_0274965 | 3300035692 | Bacteria | 1184 |
| 405 | Ga0373927_0002984 | 3300035695 | Bacteria | 12270 |
| 406 | Ga0373927_0005061 | 3300035695 | Bacteria | 9123 |
| 407 | Ga0373933_0030710 | 3300035724 | Bacteria | 3112 |
| 408 | Ga0373947_0000544 | 3300035725 | Bacteria | 22066 |
| 409 | Ga0373947_0027120 | 3300035725 | Bacteria | 3351 |
| 410 | Ga0373947_0048826 | 3300035725 | Bacteria | 2540 |
| 411 | Ga0373947_0261468 | 3300035725 | Bacteria | 1147 |
| 412 | Ga0373937_0000003 | 3300036401 | Bacteria | 235408 |
| 413 | Ga0373937_0569510 | 3300036401 | Bacteria | 1076 |
| 414 | Ga0373937_1324936 | 3300036401 | Bacteria | 668 |
| 415 | Ga0373937_1514696 | 3300036401 | Bacteria | 618 |
| 416 | Ga0373925_0000052 | 3300037068 | Bacteria | 127490 |
| 417 | Ga0373925_0003941 | 3300037068 | Bacteria | 11329 |
| 418 | Ga0373925_0395884 | 3300037068 | Bacteria | 1126 |
| 419 | Ga0436364_0004209 | 3300037853 | Bacteria | 23852 |
| 420 | Ga0436364_0116971 | 3300037853 | Bacteria | 1264 |
| 421 | Ga0436364_0118407 | 3300037853 | Bacteria | 937 |
| 422 | Ga0436364_0405847 | 3300037853 | Bacteria | 822 |
| 423 | Ga0436365_0468207 | 3300039437 | Bacteria | 2344 |
| 424 | Ga0436365_0689847 | 3300039437 | Bacteria | 6260 |
| 425 | Ga0436365_0809682 | 3300039437 | Bacteria | 5542 |
| 426 | Ga0436361_0271802 | 3300039447 | Bacteria | 1064 |
| 427 | Ga0436361_0630759 | 3300039447 | Unclassified | 1160 |
| 428 | Ga0436363_0193075 | 3300039450 | Bacteria | 1017 |
| 429 | Ga0436363_0403809 | 3300039450 | Bacteria | 835 |
| 430 | Ga0436363_0673064 | 3300039450 | Bacteria | 863 |
| 431 | Ga0436362_1121268 | 3300039453 | Bacteria | 580 |
| 432 | Ga0451793_0244858 | 3300041452 | Bacteria | 750 |
| 433 | Ga0451800_1057318 | 3300041459 | Bacteria | 554 |
| 434 | Ga0451839_0664336 | 3300041496 | Bacteria | 851 |
| 435 | Ga0451851_0321573 | 3300041507 | Bacteria | 1091 |
| 436 | Ga0439441_011431 | 3300042001 | Bacteria | 1506 |
| 437 | Ga0439443_010605 | 3300042003 | Bacteria | 1337 |
| 438 | Ga0439446_0136507 | 3300042156 | Bacteria | 799 |
| 439 | Ga0439458_0075062 | 3300042157 | Bacteria | 858 |
| 440 | Ga0439435_0033938 | 3300042436 | Bacteria | 1400 |
| 441 | Ga0439464_0050080 | 3300042439 | Bacteria | 1206 |
| 442 | Ga0439440_0013346 | 3300042993 | Bacteria | 1760 |
| 443 | Ga0453683_0032891 | 3300044673 | Unclassified | 3270 |
| 444 | Ga0466966_0500830 | 3300044684 | Bacteria | 731 |
| 445 | Ga0453684_0032386 | 3300044712 | Bacteria | 7317 |
| 446 | Ga0451576_0242482 | 3300045051 | Unclassified | 1883 |
| 447 | Ga0495627_143028 | 3300046453 | Bacteria | 670 |
| 448 | Ga0495592_0000331 | 3300046454 | Bacteria | 39293 |
| 449 | Ga0495629_0023386 | 3300046459 | Bacteria | 4404 |
| 450 | Ga0495629_0502569 | 3300046459 | Bacteria | 817 |
| 451 | Ga0495638_0009575 | 3300046460 | Bacteria | 6786 |
| 452 | Ga0495641_0030923 | 3300046461 | Bacteria | 2562 |
| 453 | Ga0495641_0200544 | 3300046461 | Bacteria | 894 |
| 454 | Ga0495651_0000733 | 3300046462 | Bacteria | 25349 |
| 455 | Ga0495653_0000071 | 3300046463 | Bacteria | 86572 |
| 456 | Ga0495580_0122525 | 3300046472 | Bacteria | 1805 |
| 457 | Ga0495582_0027755 | 3300046473 | Bacteria | 3104 |
| 458 | Ga0495582_0039798 | 3300046473 | Bacteria | 2588 |
| 459 | Ga0495582_0041190 | 3300046473 | Bacteria | 2545 |
| 460 | Ga0495662_0062909 | 3300046476 | Bacteria | 1793 |
| 461 | Ga0495664_0000162 | 3300046477 | Bacteria | 32874 |
| 462 | Ga0495584_0083951 | 3300046491 | Bacteria | 1604 |
| 463 | Ga0495594_0023885 | 3300046499 | Bacteria | 3279 |
| 464 | Ga0495596_0202334 | 3300046500 | Bacteria | 772 |
| 465 | Ga0495608_0000239 | 3300046511 | Bacteria | 39851 |
| 466 | Ga0495618_0000022 | 3300046514 | Bacteria | 127582 |
| 467 | Ga0495620_0101143 | 3300046515 | Bacteria | 1149 |
| 468 | Ga0495620_0251545 | 3300046515 | Bacteria | 674 |
| 469 | Ga0495628_0000011 | 3300046516 | Bacteria | 225267 |
| 470 | Ga0495628_0665438 | 3300046516 | Bacteria | 738 |
| 471 | Ga0495630_0005679 | 3300046517 | Bacteria | 8818 |
| 472 | Ga0495630_0623853 | 3300046517 | Bacteria | 826 |
| 473 | Ga0495637_0057238 | 3300046520 | Bacteria | 1611 |
| 474 | Ga0495644_0044757 | 3300046523 | Bacteria | 1665 |
| 475 | Ga0495666_0182560 | 3300046526 | Bacteria | 968 |
| 476 | Ga0495652_0000014 | 3300046529 | Bacteria | 225484 |
| 477 | Ga0495665_0049113 | 3300046531 | Bacteria | 2237 |
| 478 | Ga0495665_0067289 | 3300046531 | Bacteria | 1890 |
| 479 | Ga0495640_0000008 | 3300046533 | Bacteria | 220320 |
| 480 | Ga0495640_0220164 | 3300046533 | Bacteria | 1197 |
| 481 | Ga0495586_0479588 | 3300046535 | Bacteria | 717 |
| 482 | Ga0495587_0000347 | 3300046536 | Bacteria | 33002 |
| 483 | Ga0495598_0010690 | 3300046537 | Bacteria | 2205 |
| 484 | Ga0495598_0032441 | 3300046537 | Bacteria | 1476 |
| 485 | Ga0495609_0263836 | 3300046538 | Bacteria | 707 |
| 486 | Ga0495609_0320555 | 3300046538 | Bacteria | 629 |
| 487 | Ga0495621_0013947 | 3300046539 | Bacteria | 2536 |
| 488 | Ga0495597_0200804 | 3300046542 | Bacteria | 799 |
| 489 | Ga0495645_0000007 | 3300046543 | Bacteria | 376299 |
| 490 | Ga0495622_0123314 | 3300046557 | Bacteria | 1182 |
| 491 | Ga0495667_0000013 | 3300046559 | Bacteria | 220294 |
| 492 | Ga0495656_0008675 | 3300046615 | Bacteria | 3637 |
| 493 | Ga0495656_0081504 | 3300046615 | Bacteria | 1461 |
| 494 | Ga0495668_0289082 | 3300046616 | Bacteria | 898 |
| 495 | Ga0495668_0346201 | 3300046616 | Bacteria | 816 |
| 496 | Ga0495634_0031786 | 3300046642 | Bacteria | 3633 |
| 497 | Ga0495635_0000012 | 3300046663 | Bacteria | 225271 |
| 498 | Ga0495635_0789819 | 3300046663 | Bacteria | 612 |
| 499 | Ga0495661_0073697 | 3300046665 | Bacteria | 1989 |
| 500 | Ga0495657_0001891 | 3300046675 | Bacteria | 17797 |
| 501 | Ga0495599_0000008 | 3300046678 | Bacteria | 225534 |
| 502 | Ga0495623_0000500 | 3300046679 | Bacteria | 25998 |
| 503 | Ga0495646_0000004 | 3300046680 | Bacteria | 268993 |
| 504 | Ga0495646_0377026 | 3300046680 | Bacteria | 740 |
| 505 | Ga0495647_0161672 | 3300046681 | Bacteria | 965 |
| 506 | Ga0495658_0031639 | 3300046683 | Bacteria | 2883 |
| 507 | Ga0495658_0043791 | 3300046683 | Bacteria | 2505 |
| 508 | Ga0495658_0209188 | 3300046683 | Bacteria | 1218 |
| 509 | Ga0495669_0023183 | 3300046684 | Bacteria | 2701 |
| 510 | Ga0495613_0081027 | 3300046689 | Bacteria | 2359 |
| 511 | Ga0495613_0085869 | 3300046689 | Bacteria | 2283 |
| 512 | Ga0495624_0069895 | 3300046690 | Bacteria | 2186 |
| 513 | Ga0495624_0238601 | 3300046690 | Bacteria | 1100 |
| 514 | Ga0495671_0194710 | 3300046692 | Bacteria | 984 |
| 515 | Ga0495600_0000084 | 3300046809 | Bacteria | 51484 |
| 516 | Ga0495600_0548270 | 3300046809 | Bacteria | 707 |
| 517 | Ga0495581_0025182 | 3300047315 | Bacteria | 3451 |
| 518 | Ga0495581_0122397 | 3300047315 | Bacteria | 1514 |
| 519 | Ga0495604_0000001 | 3300047317 | Bacteria | 708627 |
| 520 | Ga0495674_0000630 | 3300047319 | Bacteria | 33002 |
| 521 | Ga0495674_0579336 | 3300047319 | Bacteria | 891 |
| 522 | Ga0495676_0049040 | 3300047321 | Bacteria | 3399 |
| 523 | Ga0495676_0301643 | 3300047321 | Bacteria | 1080 |
| 524 | Ga0495680_0017175 | 3300047322 | Bacteria | 6189 |
| 525 | Ga0495680_0615488 | 3300047322 | Bacteria | 725 |
| 526 | Ga0495675_0000023 | 3300047444 | Bacteria | 111081 |
| 527 | Ga0495677_0075465 | 3300047445 | Bacteria | 1260 |
| 528 | Ga0495685_025593 | 3300047447 | Bacteria | 2030 |
| 529 | Ga0495681_0242473 | 3300047470 | Bacteria | 715 |
| 530 | Ga0495684_0000007 | 3300047471 | Bacteria | 225614 |
| 531 | Ga0495593_0000918 | 3300047673 | Bacteria | 17120 |
| 532 | Ga0495602_0000431 | 3300048088 | Bacteria | 39378 |
| 533 | Ga0495615_0175302 | 3300048090 | Bacteria | 651 |
| 534 | Ga0496100_0014276 | 3300048903 | Bacteria | 4608 |
| 535 | Ga0496100_0018049 | 3300048903 | Bacteria | 4177 |
| 536 | Ga0496100_0532473 | 3300048903 | Bacteria | 907 |
| 537 | Ga0496101_0017659 | 3300048904 | Bacteria | 4839 |
| 538 | Ga0496102_0038172 | 3300048905 | Bacteria | 4333 |
| 539 | Ga0496102_0610812 | 3300048905 | Bacteria | 1013 |
| 540 | Ga0496102_0995825 | 3300048905 | Bacteria | 759 |
| 541 | Ga0496103_0001924 | 3300048906 | Bacteria | 13472 |
| 542 | Ga0496103_0006632 | 3300048906 | Bacteria | 6906 |
| 543 | Ga0496104_0002823 | 3300048907 | Bacteria | 14978 |
| 544 | Ga0496104_0004892 | 3300048907 | Bacteria | 11682 |
| 545 | Ga0496104_0030628 | 3300048907 | Bacteria | 5000 |
| 546 | Ga0496104_0436909 | 3300048907 | Bacteria | 1220 |
| 547 | Ga0496104_0523074 | 3300048907 | Bacteria | 1097 |
| 548 | Ga0496105_0001515 | 3300048908 | Bacteria | 16423 |
| 549 | Ga0496105_0004141 | 3300048908 | Bacteria | 10879 |
| 550 | Ga0496105_0012805 | 3300048908 | Bacteria | 6647 |
| 551 | Ga0496105_0021610 | 3300048908 | Bacteria | 5209 |
| 552 | Ga0496106_0002907 | 3300048909 | Bacteria | 12741 |
| 553 | Ga0496106_0052534 | 3300048909 | Bacteria | 3075 |
| 554 | Ga0496106_0479847 | 3300048909 | Bacteria | 999 |
| 555 | Ga0496106_0514473 | 3300048909 | Bacteria | 961 |
| 556 | Ga0496106_0631586 | 3300048909 | Bacteria | 856 |
| 557 | Ga0496107_0007785 | 3300048910 | Bacteria | 7399 |
| 558 | Ga0496107_0486574 | 3300048910 | Bacteria | 915 |
| 559 | Ga0496108_0001028 | 3300048911 | Bacteria | 21742 |
| 560 | Ga0496108_0207454 | 3300048911 | Bacteria | 1700 |
| 561 | Ga0496108_0226988 | 3300048911 | Bacteria | 1623 |
| 562 | Ga0496108_0335084 | 3300048911 | Bacteria | 1319 |
| 563 | Ga0496109_0002430 | 3300048912 | Bacteria | 15588 |
| 564 | Ga0496109_0073398 | 3300048912 | Bacteria | 3144 |
| 565 | Ga0496109_0176992 | 3300048912 | Bacteria | 2003 |
| 566 | Ga0496109_0601199 | 3300048912 | Bacteria | 1036 |
| 567 | Ga0496109_0789560 | 3300048912 | Bacteria | 887 |
| 568 | Ga0496110_0001894 | 3300048913 | Bacteria | 15456 |
| 569 | Ga0496110_0050256 | 3300048913 | Bacteria | 3660 |
| 570 | Ga0496110_0140044 | 3300048913 | Bacteria | 2187 |
| 571 | Ga0496110_0294605 | 3300048913 | Bacteria | 1478 |
| 572 | Ga0496110_0446085 | 3300048913 | Bacteria | 1179 |
| 573 | Ga0496110_0716377 | 3300048913 | Bacteria | 903 |
| 574 | Ga0496111_0000436 | 3300048914 | Bacteria | 21122 |
| 575 | Ga0496111_0002610 | 3300048914 | Bacteria | 10913 |
| 576 | Ga0496112_0004518 | 3300048915 | Bacteria | 11815 |
| 577 | Ga0496112_0064887 | 3300048915 | Bacteria | 3603 |
| 578 | Ga0496113_0001213 | 3300048916 | Bacteria | 14132 |
| 579 | Ga0496113_0019583 | 3300048916 | Bacteria | 4737 |
| 580 | Ga0496113_0105520 | 3300048916 | Bacteria | 2188 |
| 581 | Ga0496114_0184587 | 3300048917 | Bacteria | 1822 |
| 582 | Ga0496114_0486369 | 3300048917 | Bacteria | 1092 |
| 583 | Ga0496114_0871073 | 3300048917 | Bacteria | 781 |
| 584 | Ga0496115_0015654 | 3300048918 | Bacteria | 5757 |
| 585 | Ga0496115_0052838 | 3300048918 | Bacteria | 3260 |
| 586 | Ga0496115_0114013 | 3300048918 | Bacteria | 2221 |
| 587 | Ga0496115_0143695 | 3300048918 | Bacteria | 1968 |
| 588 | Ga0496115_0639172 | 3300048918 | Bacteria | 842 |
| 589 | Ga0501033_0702228 | 3300049570 | Bacteria | 688 |
| 590 | Ga0501034_0765268 | 3300049571 | Bacteria | 860 |
| 591 | Ga0501036_0034152 | 3300049572 | Bacteria | 4302 |
| 592 | Ga0501038_0047665 | 3300049574 | Bacteria | 3711 |
| 593 | Ga0501040_0768246 | 3300049576 | Bacteria | 697 |
| 594 | Ga0501041_0013550 | 3300049577 | Bacteria | 4836 |
| 595 | Ga0501042_0067240 | 3300049578 | Bacteria | 2562 |
| 596 | Ga0501042_0286130 | 3300049578 | Bacteria | 1191 |
| 597 | Ga0501042_1072346 | 3300049578 | Unclassified | 587 |
| 598 | Ga0501043_0413343 | 3300049579 | Bacteria | 1018 |
| 599 | Ga0501043_0950898 | 3300049579 | Bacteria | 614 |
| 600 | Ga0501068_0231429 | 3300049584 | Bacteria | 1175 |
| 601 | Ga0501071_0025028 | 3300049587 | Bacteria | 4179 |
| 602 | Ga0501071_0416714 | 3300049587 | Bacteria | 1026 |
| 603 | Ga0501072_0239009 | 3300049588 | Bacteria | 1446 |
| 604 | Ga0501073_0500409 | 3300049589 | Bacteria | 840 |
| 605 | Ga0501075_0024462 | 3300049591 | Bacteria | 4429 |
| 606 | Ga0501075_0908199 | 3300049591 | Bacteria | 669 |
| 607 | Ga0501076_0024554 | 3300049592 | Bacteria | 4660 |
| 608 | Ga0501077_0111939 | 3300049593 | Bacteria | 1730 |
| 609 | Ga0501077_0331537 | 3300049593 | Bacteria | 970 |
| 610 | Ga0501079_0002446 | 3300049741 | Bacteria | 13489 |
| 611 | Ga0501079_0178249 | 3300049741 | Bacteria | 1658 |
| 612 | Ga0501080_0009475 | 3300049742 | Bacteria | 8882 |
| 613 | Ga0501080_1332763 | 3300049742 | Bacteria | 614 |
| 614 | Ga0501081_0001816 | 3300049743 | Bacteria | 13222 |
| 615 | Ga0501081_0085666 | 3300049743 | Bacteria | 2212 |
| 616 | Ga0501081_0737708 | 3300049743 | Bacteria | 740 |
| 617 | Ga0501083_0047883 | 3300049744 | Bacteria | 2887 |
| 618 | Ga0501083_0115146 | 3300049744 | Bacteria | 1765 |
| 619 | Ga0501283_053885 | 3300049779 | Bacteria | 717 |
| 620 | Ga0501035_0091216 | 3300049822 | Bacteria | 2682 |
| 621 | Ga0501045_0059448 | 3300049824 | Bacteria | 2800 |
| 622 | Ga0501045_0644964 | 3300049824 | Bacteria | 783 |
| 623 | Ga0501045_0896502 | 3300049824 | Bacteria | 652 |
| 624 | nmdc:mga03683_70372_c1 | 3300050489 | Bacteria | 1495 |
| 625 | nmdc:mga03n38_403599_c1 | 3300050490 | Bacteria | 753 |
| 626 | nmdc:mga00v17_61181_c1 | 3300050491 | Bacteria | 2314 |
| 627 | nmdc:mga0yw44_103484_c1 | 3300050492 | Bacteria | 1816 |
| 628 | nmdc:mga0yw44_20097_c1 | 3300050492 | Bacteria | 3700 |
| 629 | nmdc:mga0yw44_47560_c1 | 3300050492 | Bacteria | 2583 |
| 630 | nmdc:mga0yw44_82900_c1 | 3300050492 | Bacteria | 2013 |
| 631 | nmdc:mga0k408_560383_c1 | 3300050493 | Bacteria | 675 |
| 632 | nmdc:mga0k408_7910_c1 | 3300050493 | Bacteria | 5693 |
| 633 | nmdc:mga06z11_180503_c1 | 3300050494 | Bacteria | 1217 |
| 634 | nmdc:mga06z11_48917_c1 | 3300050494 | Bacteria | 2154 |
| 635 | nmdc:mga04h51_220919_c1 | 3300050495 | Bacteria | 751 |
| 636 | nmdc:mga07m45_295972_c1 | 3300050496 | Bacteria | 941 |
| 637 | nmdc:mga05p37_114859_c1 | 3300050507 | Bacteria | 3309 |
| 638 | nmdc:mga05p37_11760_c1 | 3300050507 | Bacteria | 10433 |
| 639 | nmdc:mga05p37_1336385_c1 | 3300050507 | Bacteria | 727 |
| 640 | nmdc:mga05p37_68011_c1 | 3300050507 | Bacteria | 4381 |
| 641 | nmdc:mga05p37_950322_c1 | 3300050507 | Bacteria | 920 |
| 642 | nmdc:mga09592_125686_c1 | 3300050508 | Bacteria | 2204 |
| 643 | nmdc:mga09592_74608_c1 | 3300050508 | Bacteria | 2882 |
| 644 | nmdc:mga09592_94047_c1 | 3300050508 | Bacteria | 2563 |
| 645 | nmdc:mga0qj67_1081226_c1 | 3300050509 | Bacteria | 627 |
| 646 | nmdc:mga0qj67_134075_c1 | 3300050509 | Bacteria | 2006 |
| 647 | nmdc:mga0qj67_144_c1 | 3300050509 | Bacteria | 48167 |
| 648 | nmdc:mga0qj67_625769_c1 | 3300050509 | Bacteria | 860 |
| 649 | nmdc:mga0qj67_657404_c1 | 3300050509 | Bacteria | 836 |
| 650 | nmdc:mga06r32_37645_c1 | 3300050510 | Bacteria | 4576 |
| 651 | nmdc:mga06r32_410386_c1 | 3300050510 | Bacteria | 1336 |
| 652 | nmdc:mga06r32_575295_c1 | 3300050510 | Bacteria | 1099 |
| 653 | nmdc:mga06r32_593371_c1 | 3300050510 | Bacteria | 1079 |
| 654 | nmdc:mga08y16_1501240_c1 | 3300050511 | Bacteria | 634 |
| 655 | nmdc:mga08y16_293814_c1 | 3300050511 | Bacteria | 1675 |
| 656 | nmdc:mga08y16_31336_c1 | 3300050511 | Bacteria | 3026 |
| 657 | nmdc:mga08y16_31728_c1 | 3300050511 | Bacteria | 5555 |
| 658 | nmdc:mga0n895_17990_c1 | 3300050512 | Bacteria | 6531 |
| 659 | nmdc:mga0n895_4803_c1 | 3300050512 | Bacteria | 11185 |
| 660 | nmdc:mga0rr50_235935_c1 | 3300050513 | Bacteria | 1515 |
| 661 | nmdc:mga08x19_21_c1 | 3300050514 | Bacteria | 302369 |
| 662 | nmdc:mga08x19_277959_c1 | 3300050514 | Unclassified | 1160 |
| 663 | Ga0495601_0000014 | 3300053077 | Bacteria | 220318 |
| 664 | Ga0495612_0000123 | 3300053078 | Bacteria | 32874 |
| 665 | Ga0500610_0328149 | 3300053079 | Bacteria | 660 |
| 666 | Ga0495655_0011770 | 3300053083 | Bacteria | 1766 |
| 667 | Ga0495655_0113560 | 3300053083 | Bacteria | 817 |
| 668 | Ga0495595_0000169 | 3300053084 | Bacteria | 25717 |
| 669 | Ga0495619_0000006 | 3300053085 | Bacteria | 384835 |
| 670 | Ga0495619_0058304 | 3300053085 | Bacteria | 2563 |
| 671 | Ga0495619_0185834 | 3300053085 | Bacteria | 1438 |
| 672 | Ga0500651_0183707 | 3300053093 | Bacteria | 1241 |
| 673 | Ga0500641_0053745 | 3300053096 | Bacteria | 1663 |
| 674 | Ga0500641_0154990 | 3300053096 | Bacteria | 988 |
| 675 | Ga0500658_0014176 | 3300053134 | Bacteria | 2949 |
| 676 | Ga0500616_0003041 | 3300053153 | Bacteria | 13199 |
| 677 | Ga0500622_0006576 | 3300053156 | Bacteria | 6712 |
| 678 | Ga0500636_0198665 | 3300053177 | Bacteria | 1063 |
| 679 | Ga0500645_111678 | 3300053730 | Bacteria | 767 |
| 680 | Ga0501084_0047966 | 3300054114 | Bacteria | 3577 |
| 681 | Ga0501082_0005078 | 3300060353 | Bacteria | 11472 |
| 682 | Ga0501082_0082291 | 3300060353 | Bacteria | 2778 |
| 683 | Ga0501082_0348961 | 3300060353 | Bacteria | 1290 |
| 684 | Ga0530510_0092508 | 3300061734 | Bacteria | 2207 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006042 | Ga0075368_10080575 | Ga0075368_100805752 | 160 |
| 2 | 3300006353 | Ga0075370_10026736 | Ga0075370_100267363 | 160 |
| 3 | 3300009553 | Ga0105249_10882682 | Ga0105249_108826821 | 160 |
| 4 | 3300028380 | Ga0268265_11099290 | Ga0268265_110992901 | 160 |
| 5 | 3300050494 | nmdc:mga06z11_180503_c1 | nmdc:mga06z11_180503_c1_35_562 | 160 |
| 6 | 3300050495 | nmdc:mga04h51_220919_c1 | nmdc:mga04h51_220919_c1_35_562 | 160 |
| 7 | 3300025913 | Ga0207695_10870733 | Ga0207695_108707332 | 161 |
| 8 | 3300026121 | Ga0207683_10521694 | Ga0207683_105216942 | 162 |
| 9 | 3300032126 | Ga0307415_100656512 | Ga0307415_1006565122 | 162 |
| 10 | 3300049572 | Ga0501036_0034152 | Ga0501036_0034152_1886_2380 | 162 |
| 11 | 3300049574 | Ga0501038_0047665 | Ga0501038_0047665_194_688 | 162 |
| 12 | 3300049576 | Ga0501040_0768246 | Ga0501040_0768246_98_592 | 162 |
| 13 | 3300049577 | Ga0501041_0013550 | Ga0501041_0013550_1389_1883 | 162 |
| 14 | 3300049578 | Ga0501042_0067240 | Ga0501042_0067240_11_505 | 162 |
| 15 | 3300049578 | Ga0501042_1072346 | Ga0501042_1072346_79_573 | 162 |
| 16 | 3300049579 | Ga0501043_0413343 | Ga0501043_0413343_150_644 | 162 |
| 17 | 3300049587 | Ga0501071_0025028 | Ga0501071_0025028_324_818 | 162 |
| 18 | 3300049591 | Ga0501075_0024462 | Ga0501075_0024462_3523_4017 | 162 |
| 19 | 3300049592 | Ga0501076_0024554 | Ga0501076_0024554_1526_2020 | 162 |
| 20 | 3300049593 | Ga0501077_0111939 | Ga0501077_0111939_96_590 | 162 |
| 21 | 3300049741 | Ga0501079_0002446 | Ga0501079_0002446_6587_7081 | 162 |
| 22 | 3300049742 | Ga0501080_0009475 | Ga0501080_0009475_954_1448 | 162 |
| 23 | 3300049743 | Ga0501081_0001816 | Ga0501081_0001816_5080_5574 | 162 |
| 24 | 3300049743 | Ga0501081_0085666 | Ga0501081_0085666_918_1412 | 162 |
| 25 | 3300049779 | Ga0501283_053885 | Ga0501283_053885_13_516 | 162 |
| 26 | 3300049822 | Ga0501035_0091216 | Ga0501035_0091216_30_524 | 162 |
| 27 | 3300049824 | Ga0501045_0059448 | Ga0501045_0059448_1917_2411 | 162 |
| 28 | 3300054114 | Ga0501084_0047966 | Ga0501084_0047966_2996_3490 | 162 |
| 29 | 3300060353 | Ga0501082_0005078 | Ga0501082_0005078_3400_3894 | 162 |
| 30 | 3300005547 | Ga0070693_100617792 | Ga0070693_1006177921 | 164 |
| 31 | 3300005614 | Ga0068856_100148988 | Ga0068856_1001489882 | 164 |
| 32 | 3300013100 | Ga0157373_10076208 | Ga0157373_100762082 | 164 |
| 33 | 3300013307 | Ga0157372_10024327 | Ga0157372_100243272 | 164 |
| 34 | 3300026078 | Ga0207702_10119257 | Ga0207702_101192572 | 164 |
| 35 | 3300034817 | Ga0373948_0041482 | Ga0373948_0041482_397_897 | 164 |
| 36 | 3300005471 | Ga0070698_100205702 | Ga0070698_1002057022 | 166 |
| 37 | 3300048916 | Ga0496113_0105520 | Ga0496113_0105520_1286_1789 | 166 |
| 38 | 3300049742 | Ga0501080_1332763 | Ga0501080_1332763_84_584 | 166 |
| 39 | 3300049743 | Ga0501081_0737708 | Ga0501081_0737708_55_555 | 166 |
| 40 | 3300053153 | Ga0500616_0003041 | Ga0500616_0003041_11413_11922 | 166 |
| 41 | 3300005343 | Ga0070687_100423051 | Ga0070687_1004230511 | 167 |
| 42 | 3300005436 | Ga0070713_100721208 | Ga0070713_1007212081 | 167 |
| 43 | 3300005438 | Ga0070701_10023853 | Ga0070701_100238534 | 167 |
| 44 | 3300005440 | Ga0070705_100321457 | Ga0070705_1003214572 | 167 |
| 45 | 3300005617 | Ga0068859_100069488 | Ga0068859_1000694883 | 167 |
| 46 | 3300005842 | Ga0068858_100098733 | Ga0068858_1000987333 | 167 |
| 47 | 3300006931 | Ga0097620_100069489 | Ga0097620_1000694893 | 167 |
| 48 | 3300009148 | Ga0105243_10120358 | Ga0105243_101203582 | 167 |
| 49 | 3300025918 | Ga0207662_10219512 | Ga0207662_102195122 | 167 |
| 50 | 3300029957 | Ga0265324_10052386 | Ga0265324_100523862 | 167 |
| 51 | 3300031247 | Ga0265340_10387648 | Ga0265340_103876482 | 167 |
| 52 | 3300046680 | Ga0495646_0377026 | Ga0495646_0377026_36_563 | 167 |
| 53 | 3300049587 | Ga0501071_0416714 | Ga0501071_0416714_206_709 | 167 |
| 54 | 3300031344 | Ga0265316_10070448 | Ga0265316_100704483 | 168 |
| 55 | 3300044673 | Ga0453683_0032891 | Ga0453683_0032891_238_753 | 168 |
| 56 | 3300044712 | Ga0453684_0032386 | Ga0453684_0032386_5093_5608 | 168 |
| 57 | 3300045051 | Ga0451576_0242482 | Ga0451576_0242482_511_1026 | 168 |
| 58 | 3300005985 | Ga0081539_10014262 | Ga0081539_100142622 | 169 |
| 59 | 3300009094 | Ga0111539_11321080 | Ga0111539_113210802 | 169 |
| 60 | 3300050511 | nmdc:mga08y16_1501240_c1 | nmdc:mga08y16_1501240_c1_34_552 | 169 |
| 61 | 3300005353 | Ga0070669_100481419 | Ga0070669_1004814192 | 170 |
| 62 | 3300005456 | Ga0070678_100569279 | Ga0070678_1005692791 | 170 |
| 63 | 3300005549 | Ga0070704_101264767 | Ga0070704_1012647671 | 170 |
| 64 | 3300006846 | Ga0075430_100677643 | Ga0075430_1006776432 | 170 |
| 65 | 3300006847 | Ga0075431_100112076 | Ga0075431_1001120762 | 170 |
| 66 | 3300006847 | Ga0075431_101211004 | Ga0075431_1012110041 | 170 |
| 67 | 3300009094 | Ga0111539_10211335 | Ga0111539_102113352 | 170 |
| 68 | 3300009147 | Ga0114129_10464518 | Ga0114129_104645182 | 170 |
| 69 | 3300009147 | Ga0114129_12284742 | Ga0114129_122847421 | 170 |
| 70 | 3300025923 | Ga0207681_10581104 | Ga0207681_105811042 | 170 |
| 71 | 3300026121 | Ga0207683_10269810 | Ga0207683_102698102 | 170 |
| 72 | 3300044684 | Ga0466966_0500830 | Ga0466966_0500830_99_614 | 170 |
| 73 | 3300048909 | Ga0496106_0479847 | Ga0496106_0479847_76_588 | 170 |
| 74 | 3300050509 | nmdc:mga0qj67_134075_c1 | nmdc:mga0qj67_134075_c1_58_570 | 170 |
| 75 | 3300050510 | nmdc:mga06r32_575295_c1 | nmdc:mga06r32_575295_c1_554_1066 | 170 |
| 76 | 3300050510 | nmdc:mga06r32_593371_c1 | nmdc:mga06r32_593371_c1_98_610 | 170 |
| 77 | 3300050511 | nmdc:mga08y16_293814_c1 | nmdc:mga08y16_293814_c1_975_1487 | 170 |
| 78 | 3300006846 | Ga0075430_100139470 | Ga0075430_1001394702 | 171 |
| 79 | 3300006880 | Ga0075429_100892749 | Ga0075429_1008927491 | 171 |
| 80 | 3300009147 | Ga0114129_11256463 | Ga0114129_112564632 | 171 |
| 81 | 3300037853 | Ga0436364_0116971 | Ga0436364_0116971_615_1223 | 171 |
| 82 | 3300049824 | Ga0501045_0896502 | Ga0501045_0896502_82_609 | 171 |
| 83 | 3300050507 | nmdc:mga05p37_950322_c1 | nmdc:mga05p37_950322_c1_269_790 | 171 |
| 84 | 3300050508 | nmdc:mga09592_125686_c1 | nmdc:mga09592_125686_c1_1572_2093 | 171 |
| 85 | 3300005459 | Ga0068867_100807287 | Ga0068867_1008072871 | 172 |
| 86 | 3300005546 | Ga0070696_100022673 | Ga0070696_1000226732 | 172 |
| 87 | 3300005549 | Ga0070704_100001844 | Ga0070704_10000184410 | 172 |
| 88 | 3300006048 | Ga0075363_100171698 | Ga0075363_1001716981 | 172 |
| 89 | 3300006175 | Ga0070712_100064607 | Ga0070712_1000646072 | 172 |
| 90 | 3300006195 | Ga0075366_10661938 | Ga0075366_106619381 | 172 |
| 91 | 3300009094 | Ga0111539_12315861 | Ga0111539_123158611 | 172 |
| 92 | 3300009098 | Ga0105245_10478396 | Ga0105245_104783962 | 172 |
| 93 | 3300009148 | Ga0105243_10285292 | Ga0105243_102852922 | 172 |
| 94 | 3300009553 | Ga0105249_10053275 | Ga0105249_100532755 | 172 |
| 95 | 3300010159 | Ga0099796_10038454 | Ga0099796_100384542 | 172 |
| 96 | 3300011119 | Ga0105246_11232165 | Ga0105246_112321651 | 172 |
| 97 | 3300025915 | Ga0207693_10190573 | Ga0207693_101905731 | 172 |
| 98 | 3300025927 | Ga0207687_10330381 | Ga0207687_103303812 | 172 |
| 99 | 3300025935 | Ga0207709_10617326 | Ga0207709_106173262 | 172 |
| 100 | 3300025961 | Ga0207712_10003449 | Ga0207712_100034498 | 172 |
| 101 | 3300025972 | Ga0207668_10847575 | Ga0207668_108475752 | 172 |
| 102 | 3300026095 | Ga0207676_11437041 | Ga0207676_114370411 | 172 |
| 103 | 3300027512 | Ga0209179_1035642 | Ga0209179_10356422 | 172 |
| 104 | 3300027907 | Ga0207428_10104950 | Ga0207428_101049502 | 172 |
| 105 | 3300031247 | Ga0265340_10011593 | Ga0265340_100115932 | 172 |
| 106 | 3300042003 | Ga0439443_010605 | Ga0439443_010605_796_1314 | 172 |
| 107 | 3300042436 | Ga0439435_0033938 | Ga0439435_0033938_846_1364 | 172 |
| 108 | 3300042439 | Ga0439464_0050080 | Ga0439464_0050080_61_579 | 172 |
| 109 | 3300042993 | Ga0439440_0013346 | Ga0439440_0013346_1045_1563 | 172 |
| 110 | 3300048911 | Ga0496108_0226988 | Ga0496108_0226988_950_1468 | 172 |
| 111 | 3300048913 | Ga0496110_0294605 | Ga0496110_0294605_798_1316 | 172 |
| 112 | 3300049571 | Ga0501034_0765268 | Ga0501034_0765268_199_717 | 172 |
| 113 | 3300050493 | nmdc:mga0k408_560383_c1 | nmdc:mga0k408_560383_c1_101_619 | 172 |
| 114 | 3300005330 | Ga0070690_100380331 | Ga0070690_1003803311 | 173 |
| 115 | 3300005336 | Ga0070680_100019906 | Ga0070680_1000199063 | 173 |
| 116 | 3300005339 | Ga0070660_100034493 | Ga0070660_1000344934 | 173 |
| 117 | 3300005340 | Ga0070689_100122565 | Ga0070689_1001225651 | 173 |
| 118 | 3300005344 | Ga0070661_100184432 | Ga0070661_1001844321 | 173 |
| 119 | 3300005355 | Ga0070671_100314078 | Ga0070671_1003140782 | 173 |
| 120 | 3300005367 | Ga0070667_100910209 | Ga0070667_1009102092 | 173 |
| 121 | 3300005457 | Ga0070662_100080077 | Ga0070662_1000800773 | 173 |
| 122 | 3300005536 | Ga0070697_100009157 | Ga0070697_1000091577 | 173 |
| 123 | 3300005545 | Ga0070695_100015964 | Ga0070695_1000159642 | 173 |
| 124 | 3300005564 | Ga0070664_100134650 | Ga0070664_1001346503 | 173 |
| 125 | 3300005614 | Ga0068856_100174392 | Ga0068856_1001743922 | 173 |
| 126 | 3300005617 | Ga0068859_100685491 | Ga0068859_1006854912 | 173 |
| 127 | 3300005981 | Ga0081538_10000146 | Ga0081538_1000014611 | 173 |
| 128 | 3300006914 | Ga0075436_100004215 | Ga0075436_1000042157 | 173 |
| 129 | 3300006931 | Ga0097620_100685443 | Ga0097620_1006854432 | 173 |
| 130 | 3300007076 | Ga0075435_100175400 | Ga0075435_1001754004 | 173 |
| 131 | 3300009093 | Ga0105240_10272542 | Ga0105240_102725423 | 173 |
| 132 | 3300009098 | Ga0105245_10344848 | Ga0105245_103448482 | 173 |
| 133 | 3300009176 | Ga0105242_10244498 | Ga0105242_102444982 | 173 |
| 134 | 3300013102 | Ga0157371_10015546 | Ga0157371_100155464 | 173 |
| 135 | 3300014326 | Ga0157380_10208632 | Ga0157380_102086322 | 173 |
| 136 | 3300024225 | Ga0224572_1044952 | Ga0224572_10449522 | 173 |
| 137 | 3300025901 | Ga0207688_10351940 | Ga0207688_103519401 | 173 |
| 138 | 3300025909 | Ga0207705_10231510 | Ga0207705_102315102 | 173 |
| 139 | 3300025912 | Ga0207707_10009131 | Ga0207707_1000913112 | 173 |
| 140 | 3300025913 | Ga0207695_10700158 | Ga0207695_107001582 | 173 |
| 141 | 3300025917 | Ga0207660_10270496 | Ga0207660_102704962 | 173 |
| 142 | 3300025919 | Ga0207657_10021920 | Ga0207657_100219205 | 173 |
| 143 | 3300025920 | Ga0207649_10145433 | Ga0207649_101454332 | 173 |
| 144 | 3300025927 | Ga0207687_10083433 | Ga0207687_100834333 | 173 |
| 145 | 3300025931 | Ga0207644_10930257 | Ga0207644_109302572 | 173 |
| 146 | 3300025933 | Ga0207706_10059462 | Ga0207706_100594623 | 173 |
| 147 | 3300025945 | Ga0207679_10241223 | Ga0207679_102412232 | 173 |
| 148 | 3300026067 | Ga0207678_10311129 | Ga0207678_103111293 | 173 |
| 149 | 3300026078 | Ga0207702_10114467 | Ga0207702_101144673 | 173 |
| 150 | 3300035112 | Ga0373932_0165899 | Ga0373932_0165899_20_541 | 173 |
| 151 | 3300035113 | Ga0373936_0087025 | Ga0373936_0087025_144_665 | 173 |
| 152 | 3300035725 | Ga0373947_0027120 | Ga0373947_0027120_980_1501 | 173 |
| 153 | 3300046472 | Ga0495580_0122525 | Ga0495580_0122525_643_1164 | 173 |
| 154 | 3300046476 | Ga0495662_0062909 | Ga0495662_0062909_1236_1757 | 173 |
| 155 | 3300046499 | Ga0495594_0023885 | Ga0495594_0023885_1454_1975 | 173 |
| 156 | 3300046538 | Ga0495609_0320555 | Ga0495609_0320555_38_559 | 173 |
| 157 | 3300046683 | Ga0495658_0031639 | Ga0495658_0031639_1153_1674 | 173 |
| 158 | 3300046690 | Ga0495624_0069895 | Ga0495624_0069895_253_774 | 173 |
| 159 | 3300047315 | Ga0495581_0025182 | Ga0495581_0025182_2890_3411 | 173 |
| 160 | 3300047319 | Ga0495674_0579336 | Ga0495674_0579336_143_664 | 173 |
| 161 | 3300050513 | nmdc:mga0rr50_235935_c1 | nmdc:mga0rr50_235935_c1_85_621 | 173 |
| 162 | 3300050514 | nmdc:mga08x19_21_c1 | nmdc:mga08x19_21_c1_135391_135927 | 173 |
| 163 | 3300003203 | JGI25406J46586_10027958 | JGI25406J46586_100279582 | 174 |
| 164 | 3300005290 | Ga0065712_10122210 | Ga0065712_101222101 | 174 |
| 165 | 3300005328 | Ga0070676_10138121 | Ga0070676_101381212 | 174 |
| 166 | 3300005331 | Ga0070670_100053933 | Ga0070670_1000539333 | 174 |
| 167 | 3300005331 | Ga0070670_100411419 | Ga0070670_1004114192 | 174 |
| 168 | 3300005333 | Ga0070677_10043840 | Ga0070677_100438402 | 174 |
| 169 | 3300005336 | Ga0070680_100220691 | Ga0070680_1002206911 | 174 |
| 170 | 3300005338 | Ga0068868_100238478 | Ga0068868_1002384782 | 174 |
| 171 | 3300005343 | Ga0070687_100152993 | Ga0070687_1001529932 | 174 |
| 172 | 3300005344 | Ga0070661_100666805 | Ga0070661_1006668051 | 174 |
| 173 | 3300005354 | Ga0070675_100224860 | Ga0070675_1002248602 | 174 |
| 174 | 3300005355 | Ga0070671_100207907 | Ga0070671_1002079072 | 174 |
| 175 | 3300005356 | Ga0070674_100235344 | Ga0070674_1002353442 | 174 |
| 176 | 3300005364 | Ga0070673_100111922 | Ga0070673_1001119222 | 174 |
| 177 | 3300005367 | Ga0070667_100038285 | Ga0070667_1000382853 | 174 |
| 178 | 3300005367 | Ga0070667_101387234 | Ga0070667_1013872341 | 174 |
| 179 | 3300005438 | Ga0070701_10526992 | Ga0070701_105269921 | 174 |
| 180 | 3300005466 | Ga0070685_10007977 | Ga0070685_100079775 | 174 |
| 181 | 3300005466 | Ga0070685_10406784 | Ga0070685_104067842 | 174 |
| 182 | 3300005543 | Ga0070672_100075175 | Ga0070672_1000751752 | 174 |
| 183 | 3300005544 | Ga0070686_100465485 | Ga0070686_1004654852 | 174 |
| 184 | 3300005577 | Ga0068857_100115048 | Ga0068857_1001150482 | 174 |
| 185 | 3300005617 | Ga0068859_100242571 | Ga0068859_1002425712 | 174 |
| 186 | 3300005617 | Ga0068859_100370310 | Ga0068859_1003703102 | 174 |
| 187 | 3300005617 | Ga0068859_100380511 | Ga0068859_1003805112 | 174 |
| 188 | 3300005618 | Ga0068864_100158300 | Ga0068864_1001583002 | 174 |
| 189 | 3300005719 | Ga0068861_100693167 | Ga0068861_1006931672 | 174 |
| 190 | 3300005985 | Ga0081539_10040148 | Ga0081539_100401483 | 174 |
| 191 | 3300006048 | Ga0075363_100350168 | Ga0075363_1003501682 | 174 |
| 192 | 3300006177 | Ga0075362_10020342 | Ga0075362_100203423 | 174 |
| 193 | 3300006195 | Ga0075366_10115064 | Ga0075366_101150641 | 174 |
| 194 | 3300006844 | Ga0075428_100861797 | Ga0075428_1008617971 | 174 |
| 195 | 3300006846 | Ga0075430_100000583 | Ga0075430_10000058319 | 174 |
| 196 | 3300006881 | Ga0068865_100296132 | Ga0068865_1002961322 | 174 |
| 197 | 3300006931 | Ga0097620_100242557 | Ga0097620_1002425572 | 174 |
| 198 | 3300006931 | Ga0097620_100370288 | Ga0097620_1003702882 | 174 |
| 199 | 3300006931 | Ga0097620_100380494 | Ga0097620_1003804942 | 174 |
| 200 | 3300009093 | Ga0105240_10180116 | Ga0105240_101801162 | 174 |
| 201 | 3300009098 | Ga0105245_10382313 | Ga0105245_103823131 | 174 |
| 202 | 3300009101 | Ga0105247_10017488 | Ga0105247_100174882 | 174 |
| 203 | 3300009147 | Ga0114129_10290189 | Ga0114129_102901892 | 174 |
| 204 | 3300009148 | Ga0105243_10392293 | Ga0105243_103922932 | 174 |
| 205 | 3300009148 | Ga0105243_10458637 | Ga0105243_104586372 | 174 |
| 206 | 3300009174 | Ga0105241_10211087 | Ga0105241_102110872 | 174 |
| 207 | 3300009177 | Ga0105248_10395254 | Ga0105248_103952542 | 174 |
| 208 | 3300009545 | Ga0105237_10797347 | Ga0105237_107973472 | 174 |
| 209 | 3300009551 | Ga0105238_10140449 | Ga0105238_101404493 | 174 |
| 210 | 3300009553 | Ga0105249_10255227 | Ga0105249_102552272 | 174 |
| 211 | 3300009553 | Ga0105249_11892871 | Ga0105249_118928711 | 174 |
| 212 | 3300011119 | Ga0105246_10069686 | Ga0105246_100696862 | 174 |
| 213 | 3300011119 | Ga0105246_10193564 | Ga0105246_101935642 | 174 |
| 214 | 3300013297 | Ga0157378_10096003 | Ga0157378_100960032 | 174 |
| 215 | 3300013306 | Ga0163162_10840882 | Ga0163162_108408822 | 174 |
| 216 | 3300013308 | Ga0157375_10523055 | Ga0157375_105230552 | 174 |
| 217 | 3300013308 | Ga0157375_10723075 | Ga0157375_107230751 | 174 |
| 218 | 3300014325 | Ga0163163_10192445 | Ga0163163_101924451 | 174 |
| 219 | 3300014325 | Ga0163163_10303310 | Ga0163163_103033101 | 174 |
| 220 | 3300017792 | Ga0163161_10260789 | Ga0163161_102607892 | 174 |
| 221 | 3300025893 | Ga0207682_10005543 | Ga0207682_100055436 | 174 |
| 222 | 3300025901 | Ga0207688_10094238 | Ga0207688_100942382 | 174 |
| 223 | 3300025907 | Ga0207645_10107807 | Ga0207645_101078072 | 174 |
| 224 | 3300025908 | Ga0207643_10444541 | Ga0207643_104445412 | 174 |
| 225 | 3300025914 | Ga0207671_10896894 | Ga0207671_108968941 | 174 |
| 226 | 3300025914 | Ga0207671_11033018 | Ga0207671_110330181 | 174 |
| 227 | 3300025918 | Ga0207662_10092315 | Ga0207662_100923152 | 174 |
| 228 | 3300025918 | Ga0207662_10143468 | Ga0207662_101434682 | 174 |
| 229 | 3300025923 | Ga0207681_10028773 | Ga0207681_100287732 | 174 |
| 230 | 3300025924 | Ga0207694_10227434 | Ga0207694_102274342 | 174 |
| 231 | 3300025926 | Ga0207659_10355930 | Ga0207659_103559302 | 174 |
| 232 | 3300025926 | Ga0207659_10463029 | Ga0207659_104630292 | 174 |
| 233 | 3300025931 | Ga0207644_10152425 | Ga0207644_101524252 | 174 |
| 234 | 3300025934 | Ga0207686_10652957 | Ga0207686_106529572 | 174 |
| 235 | 3300025935 | Ga0207709_10029425 | Ga0207709_100294251 | 174 |
| 236 | 3300025936 | Ga0207670_10133149 | Ga0207670_101331492 | 174 |
| 237 | 3300025937 | Ga0207669_10118992 | Ga0207669_101189922 | 174 |
| 238 | 3300025938 | Ga0207704_10882628 | Ga0207704_108826282 | 174 |
| 239 | 3300025940 | Ga0207691_10082085 | Ga0207691_100820852 | 174 |
| 240 | 3300025940 | Ga0207691_10254298 | Ga0207691_102542982 | 174 |
| 241 | 3300025941 | Ga0207711_10610964 | Ga0207711_106109642 | 174 |
| 242 | 3300025942 | Ga0207689_10250916 | Ga0207689_102509162 | 174 |
| 243 | 3300025960 | Ga0207651_10285439 | Ga0207651_102854392 | 174 |
| 244 | 3300025960 | Ga0207651_10525958 | Ga0207651_105259582 | 174 |
| 245 | 3300025961 | Ga0207712_10250865 | Ga0207712_102508651 | 174 |
| 246 | 3300025986 | Ga0207658_10989844 | Ga0207658_109898442 | 174 |
| 247 | 3300026023 | Ga0207677_10222820 | Ga0207677_102228202 | 174 |
| 248 | 3300026023 | Ga0207677_10746693 | Ga0207677_107466931 | 174 |
| 249 | 3300026041 | Ga0207639_10263378 | Ga0207639_102633782 | 174 |
| 250 | 3300026041 | Ga0207639_10538913 | Ga0207639_105389132 | 174 |
| 251 | 3300026089 | Ga0207648_10085705 | Ga0207648_100857052 | 174 |
| 252 | 3300026116 | Ga0207674_10009568 | Ga0207674_1000956811 | 174 |
| 253 | 3300026118 | Ga0207675_100423152 | Ga0207675_1004231522 | 174 |
| 254 | 3300026121 | Ga0207683_10000979 | Ga0207683_1000097930 | 174 |
| 255 | 3300037853 | Ga0436364_0118407 | Ga0436364_0118407_64_597 | 174 |
| 256 | 3300037853 | Ga0436364_0405847 | Ga0436364_0405847_61_660 | 174 |
| 257 | 3300039437 | Ga0436365_0809682 | Ga0436365_0809682_48_572 | 174 |
| 258 | 3300039450 | Ga0436363_0403809 | Ga0436363_0403809_10_534 | 174 |
| 259 | 3300042001 | Ga0439441_011431 | Ga0439441_011431_89_613 | 174 |
| 260 | 3300042156 | Ga0439446_0136507 | Ga0439446_0136507_86_610 | 174 |
| 261 | 3300046460 | Ga0495638_0009575 | Ga0495638_0009575_3076_3600 | 174 |
| 262 | 3300046537 | Ga0495598_0032441 | Ga0495598_0032441_239_763 | 174 |
| 263 | 3300046539 | Ga0495621_0013947 | Ga0495621_0013947_1160_1684 | 174 |
| 264 | 3300046615 | Ga0495656_0081504 | Ga0495656_0081504_394_918 | 174 |
| 265 | 3300046616 | Ga0495668_0346201 | Ga0495668_0346201_17_541 | 174 |
| 266 | 3300047447 | Ga0495685_025593 | Ga0495685_025593_357_881 | 174 |
| 267 | 3300048913 | Ga0496110_0716377 | Ga0496110_0716377_157_681 | 174 |
| 268 | 3300048918 | Ga0496115_0639172 | Ga0496115_0639172_172_696 | 174 |
| 269 | 3300049588 | Ga0501072_0239009 | Ga0501072_0239009_136_660 | 174 |
| 270 | 3300049744 | Ga0501083_0047883 | Ga0501083_0047883_1943_2467 | 174 |
| 271 | 3300049744 | Ga0501083_0115146 | Ga0501083_0115146_435_959 | 174 |
| 272 | 3300050489 | nmdc:mga03683_70372_c1 | nmdc:mga03683_70372_c1_177_701 | 174 |
| 273 | 3300050490 | nmdc:mga03n38_403599_c1 | nmdc:mga03n38_403599_c1_177_701 | 174 |
| 274 | 3300050491 | nmdc:mga00v17_61181_c1 | nmdc:mga00v17_61181_c1_1415_1939 | 174 |
| 275 | 3300050493 | nmdc:mga0k408_7910_c1 | nmdc:mga0k408_7910_c1_3761_4285 | 174 |
| 276 | 3300050496 | nmdc:mga07m45_295972_c1 | nmdc:mga07m45_295972_c1_131_655 | 174 |
| 277 | 3300050507 | nmdc:mga05p37_114859_c1 | nmdc:mga05p37_114859_c1_960_1484 | 174 |
| 278 | 3300050509 | nmdc:mga0qj67_1081226_c1 | nmdc:mga0qj67_1081226_c1_77_601 | 174 |
| 279 | 3300050509 | nmdc:mga0qj67_144_c1 | nmdc:mga0qj67_144_c1_39779_40303 | 174 |
| 280 | 3300053079 | Ga0500610_0328149 | Ga0500610_0328149_111_635 | 174 |
| 281 | 3300053083 | Ga0495655_0113560 | Ga0495655_0113560_200_724 | 174 |
| 282 | 3300053093 | Ga0500651_0183707 | Ga0500651_0183707_204_728 | 174 |
| 283 | 3300053096 | Ga0500641_0154990 | Ga0500641_0154990_307_831 | 174 |
| 284 | 3300053134 | Ga0500658_0014176 | Ga0500658_0014176_1234_1758 | 174 |
| 285 | 3300053177 | Ga0500636_0198665 | Ga0500636_0198665_418_942 | 174 |
| 286 | 3300060353 | Ga0501082_0082291 | Ga0501082_0082291_287_811 | 174 |
| 287 | 3300002070 | JGI24750J21931_1003979 | JGI24750J21931_10039792 | 175 |
| 288 | 3300002077 | JGI24744J21845_10009127 | JGI24744J21845_100091272 | 175 |
| 289 | 3300002459 | JGI24751J29686_10004761 | JGI24751J29686_100047612 | 175 |
| 290 | 3300005327 | Ga0070658_10351382 | Ga0070658_103513821 | 175 |
| 291 | 3300005329 | Ga0070683_100270444 | Ga0070683_1002704442 | 175 |
| 292 | 3300005330 | Ga0070690_100041527 | Ga0070690_1000415271 | 175 |
| 293 | 3300005331 | Ga0070670_100026862 | Ga0070670_1000268624 | 175 |
| 294 | 3300005335 | Ga0070666_10072282 | Ga0070666_100722823 | 175 |
| 295 | 3300005338 | Ga0068868_100004148 | Ga0068868_10000414810 | 175 |
| 296 | 3300005340 | Ga0070689_100004242 | Ga0070689_1000042423 | 175 |
| 297 | 3300005340 | Ga0070689_100383534 | Ga0070689_1003835342 | 175 |
| 298 | 3300005343 | Ga0070687_100145372 | Ga0070687_1001453722 | 175 |
| 299 | 3300005345 | Ga0070692_10155262 | Ga0070692_101552622 | 175 |
| 300 | 3300005347 | Ga0070668_100007545 | Ga0070668_1000075456 | 175 |
| 301 | 3300005347 | Ga0070668_100097606 | Ga0070668_1000976062 | 175 |
| 302 | 3300005353 | Ga0070669_100027678 | Ga0070669_1000276782 | 175 |
| 303 | 3300005354 | Ga0070675_100150284 | Ga0070675_1001502842 | 175 |
| 304 | 3300005355 | Ga0070671_100108048 | Ga0070671_1001080482 | 175 |
| 305 | 3300005364 | Ga0070673_100181988 | Ga0070673_1001819882 | 175 |
| 306 | 3300005364 | Ga0070673_101226332 | Ga0070673_1012263321 | 175 |
| 307 | 3300005367 | Ga0070667_100020104 | Ga0070667_1000201044 | 175 |
| 308 | 3300005367 | Ga0070667_100131123 | Ga0070667_1001311233 | 175 |
| 309 | 3300005367 | Ga0070667_101027359 | Ga0070667_1010273591 | 175 |
| 310 | 3300005434 | Ga0070709_10073862 | Ga0070709_100738621 | 175 |
| 311 | 3300005435 | Ga0070714_100183202 | Ga0070714_1001832022 | 175 |
| 312 | 3300005435 | Ga0070714_100554465 | Ga0070714_1005544652 | 175 |
| 313 | 3300005436 | Ga0070713_100051720 | Ga0070713_1000517205 | 175 |
| 314 | 3300005436 | Ga0070713_100097916 | Ga0070713_1000979164 | 175 |
| 315 | 3300005437 | Ga0070710_10035150 | Ga0070710_100351503 | 175 |
| 316 | 3300005437 | Ga0070710_10075928 | Ga0070710_100759282 | 175 |
| 317 | 3300005438 | Ga0070701_10036830 | Ga0070701_100368303 | 175 |
| 318 | 3300005439 | Ga0070711_100898707 | Ga0070711_1008987071 | 175 |
| 319 | 3300005440 | Ga0070705_100304212 | Ga0070705_1003042122 | 175 |
| 320 | 3300005441 | Ga0070700_100001737 | Ga0070700_1000017374 | 175 |
| 321 | 3300005444 | Ga0070694_100722551 | Ga0070694_1007225511 | 175 |
| 322 | 3300005455 | Ga0070663_100060419 | Ga0070663_1000604192 | 175 |
| 323 | 3300005455 | Ga0070663_100431890 | Ga0070663_1004318901 | 175 |
| 324 | 3300005457 | Ga0070662_100692017 | Ga0070662_1006920171 | 175 |
| 325 | 3300005459 | Ga0068867_100007687 | Ga0068867_1000076877 | 175 |
| 326 | 3300005468 | Ga0070707_100278025 | Ga0070707_1002780252 | 175 |
| 327 | 3300005471 | Ga0070698_100138153 | Ga0070698_1001381532 | 175 |
| 328 | 3300005471 | Ga0070698_100699697 | Ga0070698_1006996971 | 175 |
| 329 | 3300005518 | Ga0070699_100020079 | Ga0070699_1000200795 | 175 |
| 330 | 3300005518 | Ga0070699_100620378 | Ga0070699_1006203781 | 175 |
| 331 | 3300005530 | Ga0070679_100970310 | Ga0070679_1009703101 | 175 |
| 332 | 3300005535 | Ga0070684_100075565 | Ga0070684_1000755652 | 175 |
| 333 | 3300005543 | Ga0070672_100525359 | Ga0070672_1005253592 | 175 |
| 334 | 3300005544 | Ga0070686_100675000 | Ga0070686_1006750002 | 175 |
| 335 | 3300005545 | Ga0070695_100630242 | Ga0070695_1006302422 | 175 |
| 336 | 3300005546 | Ga0070696_100897459 | Ga0070696_1008974591 | 175 |
| 337 | 3300005549 | Ga0070704_100384246 | Ga0070704_1003842462 | 175 |
| 338 | 3300005564 | Ga0070664_100131849 | Ga0070664_1001318493 | 175 |
| 339 | 3300005564 | Ga0070664_100158765 | Ga0070664_1001587652 | 175 |
| 340 | 3300005615 | Ga0070702_100001567 | Ga0070702_1000015679 | 175 |
| 341 | 3300005615 | Ga0070702_100211050 | Ga0070702_1002110502 | 175 |
| 342 | 3300005616 | Ga0068852_100096596 | Ga0068852_1000965963 | 175 |
| 343 | 3300005618 | Ga0068864_100021281 | Ga0068864_1000212815 | 175 |
| 344 | 3300005718 | Ga0068866_10013349 | Ga0068866_100133492 | 175 |
| 345 | 3300005719 | Ga0068861_100088205 | Ga0068861_1000882054 | 175 |
| 346 | 3300005834 | Ga0068851_10135286 | Ga0068851_101352861 | 175 |
| 347 | 3300005840 | Ga0068870_10002141 | Ga0068870_100021414 | 175 |
| 348 | 3300005841 | Ga0068863_100300488 | Ga0068863_1003004882 | 175 |
| 349 | 3300005842 | Ga0068858_100006326 | Ga0068858_1000063268 | 175 |
| 350 | 3300005842 | Ga0068858_100553498 | Ga0068858_1005534982 | 175 |
| 351 | 3300005843 | Ga0068860_100028301 | Ga0068860_1000283013 | 175 |
| 352 | 3300005843 | Ga0068860_100513631 | Ga0068860_1005136311 | 175 |
| 353 | 3300005844 | Ga0068862_100012692 | Ga0068862_1000126923 | 175 |
| 354 | 3300005937 | Ga0081455_10003757 | Ga0081455_1000375714 | 175 |
| 355 | 3300005937 | Ga0081455_10030575 | Ga0081455_100305754 | 175 |
| 356 | 3300005937 | Ga0081455_10046628 | Ga0081455_100466282 | 175 |
| 357 | 3300005981 | Ga0081538_10021756 | Ga0081538_100217564 | 175 |
| 358 | 3300005983 | Ga0081540_1012665 | Ga0081540_10126657 | 175 |
| 359 | 3300006028 | Ga0070717_10134085 | Ga0070717_101340852 | 175 |
| 360 | 3300006028 | Ga0070717_10643995 | Ga0070717_106439952 | 175 |
| 361 | 3300006038 | Ga0075365_10053135 | Ga0075365_100531352 | 175 |
| 362 | 3300006038 | Ga0075365_10107326 | Ga0075365_101073262 | 175 |
| 363 | 3300006038 | Ga0075365_10497928 | Ga0075365_104979281 | 175 |
| 364 | 3300006048 | Ga0075363_100386543 | Ga0075363_1003865432 | 175 |
| 365 | 3300006051 | Ga0075364_10113068 | Ga0075364_101130682 | 175 |
| 366 | 3300006163 | Ga0070715_10007987 | Ga0070715_100079872 | 175 |
| 367 | 3300006173 | Ga0070716_100038326 | Ga0070716_1000383262 | 175 |
| 368 | 3300006173 | Ga0070716_100644051 | Ga0070716_1006440512 | 175 |
| 369 | 3300006175 | Ga0070712_100116633 | Ga0070712_1001166332 | 175 |
| 370 | 3300006175 | Ga0070712_100232547 | Ga0070712_1002325472 | 175 |
| 371 | 3300006178 | Ga0075367_10073575 | Ga0075367_100735753 | 175 |
| 372 | 3300006178 | Ga0075367_10165656 | Ga0075367_101656562 | 175 |
| 373 | 3300006178 | Ga0075367_10224412 | Ga0075367_102244122 | 175 |
| 374 | 3300006237 | Ga0097621_100010895 | Ga0097621_1000108951 | 175 |
| 375 | 3300006358 | Ga0068871_100271209 | Ga0068871_1002712091 | 175 |
| 376 | 3300006844 | Ga0075428_100085901 | Ga0075428_1000859012 | 175 |
| 377 | 3300006847 | Ga0075431_100220278 | Ga0075431_1002202782 | 175 |
| 378 | 3300006847 | Ga0075431_100924884 | Ga0075431_1009248841 | 175 |
| 379 | 3300006871 | Ga0075434_100010388 | Ga0075434_1000103885 | 175 |
| 380 | 3300006871 | Ga0075434_100164343 | Ga0075434_1001643432 | 175 |
| 381 | 3300006880 | Ga0075429_100153262 | Ga0075429_1001532622 | 175 |
| 382 | 3300006880 | Ga0075429_100897059 | Ga0075429_1008970592 | 175 |
| 383 | 3300006914 | Ga0075436_100408703 | Ga0075436_1004087032 | 175 |
| 384 | 3300007076 | Ga0075435_101078401 | Ga0075435_1010784012 | 175 |
| 385 | 3300007265 | Ga0099794_10060226 | Ga0099794_100602262 | 175 |
| 386 | 3300009094 | Ga0111539_10013535 | Ga0111539_100135359 | 175 |
| 387 | 3300009094 | Ga0111539_10231184 | Ga0111539_102311843 | 175 |
| 388 | 3300009098 | Ga0105245_10123903 | Ga0105245_101239032 | 175 |
| 389 | 3300009101 | Ga0105247_10002289 | Ga0105247_100022894 | 175 |
| 390 | 3300009101 | Ga0105247_10555182 | Ga0105247_105551821 | 175 |
| 391 | 3300009147 | Ga0114129_10132354 | Ga0114129_101323542 | 175 |
| 392 | 3300009147 | Ga0114129_10150021 | Ga0114129_101500213 | 175 |
| 393 | 3300009147 | Ga0114129_11176658 | Ga0114129_111766582 | 175 |
| 394 | 3300009176 | Ga0105242_10033647 | Ga0105242_100336476 | 175 |
| 395 | 3300009177 | Ga0105248_10008256 | Ga0105248_100082564 | 175 |
| 396 | 3300009545 | Ga0105237_10029785 | Ga0105237_100297855 | 175 |
| 397 | 3300009551 | Ga0105238_10149332 | Ga0105238_101493322 | 175 |
| 398 | 3300009553 | Ga0105249_10030751 | Ga0105249_100307514 | 175 |
| 399 | 3300010375 | Ga0105239_10183580 | Ga0105239_101835803 | 175 |
| 400 | 3300010375 | Ga0105239_10327719 | Ga0105239_103277192 | 175 |
| 401 | 3300011119 | Ga0105246_10284799 | Ga0105246_102847992 | 175 |
| 402 | 3300011119 | Ga0105246_11533473 | Ga0105246_115334731 | 175 |
| 403 | 3300013296 | Ga0157374_10008420 | Ga0157374_100084205 | 175 |
| 404 | 3300013297 | Ga0157378_10538162 | Ga0157378_105381622 | 175 |
| 405 | 3300013306 | Ga0163162_10801181 | Ga0163162_108011812 | 175 |
| 406 | 3300013308 | Ga0157375_12085772 | Ga0157375_120857721 | 175 |
| 407 | 3300014325 | Ga0163163_10071017 | Ga0163163_100710174 | 175 |
| 408 | 3300014745 | Ga0157377_10005919 | Ga0157377_100059196 | 175 |
| 409 | 3300014745 | Ga0157377_10266837 | Ga0157377_102668372 | 175 |
| 410 | 3300014968 | Ga0157379_10020263 | Ga0157379_100202637 | 175 |
| 411 | 3300014969 | Ga0157376_10017126 | Ga0157376_100171263 | 175 |
| 412 | 3300017792 | Ga0163161_10086802 | Ga0163161_100868022 | 175 |
| 413 | 3300021384 | Ga0213876_10004487 | Ga0213876_100044875 | 175 |
| 414 | 3300021388 | Ga0213875_10000040 | Ga0213875_10000040125 | 175 |
| 415 | 3300025321 | Ga0207656_10005379 | Ga0207656_100053792 | 175 |
| 416 | 3300025898 | Ga0207692_10268360 | Ga0207692_102683602 | 175 |
| 417 | 3300025898 | Ga0207692_10449511 | Ga0207692_104495112 | 175 |
| 418 | 3300025899 | Ga0207642_10004584 | Ga0207642_100045844 | 175 |
| 419 | 3300025900 | Ga0207710_10021632 | Ga0207710_100216322 | 175 |
| 420 | 3300025900 | Ga0207710_10271822 | Ga0207710_102718221 | 175 |
| 421 | 3300025901 | Ga0207688_10000480 | Ga0207688_1000048014 | 175 |
| 422 | 3300025904 | Ga0207647_10045019 | Ga0207647_100450193 | 175 |
| 423 | 3300025906 | Ga0207699_10896179 | Ga0207699_108961792 | 175 |
| 424 | 3300025907 | Ga0207645_10008758 | Ga0207645_100087586 | 175 |
| 425 | 3300025908 | Ga0207643_10017874 | Ga0207643_100178742 | 175 |
| 426 | 3300025909 | Ga0207705_10321200 | Ga0207705_103212002 | 175 |
| 427 | 3300025910 | Ga0207684_10060236 | Ga0207684_100602363 | 175 |
| 428 | 3300025914 | Ga0207671_10105646 | Ga0207671_101056462 | 175 |
| 429 | 3300025915 | Ga0207693_10067103 | Ga0207693_100671033 | 175 |
| 430 | 3300025915 | Ga0207693_10100053 | Ga0207693_101000532 | 175 |
| 431 | 3300025918 | Ga0207662_10012537 | Ga0207662_100125377 | 175 |
| 432 | 3300025920 | Ga0207649_10118655 | Ga0207649_101186552 | 175 |
| 433 | 3300025922 | Ga0207646_10230750 | Ga0207646_102307502 | 175 |
| 434 | 3300025925 | Ga0207650_10027777 | Ga0207650_100277772 | 175 |
| 435 | 3300025925 | Ga0207650_10029398 | Ga0207650_100293982 | 175 |
| 436 | 3300025926 | Ga0207659_10027691 | Ga0207659_100276912 | 175 |
| 437 | 3300025927 | Ga0207687_10020079 | Ga0207687_100200794 | 175 |
| 438 | 3300025928 | Ga0207700_10037724 | Ga0207700_100377245 | 175 |
| 439 | 3300025928 | Ga0207700_10414313 | Ga0207700_104143132 | 175 |
| 440 | 3300025931 | Ga0207644_10350061 | Ga0207644_103500612 | 175 |
| 441 | 3300025932 | Ga0207690_10006529 | Ga0207690_100065299 | 175 |
| 442 | 3300025933 | Ga0207706_10005860 | Ga0207706_1000586012 | 175 |
| 443 | 3300025936 | Ga0207670_10008610 | Ga0207670_100086107 | 175 |
| 444 | 3300025936 | Ga0207670_10289599 | Ga0207670_102895992 | 175 |
| 445 | 3300025937 | Ga0207669_10043006 | Ga0207669_100430062 | 175 |
| 446 | 3300025939 | Ga0207665_10016432 | Ga0207665_100164325 | 175 |
| 447 | 3300025940 | Ga0207691_10142907 | Ga0207691_101429073 | 175 |
| 448 | 3300025941 | Ga0207711_10014189 | Ga0207711_100141891 | 175 |
| 449 | 3300025942 | Ga0207689_10033455 | Ga0207689_100334553 | 175 |
| 450 | 3300025944 | Ga0207661_10019047 | Ga0207661_100190472 | 175 |
| 451 | 3300025972 | Ga0207668_10071058 | Ga0207668_100710582 | 175 |
| 452 | 3300025986 | Ga0207658_10438028 | Ga0207658_104380282 | 175 |
| 453 | 3300026035 | Ga0207703_10005201 | Ga0207703_1000520110 | 175 |
| 454 | 3300026035 | Ga0207703_10147337 | Ga0207703_101473372 | 175 |
| 455 | 3300026041 | Ga0207639_10023555 | Ga0207639_100235552 | 175 |
| 456 | 3300026067 | Ga0207678_10028564 | Ga0207678_100285644 | 175 |
| 457 | 3300026067 | Ga0207678_10582836 | Ga0207678_105828361 | 175 |
| 458 | 3300026075 | Ga0207708_10002098 | Ga0207708_1000209811 | 175 |
| 459 | 3300026075 | Ga0207708_10830621 | Ga0207708_108306211 | 175 |
| 460 | 3300026088 | Ga0207641_10210699 | Ga0207641_102106992 | 175 |
| 461 | 3300026089 | Ga0207648_10004699 | Ga0207648_1000469913 | 175 |
| 462 | 3300026095 | Ga0207676_10006485 | Ga0207676_100064853 | 175 |
| 463 | 3300026118 | Ga0207675_100031234 | Ga0207675_1000312344 | 175 |
| 464 | 3300027671 | Ga0209588_1026172 | Ga0209588_10261722 | 175 |
| 465 | 3300027907 | Ga0207428_10023410 | Ga0207428_100234104 | 175 |
| 466 | 3300028380 | Ga0268265_10114982 | Ga0268265_101149822 | 175 |
| 467 | 3300028381 | Ga0268264_10509037 | Ga0268264_105090372 | 175 |
| 468 | 3300028381 | Ga0268264_11524949 | Ga0268264_115249491 | 175 |
| 469 | 3300031238 | Ga0265332_10017008 | Ga0265332_100170083 | 175 |
| 470 | 3300031241 | Ga0265325_10095672 | Ga0265325_100956721 | 175 |
| 471 | 3300031247 | Ga0265340_10026015 | Ga0265340_100260152 | 175 |
| 472 | 3300031247 | Ga0265340_10047664 | Ga0265340_100476641 | 175 |
| 473 | 3300031247 | Ga0265340_10237550 | Ga0265340_102375501 | 175 |
| 474 | 3300031249 | Ga0265339_10001375 | Ga0265339_100013755 | 175 |
| 475 | 3300031250 | Ga0265331_10053640 | Ga0265331_100536402 | 175 |
| 476 | 3300031712 | Ga0265342_10000569 | Ga0265342_100005696 | 175 |
| 477 | 3300034819 | Ga0373958_0040803 | Ga0373958_0040803_201_728 | 175 |
| 478 | 3300035083 | Ga0373926_0059622 | Ga0373926_0059622_194_721 | 175 |
| 479 | 3300035083 | Ga0373926_0281402 | Ga0373926_0281402_20_547 | 175 |
| 480 | 3300035084 | Ga0373928_0040031 | Ga0373928_0040031_159_686 | 175 |
| 481 | 3300035090 | Ga0373949_0016924 | Ga0373949_0016924_400_927 | 175 |
| 482 | 3300035111 | Ga0373923_0003583 | Ga0373923_0003583_117_644 | 175 |
| 483 | 3300035113 | Ga0373936_0004843 | Ga0373936_0004843_335_862 | 175 |
| 484 | 3300035115 | Ga0373941_0097299 | Ga0373941_0097299_101_628 | 175 |
| 485 | 3300035116 | Ga0373945_0043778 | Ga0373945_0043778_1055_1582 | 175 |
| 486 | 3300035117 | Ga0373953_0007533 | Ga0373953_0007533_2047_2574 | 175 |
| 487 | 3300035118 | Ga0373954_0001419 | Ga0373954_0001419_1934_2461 | 175 |
| 488 | 3300035170 | Ga0373943_0006089 | Ga0373943_0006089_32_559 | 175 |
| 489 | 3300035170 | Ga0373943_0033990 | Ga0373943_0033990_113_640 | 175 |
| 490 | 3300035171 | Ga0373946_0001531 | Ga0373946_0001531_3025_3552 | 175 |
| 491 | 3300035172 | Ga0373955_0002037 | Ga0373955_0002037_226_753 | 175 |
| 492 | 3300035242 | Ga0373962_0152550 | Ga0373962_0152550_196_723 | 175 |
| 493 | 3300035410 | Ga0373924_0218599 | Ga0373924_0218599_64_591 | 175 |
| 494 | 3300035691 | Ga0373931_0020363 | Ga0373931_0020363_1557_2084 | 175 |
| 495 | 3300035691 | Ga0373931_0022068 | Ga0373931_0022068_1297_1824 | 175 |
| 496 | 3300035692 | Ga0373935_0000246 | Ga0373935_0000246_22125_22652 | 175 |
| 497 | 3300035692 | Ga0373935_0274965 | Ga0373935_0274965_120_647 | 175 |
| 498 | 3300035695 | Ga0373927_0002984 | Ga0373927_0002984_8090_8617 | 175 |
| 499 | 3300035695 | Ga0373927_0005061 | Ga0373927_0005061_1267_1794 | 175 |
| 500 | 3300035724 | Ga0373933_0030710 | Ga0373933_0030710_1265_1792 | 175 |
| 501 | 3300035725 | Ga0373947_0000544 | Ga0373947_0000544_19575_20102 | 175 |
| 502 | 3300035725 | Ga0373947_0048826 | Ga0373947_0048826_1917_2444 | 175 |
| 503 | 3300035725 | Ga0373947_0261468 | Ga0373947_0261468_585_1112 | 175 |
| 504 | 3300036401 | Ga0373937_0000003 | Ga0373937_0000003_211596_212123 | 175 |
| 505 | 3300036401 | Ga0373937_0569510 | Ga0373937_0569510_139_666 | 175 |
| 506 | 3300036401 | Ga0373937_1324936 | Ga0373937_1324936_96_623 | 175 |
| 507 | 3300036401 | Ga0373937_1514696 | Ga0373937_1514696_21_548 | 175 |
| 508 | 3300037068 | Ga0373925_0000052 | Ga0373925_0000052_103678_104205 | 175 |
| 509 | 3300037068 | Ga0373925_0003941 | Ga0373925_0003941_2950_3477 | 175 |
| 510 | 3300037068 | Ga0373925_0395884 | Ga0373925_0395884_431_958 | 175 |
| 511 | 3300037853 | Ga0436364_0004209 | Ga0436364_0004209_16217_16744 | 175 |
| 512 | 3300039437 | Ga0436365_0468207 | Ga0436365_0468207_1561_2097 | 175 |
| 513 | 3300039437 | Ga0436365_0689847 | Ga0436365_0689847_3596_4132 | 175 |
| 514 | 3300039447 | Ga0436361_0271802 | Ga0436361_0271802_168_695 | 175 |
| 515 | 3300039447 | Ga0436361_0630759 | Ga0436361_0630759_594_1142 | 175 |
| 516 | 3300039450 | Ga0436363_0193075 | Ga0436363_0193075_144_671 | 175 |
| 517 | 3300039450 | Ga0436363_0673064 | Ga0436363_0673064_179_715 | 175 |
| 518 | 3300039453 | Ga0436362_1121268 | Ga0436362_1121268_33_560 | 175 |
| 519 | 3300041452 | Ga0451793_0244858 | Ga0451793_0244858_174_701 | 175 |
| 520 | 3300041459 | Ga0451800_1057318 | Ga0451800_1057318_10_537 | 175 |
| 521 | 3300041496 | Ga0451839_0664336 | Ga0451839_0664336_57_584 | 175 |
| 522 | 3300041507 | Ga0451851_0321573 | Ga0451851_0321573_52_579 | 175 |
| 523 | 3300042157 | Ga0439458_0075062 | Ga0439458_0075062_188_715 | 175 |
| 524 | 3300046453 | Ga0495627_143028 | Ga0495627_143028_57_614 | 175 |
| 525 | 3300046454 | Ga0495592_0000331 | Ga0495592_0000331_15481_16008 | 175 |
| 526 | 3300046459 | Ga0495629_0023386 | Ga0495629_0023386_32_559 | 175 |
| 527 | 3300046459 | Ga0495629_0502569 | Ga0495629_0502569_52_579 | 175 |
| 528 | 3300046461 | Ga0495641_0030923 | Ga0495641_0030923_1163_1690 | 175 |
| 529 | 3300046461 | Ga0495641_0200544 | Ga0495641_0200544_130_657 | 175 |
| 530 | 3300046462 | Ga0495651_0000733 | Ga0495651_0000733_15486_16013 | 175 |
| 531 | 3300046463 | Ga0495653_0000071 | Ga0495653_0000071_76675_77202 | 175 |
| 532 | 3300046473 | Ga0495582_0027755 | Ga0495582_0027755_1405_1932 | 175 |
| 533 | 3300046473 | Ga0495582_0039798 | Ga0495582_0039798_1633_2160 | 175 |
| 534 | 3300046473 | Ga0495582_0041190 | Ga0495582_0041190_1917_2444 | 175 |
| 535 | 3300046477 | Ga0495664_0000162 | Ga0495664_0000162_23286_23813 | 175 |
| 536 | 3300046491 | Ga0495584_0083951 | Ga0495584_0083951_30_557 | 175 |
| 537 | 3300046500 | Ga0495596_0202334 | Ga0495596_0202334_26_553 | 175 |
| 538 | 3300046511 | Ga0495608_0000239 | Ga0495608_0000239_15565_16092 | 175 |
| 539 | 3300046514 | Ga0495618_0000022 | Ga0495618_0000022_103794_104321 | 175 |
| 540 | 3300046515 | Ga0495620_0101143 | Ga0495620_0101143_124_651 | 175 |
| 541 | 3300046515 | Ga0495620_0251545 | Ga0495620_0251545_91_618 | 175 |
| 542 | 3300046516 | Ga0495628_0000011 | Ga0495628_0000011_23286_23813 | 175 |
| 543 | 3300046516 | Ga0495628_0665438 | Ga0495628_0665438_91_618 | 175 |
| 544 | 3300046517 | Ga0495630_0005679 | Ga0495630_0005679_6910_7437 | 175 |
| 545 | 3300046517 | Ga0495630_0623853 | Ga0495630_0623853_20_547 | 175 |
| 546 | 3300046520 | Ga0495637_0057238 | Ga0495637_0057238_273_800 | 175 |
| 547 | 3300046523 | Ga0495644_0044757 | Ga0495644_0044757_1059_1586 | 175 |
| 548 | 3300046526 | Ga0495666_0182560 | Ga0495666_0182560_67_594 | 175 |
| 549 | 3300046529 | Ga0495652_0000014 | Ga0495652_0000014_201672_202199 | 175 |
| 550 | 3300046531 | Ga0495665_0049113 | Ga0495665_0049113_547_1074 | 175 |
| 551 | 3300046531 | Ga0495665_0067289 | Ga0495665_0067289_122_649 | 175 |
| 552 | 3300046533 | Ga0495640_0000008 | Ga0495640_0000008_23286_23813 | 175 |
| 553 | 3300046533 | Ga0495640_0220164 | Ga0495640_0220164_11_538 | 175 |
| 554 | 3300046535 | Ga0495586_0479588 | Ga0495586_0479588_15_542 | 175 |
| 555 | 3300046536 | Ga0495587_0000347 | Ga0495587_0000347_23286_23813 | 175 |
| 556 | 3300046537 | Ga0495598_0010690 | Ga0495598_0010690_1574_2101 | 175 |
| 557 | 3300046538 | Ga0495609_0263836 | Ga0495609_0263836_108_635 | 175 |
| 558 | 3300046542 | Ga0495597_0200804 | Ga0495597_0200804_50_577 | 175 |
| 559 | 3300046543 | Ga0495645_0000007 | Ga0495645_0000007_360190_360717 | 175 |
| 560 | 3300046557 | Ga0495622_0123314 | Ga0495622_0123314_525_1052 | 175 |
| 561 | 3300046559 | Ga0495667_0000013 | Ga0495667_0000013_23272_23799 | 175 |
| 562 | 3300046615 | Ga0495656_0008675 | Ga0495656_0008675_2349_2876 | 175 |
| 563 | 3300046616 | Ga0495668_0289082 | Ga0495668_0289082_109_636 | 175 |
| 564 | 3300046642 | Ga0495634_0031786 | Ga0495634_0031786_2182_2709 | 175 |
| 565 | 3300046663 | Ga0495635_0000012 | Ga0495635_0000012_201459_201986 | 175 |
| 566 | 3300046663 | Ga0495635_0789819 | Ga0495635_0789819_52_579 | 175 |
| 567 | 3300046665 | Ga0495661_0073697 | Ga0495661_0073697_1142_1669 | 175 |
| 568 | 3300046675 | Ga0495657_0001891 | Ga0495657_0001891_15189_15716 | 175 |
| 569 | 3300046678 | Ga0495599_0000008 | Ga0495599_0000008_201722_202249 | 175 |
| 570 | 3300046679 | Ga0495623_0000500 | Ga0495623_0000500_23270_23797 | 175 |
| 571 | 3300046680 | Ga0495646_0000004 | Ga0495646_0000004_71940_72467 | 175 |
| 572 | 3300046681 | Ga0495647_0161672 | Ga0495647_0161672_64_618 | 175 |
| 573 | 3300046683 | Ga0495658_0043791 | Ga0495658_0043791_542_1069 | 175 |
| 574 | 3300046683 | Ga0495658_0209188 | Ga0495658_0209188_631_1158 | 175 |
| 575 | 3300046684 | Ga0495669_0023183 | Ga0495669_0023183_1058_1585 | 175 |
| 576 | 3300046689 | Ga0495613_0081027 | Ga0495613_0081027_1465_1992 | 175 |
| 577 | 3300046689 | Ga0495613_0085869 | Ga0495613_0085869_1732_2259 | 175 |
| 578 | 3300046690 | Ga0495624_0238601 | Ga0495624_0238601_482_1009 | 175 |
| 579 | 3300046692 | Ga0495671_0194710 | Ga0495671_0194710_63_590 | 175 |
| 580 | 3300046809 | Ga0495600_0000084 | Ga0495600_0000084_35426_35953 | 175 |
| 581 | 3300046809 | Ga0495600_0548270 | Ga0495600_0548270_151_678 | 175 |
| 582 | 3300047315 | Ga0495581_0122397 | Ga0495581_0122397_581_1108 | 175 |
| 583 | 3300047317 | Ga0495604_0000001 | Ga0495604_0000001_307879_308406 | 175 |
| 584 | 3300047319 | Ga0495674_0000630 | Ga0495674_0000630_9190_9717 | 175 |
| 585 | 3300047321 | Ga0495676_0049040 | Ga0495676_0049040_1008_1535 | 175 |
| 586 | 3300047321 | Ga0495676_0301643 | Ga0495676_0301643_462_989 | 175 |
| 587 | 3300047322 | Ga0495680_0017175 | Ga0495680_0017175_4980_5507 | 175 |
| 588 | 3300047322 | Ga0495680_0615488 | Ga0495680_0615488_65_592 | 175 |
| 589 | 3300047444 | Ga0495675_0000023 | Ga0495675_0000023_87269_87796 | 175 |
| 590 | 3300047445 | Ga0495677_0075465 | Ga0495677_0075465_651_1178 | 175 |
| 591 | 3300047470 | Ga0495681_0242473 | Ga0495681_0242473_74_601 | 175 |
| 592 | 3300047471 | Ga0495684_0000007 | Ga0495684_0000007_201532_202059 | 175 |
| 593 | 3300047673 | Ga0495593_0000918 | Ga0495593_0000918_1069_1596 | 175 |
| 594 | 3300048088 | Ga0495602_0000431 | Ga0495602_0000431_23286_23813 | 175 |
| 595 | 3300048090 | Ga0495615_0175302 | Ga0495615_0175302_44_571 | 175 |
| 596 | 3300048903 | Ga0496100_0014276 | Ga0496100_0014276_4053_4580 | 175 |
| 597 | 3300048903 | Ga0496100_0018049 | Ga0496100_0018049_2839_3366 | 175 |
| 598 | 3300048903 | Ga0496100_0532473 | Ga0496100_0532473_138_665 | 175 |
| 599 | 3300048904 | Ga0496101_0017659 | Ga0496101_0017659_4053_4580 | 175 |
| 600 | 3300048905 | Ga0496102_0038172 | Ga0496102_0038172_1555_2082 | 175 |
| 601 | 3300048905 | Ga0496102_0610812 | Ga0496102_0610812_106_633 | 175 |
| 602 | 3300048905 | Ga0496102_0995825 | Ga0496102_0995825_177_704 | 175 |
| 603 | 3300048906 | Ga0496103_0001924 | Ga0496103_0001924_1359_1886 | 175 |
| 604 | 3300048906 | Ga0496103_0006632 | Ga0496103_0006632_4966_5493 | 175 |
| 605 | 3300048907 | Ga0496104_0002823 | Ga0496104_0002823_12818_13357 | 175 |
| 606 | 3300048907 | Ga0496104_0004892 | Ga0496104_0004892_9349_9888 | 175 |
| 607 | 3300048907 | Ga0496104_0030628 | Ga0496104_0030628_3617_4144 | 175 |
| 608 | 3300048907 | Ga0496104_0436909 | Ga0496104_0436909_434_961 | 175 |
| 609 | 3300048907 | Ga0496104_0523074 | Ga0496104_0523074_75_602 | 175 |
| 610 | 3300048908 | Ga0496105_0001515 | Ga0496105_0001515_11579_12106 | 175 |
| 611 | 3300048908 | Ga0496105_0004141 | Ga0496105_0004141_2777_3304 | 175 |
| 612 | 3300048908 | Ga0496105_0012805 | Ga0496105_0012805_2642_3181 | 175 |
| 613 | 3300048908 | Ga0496105_0021610 | Ga0496105_0021610_360_899 | 175 |
| 614 | 3300048909 | Ga0496106_0002907 | Ga0496106_0002907_2517_3044 | 175 |
| 615 | 3300048909 | Ga0496106_0052534 | Ga0496106_0052534_1136_1663 | 175 |
| 616 | 3300048909 | Ga0496106_0514473 | Ga0496106_0514473_204_731 | 175 |
| 617 | 3300048909 | Ga0496106_0631586 | Ga0496106_0631586_25_552 | 175 |
| 618 | 3300048910 | Ga0496107_0007785 | Ga0496107_0007785_77_604 | 175 |
| 619 | 3300048910 | Ga0496107_0486574 | Ga0496107_0486574_255_794 | 175 |
| 620 | 3300048911 | Ga0496108_0001028 | Ga0496108_0001028_9348_9875 | 175 |
| 621 | 3300048911 | Ga0496108_0207454 | Ga0496108_0207454_668_1195 | 175 |
| 622 | 3300048911 | Ga0496108_0335084 | Ga0496108_0335084_448_987 | 175 |
| 623 | 3300048912 | Ga0496109_0002430 | Ga0496109_0002430_4447_4974 | 175 |
| 624 | 3300048912 | Ga0496109_0073398 | Ga0496109_0073398_1503_2042 | 175 |
| 625 | 3300048912 | Ga0496109_0176992 | Ga0496109_0176992_1177_1716 | 175 |
| 626 | 3300048912 | Ga0496109_0601199 | Ga0496109_0601199_149_676 | 175 |
| 627 | 3300048912 | Ga0496109_0789560 | Ga0496109_0789560_106_633 | 175 |
| 628 | 3300048913 | Ga0496110_0001894 | Ga0496110_0001894_14901_15428 | 175 |
| 629 | 3300048913 | Ga0496110_0050256 | Ga0496110_0050256_1109_1636 | 175 |
| 630 | 3300048913 | Ga0496110_0140044 | Ga0496110_0140044_1586_2125 | 175 |
| 631 | 3300048913 | Ga0496110_0446085 | Ga0496110_0446085_338_865 | 175 |
| 632 | 3300048914 | Ga0496111_0000436 | Ga0496111_0000436_14594_15121 | 175 |
| 633 | 3300048914 | Ga0496111_0002610 | Ga0496111_0002610_2905_3432 | 175 |
| 634 | 3300048915 | Ga0496112_0004518 | Ga0496112_0004518_8468_8995 | 175 |
| 635 | 3300048915 | Ga0496112_0064887 | Ga0496112_0064887_234_761 | 175 |
| 636 | 3300048916 | Ga0496113_0001213 | Ga0496113_0001213_11169_11696 | 175 |
| 637 | 3300048916 | Ga0496113_0019583 | Ga0496113_0019583_669_1196 | 175 |
| 638 | 3300048917 | Ga0496114_0184587 | Ga0496114_0184587_790_1317 | 175 |
| 639 | 3300048917 | Ga0496114_0486369 | Ga0496114_0486369_38_577 | 175 |
| 640 | 3300048917 | Ga0496114_0871073 | Ga0496114_0871073_187_714 | 175 |
| 641 | 3300048918 | Ga0496115_0015654 | Ga0496115_0015654_2388_2915 | 175 |
| 642 | 3300048918 | Ga0496115_0052838 | Ga0496115_0052838_2232_2771 | 175 |
| 643 | 3300048918 | Ga0496115_0114013 | Ga0496115_0114013_241_768 | 175 |
| 644 | 3300048918 | Ga0496115_0143695 | Ga0496115_0143695_189_728 | 175 |
| 645 | 3300049570 | Ga0501033_0702228 | Ga0501033_0702228_40_567 | 175 |
| 646 | 3300049578 | Ga0501042_0286130 | Ga0501042_0286130_212_739 | 175 |
| 647 | 3300049579 | Ga0501043_0950898 | Ga0501043_0950898_65_592 | 175 |
| 648 | 3300049584 | Ga0501068_0231429 | Ga0501068_0231429_371_898 | 175 |
| 649 | 3300049589 | Ga0501073_0500409 | Ga0501073_0500409_186_713 | 175 |
| 650 | 3300049591 | Ga0501075_0908199 | Ga0501075_0908199_58_585 | 175 |
| 651 | 3300049593 | Ga0501077_0331537 | Ga0501077_0331537_176_703 | 175 |
| 652 | 3300049741 | Ga0501079_0178249 | Ga0501079_0178249_459_986 | 175 |
| 653 | 3300049824 | Ga0501045_0644964 | Ga0501045_0644964_193_720 | 175 |
| 654 | 3300050492 | nmdc:mga0yw44_103484_c1 | nmdc:mga0yw44_103484_c1_1244_1771 | 175 |
| 655 | 3300050492 | nmdc:mga0yw44_20097_c1 | nmdc:mga0yw44_20097_c1_666_1193 | 175 |
| 656 | 3300050492 | nmdc:mga0yw44_47560_c1 | nmdc:mga0yw44_47560_c1_756_1283 | 175 |
| 657 | 3300050492 | nmdc:mga0yw44_82900_c1 | nmdc:mga0yw44_82900_c1_55_582 | 175 |
| 658 | 3300050494 | nmdc:mga06z11_48917_c1 | nmdc:mga06z11_48917_c1_921_1472 | 175 |
| 659 | 3300050507 | nmdc:mga05p37_11760_c1 | nmdc:mga05p37_11760_c1_5407_5934 | 175 |
| 660 | 3300050507 | nmdc:mga05p37_1336385_c1 | nmdc:mga05p37_1336385_c1_124_651 | 175 |
| 661 | 3300050507 | nmdc:mga05p37_68011_c1 | nmdc:mga05p37_68011_c1_2216_2743 | 175 |
| 662 | 3300050508 | nmdc:mga09592_74608_c1 | nmdc:mga09592_74608_c1_1370_1897 | 175 |
| 663 | 3300050508 | nmdc:mga09592_94047_c1 | nmdc:mga09592_94047_c1_336_914 | 175 |
| 664 | 3300050509 | nmdc:mga0qj67_625769_c1 | nmdc:mga0qj67_625769_c1_85_663 | 175 |
| 665 | 3300050509 | nmdc:mga0qj67_657404_c1 | nmdc:mga0qj67_657404_c1_54_581 | 175 |
| 666 | 3300050510 | nmdc:mga06r32_37645_c1 | nmdc:mga06r32_37645_c1_455_982 | 175 |
| 667 | 3300050510 | nmdc:mga06r32_410386_c1 | nmdc:mga06r32_410386_c1_197_724 | 175 |
| 668 | 3300050511 | nmdc:mga08y16_31336_c1 | nmdc:mga08y16_31336_c1_1471_1998 | 175 |
| 669 | 3300050511 | nmdc:mga08y16_31728_c1 | nmdc:mga08y16_31728_c1_747_1274 | 175 |
| 670 | 3300050512 | nmdc:mga0n895_17990_c1 | nmdc:mga0n895_17990_c1_1581_2108 | 175 |
| 671 | 3300050512 | nmdc:mga0n895_4803_c1 | nmdc:mga0n895_4803_c1_4359_4886 | 175 |
| 672 | 3300050514 | nmdc:mga08x19_277959_c1 | nmdc:mga08x19_277959_c1_208_735 | 175 |
| 673 | 3300053077 | Ga0495601_0000014 | Ga0495601_0000014_196506_197033 | 175 |
| 674 | 3300053078 | Ga0495612_0000123 | Ga0495612_0000123_23286_23813 | 175 |
| 675 | 3300053083 | Ga0495655_0011770 | Ga0495655_0011770_783_1310 | 175 |
| 676 | 3300053084 | Ga0495595_0000169 | Ga0495595_0000169_9517_10044 | 175 |
| 677 | 3300053085 | Ga0495619_0000006 | Ga0495619_0000006_23286_23813 | 175 |
| 678 | 3300053085 | Ga0495619_0058304 | Ga0495619_0058304_2008_2535 | 175 |
| 679 | 3300053085 | Ga0495619_0185834 | Ga0495619_0185834_326_853 | 175 |
| 680 | 3300053096 | Ga0500641_0053745 | Ga0500641_0053745_486_1034 | 175 |
| 681 | 3300053156 | Ga0500622_0006576 | Ga0500622_0006576_1197_1727 | 175 |
| 682 | 3300053730 | Ga0500645_111678 | Ga0500645_111678_230_757 | 175 |
| 683 | 3300060353 | Ga0501082_0348961 | Ga0501082_0348961_55_582 | 175 |
| 684 | 3300061734 | Ga0530510_0092508 | Ga0530510_0092508_72_599 | 175 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3pg5-assembly6.cif.gz_D | crystal structure of protein dip2308 from corynebacterium diphtheriae, northeast structural genomics consortium target cdr78 | 0.7674 | 1 | 36 |
| 1p9n-assembly1.cif.gz_B | crystal structure of escherichia coli mobb. | 0.7551 | 1 | 160 |
| 1np6-assembly1.cif.gz_B | crystal structure of escherichia coli mobb | 0.739 | 1 | 160 |
| 1np6-assembly1.cif.gz_A | crystal structure of escherichia coli mobb | 0.7364 | 1 | 160 |
| 1p9n-assembly1.cif.gz_B | crystal structure of escherichia coli mobb. | 0.7203 | 1 | 160 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1rz3A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8892 | 4 | 36 | 3.40.50.300 |
| 1p9nB01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8164 | 1 | 160 | 3.40.50.300 |
| 1ihuA02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8149 | 3 | 38 | 3.40.50.300 |
| 1p9nB01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.7811 | 1 | 160 | 3.40.50.300 |
| 3pg5A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.7557 | 2 | 36 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7C4BS80-F1-model_v4 | Molybdopterin-guanine dinucleotide biosynthesis protein B | 0.956 | 7 | 64 |
GO:0005525
GO:0006777 |
| AF-A0A843EQH1-F1-model_v4 | Molybdopterin-guanine dinucleotide biosynthesis protein B | 0.9345 | 1 | 64 |
GO:0005525
GO:0006777 |
| AF-A0A352PNV1-F1-model_v4 | Molybdopterin-guanine dinucleotide biosynthesis protein B | 0.9335 | 7 | 66 |
GO:0005525
GO:0006777 |
| AF-A0A1F8P987-F1-model_v4 | Molybdopterin-guanine dinucleotide biosynthesis protein B | 0.9314 | 7 | 70 |
GO:0005525
GO:0006777 |
| AF-A0A1G0E9H6-F1-model_v4 | Molybdopterin-guanine dinucleotide biosynthesis protein B | 0.919 | 7 | 69 |
GO:0005525
GO:0006777 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar