F475038

General Info

Members Datasets Scaffolds Average Seq Length
684 374 684 174

Family's Representative Sequence

Representative Sequence 3300005547|Ga0070693_100617792|Ga0070693_1006177921
Length 189
Sequence VILQATRPVIGIVGWKNSGKTTLVESLVGELTRRGLRVSTIKHAHHDCEIDKPGKDSYRHRQAGAQEVIVSSAKRWALVHELDDESEPSLAGLLSHLSSCDLVLVEGMKSETFDKILVVRGKNDPPWNLCTGICAVASDEPASAGPFQSLPLNEPRVITDFLVARYQLEKRTRLARCDFSISAQSGAPT

Samples

Sample ID Description Type Environment
1 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
69 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
70 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
71 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
72 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
73 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
74 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
75 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
76 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
77 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
78 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
79 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
80 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
81 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
82 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
83 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
85 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
86 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
87 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
88 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
89 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
90 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
91 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
92 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
93 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
95 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
96 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
97 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
99 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
100 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
102 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
103 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
104 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
105 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
106 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
107 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
108 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
109 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
110 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
111 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
112 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
113 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
114 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
115 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
116 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
117 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
118 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
119 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
120 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
121 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
122 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
123 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
124 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
125 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
126 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
127 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
187 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
190 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
191 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
192 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
193 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
194 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
195 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
196 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
197 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
198 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
199 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
200 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
201 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
202 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
203 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
204 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
205 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
206 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
207 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
208 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
209 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
210 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
211 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
212 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
213 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
214 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
215 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
216 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
217 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
218 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
219 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
220 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
221 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
222 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
223 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
224 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
225 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
226 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
227 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
228 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
229 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
230 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
231 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
232 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
233 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
234 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
235 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
236 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
237 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
238 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
239 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
240 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
241 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
242 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
243 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
244 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
245 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
246 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
247 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
248 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
249 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
250 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
251 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
252 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
253 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
254 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
255 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
256 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
257 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
258 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
259 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
260 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
261 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
262 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
263 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
264 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
265 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
266 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
267 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
268 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
269 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
270 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
271 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
272 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
273 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
274 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
275 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
276 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
277 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
278 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
279 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
280 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
281 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
282 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
283 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
284 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
285 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
286 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
287 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
288 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
289 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
290 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
291 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
292 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
293 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
294 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
295 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
296 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
297 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
298 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
299 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
300 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
301 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
302 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
303 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
304 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
305 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
306 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
307 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
308 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
309 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
310 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
311 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
312 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
313 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
314 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
315 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
316 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
317 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
318 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
319 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
320 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
321 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
322 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
323 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
324 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
325 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
326 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
327 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
328 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
329 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
330 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
331 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
332 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
333 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
334 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
335 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
336 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
337 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
338 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
339 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
340 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
341 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
342 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
343 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
344 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
345 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
346 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
347 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
348 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
349 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
350 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
351 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
352 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
353 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
354 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
355 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
356 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
357 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
358 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
359 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
360 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
361 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
362 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
363 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
364 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
365 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
366 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
367 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
368 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
369 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
370 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
371 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
372 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
373 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
374 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.41
Nodule 0
Rhizoplane 8.33
Rhizosphere 84.21
Stem 0
Stem Tuber 0
Unclassified 2.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24750J21931_1003979 3300002070 Bacteria 1781
2 JGI24744J21845_10009127 3300002077 Bacteria 2036
3 JGI24751J29686_10004761 3300002459 Bacteria 2757
4 JGI25406J46586_10027958 3300003203 Bacteria 2154
5 Ga0065712_10122210 3300005290 Bacteria 1654
6 Ga0070658_10351382 3300005327 Bacteria 1262
7 Ga0070676_10138121 3300005328 Bacteria 1548
8 Ga0070683_100270444 3300005329 Bacteria 1616
9 Ga0070690_100041527 3300005330 Bacteria 2912
10 Ga0070690_100380331 3300005330 Bacteria 1032
11 Ga0070670_100026862 3300005331 Bacteria 4951
12 Ga0070670_100053933 3300005331 Bacteria 3452
13 Ga0070670_100411419 3300005331 Bacteria 1195
14 Ga0070677_10043840 3300005333 Bacteria 1778
15 Ga0070666_10072282 3300005335 Bacteria 2348
16 Ga0070680_100019906 3300005336 Bacteria 5321
17 Ga0070680_100220691 3300005336 Bacteria 1600
18 Ga0068868_100004148 3300005338 Bacteria 10129
19 Ga0068868_100238478 3300005338 Bacteria 1527
20 Ga0070660_100034493 3300005339 Bacteria 3824
21 Ga0070689_100004242 3300005340 Bacteria 9662
22 Ga0070689_100122565 3300005340 Bacteria 2077
23 Ga0070689_100383534 3300005340 Bacteria 1185
24 Ga0070687_100145372 3300005343 Bacteria 1385
25 Ga0070687_100152993 3300005343 Bacteria 1356
26 Ga0070687_100423051 3300005343 Bacteria 879
27 Ga0070661_100184432 3300005344 Bacteria 1589
28 Ga0070661_100666805 3300005344 Bacteria 845
29 Ga0070692_10155262 3300005345 Bacteria 1307
30 Ga0070668_100007545 3300005347 Bacteria 8078
31 Ga0070668_100097606 3300005347 Bacteria 2324
32 Ga0070669_100027678 3300005353 Bacteria 4080
33 Ga0070669_100481419 3300005353 Bacteria 1027
34 Ga0070675_100150284 3300005354 Bacteria 1996
35 Ga0070675_100224860 3300005354 Bacteria 1635
36 Ga0070671_100108048 3300005355 Bacteria 2336
37 Ga0070671_100207907 3300005355 Bacteria 1660
38 Ga0070671_100314078 3300005355 Bacteria 1335
39 Ga0070674_100235344 3300005356 Bacteria 1431
40 Ga0070673_100111922 3300005364 Bacteria 2265
41 Ga0070673_100181988 3300005364 Bacteria 1800
42 Ga0070673_101226332 3300005364 Bacteria 703
43 Ga0070667_100020104 3300005367 Bacteria 5543
44 Ga0070667_100038285 3300005367 Bacteria 4020
45 Ga0070667_100131123 3300005367 Bacteria 2188
46 Ga0070667_100910209 3300005367 Bacteria 819
47 Ga0070667_101027359 3300005367 Bacteria 769
48 Ga0070667_101387234 3300005367 Bacteria 659
49 Ga0070709_10073862 3300005434 Bacteria 2209
50 Ga0070714_100183202 3300005435 Bacteria 1906
51 Ga0070714_100554465 3300005435 Bacteria 1100
52 Ga0070713_100051720 3300005436 Bacteria 3399
53 Ga0070713_100097916 3300005436 Bacteria 2535
54 Ga0070713_100721208 3300005436 Bacteria 953
55 Ga0070710_10035150 3300005437 Bacteria 2731
56 Ga0070710_10075928 3300005437 Bacteria 1948
57 Ga0070701_10023853 3300005438 Bacteria 2952
58 Ga0070701_10036830 3300005438 Bacteria 2467
59 Ga0070701_10526992 3300005438 Bacteria 771
60 Ga0070711_100898707 3300005439 Bacteria 756
61 Ga0070705_100304212 3300005440 Bacteria 1144
62 Ga0070705_100321457 3300005440 Bacteria 1117
63 Ga0070700_100001737 3300005441 Bacteria 10954
64 Ga0070694_100722551 3300005444 Bacteria 811
65 Ga0070663_100060419 3300005455 Bacteria 2726
66 Ga0070663_100431890 3300005455 Bacteria 1082
67 Ga0070678_100569279 3300005456 Bacteria 1008
68 Ga0070662_100080077 3300005457 Bacteria 2431
69 Ga0070662_100692017 3300005457 Bacteria 862
70 Ga0068867_100007687 3300005459 Bacteria 7626
71 Ga0068867_100807287 3300005459 Unclassified 837
72 Ga0070685_10007977 3300005466 Bacteria 5427
73 Ga0070685_10406784 3300005466 Bacteria 944
74 Ga0070707_100278025 3300005468 Bacteria 1627
75 Ga0070698_100138153 3300005471 Bacteria 2390
76 Ga0070698_100205702 3300005471 Bacteria 1904
77 Ga0070698_100699697 3300005471 Bacteria 955
78 Ga0070699_100020079 3300005518 Bacteria 5758
79 Ga0070699_100620378 3300005518 Bacteria 986
80 Ga0070679_100970310 3300005530 Bacteria 794
81 Ga0070684_100075565 3300005535 Bacteria 2972
82 Ga0070697_100009157 3300005536 Bacteria 7735
83 Ga0070672_100075175 3300005543 Bacteria 2696
84 Ga0070672_100525359 3300005543 Bacteria 1025
85 Ga0070686_100465485 3300005544 Bacteria 974
86 Ga0070686_100675000 3300005544 Bacteria 822
87 Ga0070695_100015964 3300005545 Bacteria 4539
88 Ga0070695_100630242 3300005545 Unclassified 845
89 Ga0070696_100022673 3300005546 Bacteria 4267
90 Ga0070696_100897459 3300005546 Bacteria 735
91 Ga0070693_100617792 3300005547 Unclassified 784
92 Ga0070704_100001844 3300005549 Bacteria 11680
93 Ga0070704_100384246 3300005549 Bacteria 1194
94 Ga0070704_101264767 3300005549 Unclassified 674
95 Ga0070664_100131849 3300005564 Bacteria 2196
96 Ga0070664_100134650 3300005564 Bacteria 2172
97 Ga0070664_100158765 3300005564 Bacteria 1999
98 Ga0068857_100115048 3300005577 Bacteria 2419
99 Ga0068856_100148988 3300005614 Bacteria 2348
100 Ga0068856_100174392 3300005614 Bacteria 2163
101 Ga0070702_100001567 3300005615 Bacteria 9425
102 Ga0070702_100211050 3300005615 Bacteria 1292
103 Ga0068852_100096596 3300005616 Bacteria 2656
104 Ga0068859_100069488 3300005617 Bacteria 3557
105 Ga0068859_100242571 3300005617 Bacteria 1891
106 Ga0068859_100370310 3300005617 Bacteria 1528
107 Ga0068859_100380511 3300005617 Bacteria 1507
108 Ga0068859_100685491 3300005617 Bacteria 1116
109 Ga0068864_100021281 3300005618 Bacteria 5434
110 Ga0068864_100158300 3300005618 Bacteria 2057
111 Ga0068866_10013349 3300005718 Bacteria 3602
112 Ga0068861_100088205 3300005719 Bacteria 2442
113 Ga0068861_100693167 3300005719 Bacteria 946
114 Ga0068851_10135286 3300005834 Bacteria 1336
115 Ga0068870_10002141 3300005840 Bacteria 8175
116 Ga0068863_100300488 3300005841 Bacteria 1557
117 Ga0068858_100006326 3300005842 Bacteria 11531
118 Ga0068858_100098733 3300005842 Bacteria 2722
119 Ga0068858_100553498 3300005842 Bacteria 1114
120 Ga0068860_100028301 3300005843 Bacteria 5394
121 Ga0068860_100513631 3300005843 Bacteria 1197
122 Ga0068862_100012692 3300005844 Bacteria 6972
123 Ga0081455_10003757 3300005937 Bacteria 17335
124 Ga0081455_10030575 3300005937 Bacteria 4890
125 Ga0081455_10046628 3300005937 Bacteria 3758
126 Ga0081538_10000146 3300005981 Bacteria 73599
127 Ga0081538_10021756 3300005981 Bacteria 4667
128 Ga0081540_1012665 3300005983 Bacteria 5532
129 Ga0081539_10014262 3300005985 Bacteria 5897
130 Ga0081539_10040148 3300005985 Bacteria 2751
131 Ga0070717_10134085 3300006028 Bacteria 2131
132 Ga0070717_10643995 3300006028 Bacteria 962
133 Ga0075365_10053135 3300006038 Bacteria 2682
134 Ga0075365_10107326 3300006038 Bacteria 1917
135 Ga0075365_10497928 3300006038 Bacteria 861
136 Ga0075368_10080575 3300006042 Bacteria 1324
137 Ga0075363_100171698 3300006048 Bacteria 1231
138 Ga0075363_100350168 3300006048 Bacteria 862
139 Ga0075363_100386543 3300006048 Bacteria 821
140 Ga0075364_10113068 3300006051 Bacteria 1813
141 Ga0070715_10007987 3300006163 Bacteria 3669
142 Ga0070716_100038326 3300006173 Bacteria 2654
143 Ga0070716_100644051 3300006173 Bacteria 803
144 Ga0070712_100064607 3300006175 Bacteria 2596
145 Ga0070712_100116633 3300006175 Bacteria 2003
146 Ga0070712_100232547 3300006175 Bacteria 1464
147 Ga0075362_10020342 3300006177 Bacteria 2772
148 Ga0075367_10073575 3300006178 Bacteria 2059
149 Ga0075367_10165656 3300006178 Bacteria 1375
150 Ga0075367_10224412 3300006178 Bacteria 1176
151 Ga0075366_10115064 3300006195 Bacteria 1619
152 Ga0075366_10661938 3300006195 Bacteria 648
153 Ga0097621_100010895 3300006237 Bacteria 6674
154 Ga0075370_10026736 3300006353 Bacteria 3198
155 Ga0068871_100271209 3300006358 Bacteria 1482
156 Ga0075428_100085901 3300006844 Bacteria 3432
157 Ga0075428_100861797 3300006844 Bacteria 962
158 Ga0075430_100000583 3300006846 Bacteria 27751
159 Ga0075430_100139470 3300006846 Bacteria 2019
160 Ga0075430_100677643 3300006846 Bacteria 850
161 Ga0075431_100112076 3300006847 Bacteria 2815
162 Ga0075431_100220278 3300006847 Bacteria 1936
163 Ga0075431_100924884 3300006847 Bacteria 841
164 Ga0075431_101211004 3300006847 Bacteria 718
165 Ga0075434_100010388 3300006871 Bacteria 8726
166 Ga0075434_100164343 3300006871 Bacteria 2239
167 Ga0075429_100153262 3300006880 Bacteria 2018
168 Ga0075429_100892749 3300006880 Bacteria 778
169 Ga0075429_100897059 3300006880 Bacteria 776
170 Ga0068865_100296132 3300006881 Bacteria 1293
171 Ga0075436_100004215 3300006914 Bacteria 9869
172 Ga0075436_100408703 3300006914 Unclassified 984
173 Ga0097620_100069489 3300006931 Bacteria 3557
174 Ga0097620_100242557 3300006931 Bacteria 1891
175 Ga0097620_100370288 3300006931 Bacteria 1528
176 Ga0097620_100380494 3300006931 Bacteria 1507
177 Ga0097620_100685443 3300006931 Bacteria 1116
178 Ga0075435_100175400 3300007076 Bacteria 1810
179 Ga0075435_101078401 3300007076 Bacteria 702
180 Ga0099794_10060226 3300007265 Bacteria 1843
181 Ga0105240_10180116 3300009093 Bacteria 2494
182 Ga0105240_10272542 3300009093 Bacteria 1948
183 Ga0111539_10013535 3300009094 Bacteria 10195
184 Ga0111539_10211335 3300009094 Bacteria 2261
185 Ga0111539_10231184 3300009094 Bacteria 2153
186 Ga0111539_11321080 3300009094 Bacteria 837
187 Ga0111539_12315861 3300009094 Bacteria 623
188 Ga0105245_10123903 3300009098 Bacteria 2417
189 Ga0105245_10344848 3300009098 Bacteria 1474
190 Ga0105245_10382313 3300009098 Bacteria 1402
191 Ga0105245_10478396 3300009098 Bacteria 1258
192 Ga0105247_10002289 3300009101 Bacteria 13101
193 Ga0105247_10017488 3300009101 Bacteria 4302
194 Ga0105247_10555182 3300009101 Bacteria 845
195 Ga0114129_10132354 3300009147 Bacteria 3424
196 Ga0114129_10150021 3300009147 Bacteria 3191
197 Ga0114129_10290189 3300009147 Bacteria 2183
198 Ga0114129_10464518 3300009147 Bacteria 1658
199 Ga0114129_11176658 3300009147 Bacteria 956
200 Ga0114129_11256463 3300009147 Bacteria 920
201 Ga0114129_12284742 3300009147 Bacteria 649
202 Ga0105243_10120358 3300009148 Bacteria 2212
203 Ga0105243_10285292 3300009148 Bacteria 1489
204 Ga0105243_10392293 3300009148 Bacteria 1287
205 Ga0105243_10458637 3300009148 Bacteria 1198
206 Ga0105241_10211087 3300009174 Bacteria 1627
207 Ga0105242_10033647 3300009176 Bacteria 4106
208 Ga0105242_10244498 3300009176 Bacteria 1614
209 Ga0105248_10008256 3300009177 Bacteria 11439
210 Ga0105248_10395254 3300009177 Bacteria 1557
211 Ga0105237_10029785 3300009545 Bacteria 5545
212 Ga0105237_10797347 3300009545 Bacteria 951
213 Ga0105238_10140449 3300009551 Bacteria 2392
214 Ga0105238_10149332 3300009551 Bacteria 2312
215 Ga0105249_10030751 3300009553 Bacteria 4854
216 Ga0105249_10053275 3300009553 Bacteria 3698
217 Ga0105249_10255227 3300009553 Bacteria 1740
218 Ga0105249_10882682 3300009553 Bacteria 961
219 Ga0105249_11892871 3300009553 Bacteria 669
220 Ga0099796_10038454 3300010159 Bacteria 1605
221 Ga0105239_10183580 3300010375 Bacteria 2341
222 Ga0105239_10327719 3300010375 Bacteria 1727
223 Ga0105246_10069686 3300011119 Bacteria 2471
224 Ga0105246_10193564 3300011119 Bacteria 1576
225 Ga0105246_10284799 3300011119 Bacteria 1327
226 Ga0105246_11232165 3300011119 Bacteria 690
227 Ga0105246_11533473 3300011119 Bacteria 627
228 Ga0157373_10076208 3300013100 Unclassified 2367
229 Ga0157371_10015546 3300013102 Bacteria 5708
230 Ga0157374_10008420 3300013296 Bacteria 8811
231 Ga0157378_10096003 3300013297 Bacteria 2701
232 Ga0157378_10538162 3300013297 Bacteria 1172
233 Ga0163162_10801181 3300013306 Bacteria 1059
234 Ga0163162_10840882 3300013306 Bacteria 1033
235 Ga0157372_10024327 3300013307 Bacteria 6577
236 Ga0157375_10523055 3300013308 Bacteria 1349
237 Ga0157375_10723075 3300013308 Bacteria 1148
238 Ga0157375_12085772 3300013308 Bacteria 675
239 Ga0163163_10071017 3300014325 Bacteria 3468
240 Ga0163163_10192445 3300014325 Bacteria 2088
241 Ga0163163_10303310 3300014325 Bacteria 1650
242 Ga0157380_10208632 3300014326 Bacteria 1739
243 Ga0157377_10005919 3300014745 Bacteria 5787
244 Ga0157377_10266837 3300014745 Bacteria 1116
245 Ga0157379_10020263 3300014968 Bacteria 5880
246 Ga0157376_10017126 3300014969 Bacteria 5520
247 Ga0163161_10086802 3300017792 Bacteria 2310
248 Ga0163161_10260789 3300017792 Bacteria 1353
249 Ga0213876_10004487 3300021384 Bacteria 7800
250 Ga0213875_10000040 3300021388 Bacteria 156362
251 Ga0224572_1044952 3300024225 Bacteria 828
252 Ga0207656_10005379 3300025321 Bacteria 4521
253 Ga0207682_10005543 3300025893 Bacteria 5137
254 Ga0207692_10268360 3300025898 Bacteria 1028
255 Ga0207692_10449511 3300025898 Bacteria 811
256 Ga0207642_10004584 3300025899 Bacteria 4465
257 Ga0207710_10021632 3300025900 Bacteria 2758
258 Ga0207710_10271822 3300025900 Bacteria 851
259 Ga0207688_10000480 3300025901 Bacteria 19126
260 Ga0207688_10094238 3300025901 Bacteria 1722
261 Ga0207688_10351940 3300025901 Bacteria 908
262 Ga0207647_10045019 3300025904 Bacteria 2754
263 Ga0207699_10896179 3300025906 Bacteria 654
264 Ga0207645_10008758 3300025907 Bacteria 7039
265 Ga0207645_10107807 3300025907 Bacteria 1802
266 Ga0207643_10017874 3300025908 Bacteria 3883
267 Ga0207643_10444541 3300025908 Bacteria 824
268 Ga0207705_10231510 3300025909 Bacteria 1405
269 Ga0207705_10321200 3300025909 Bacteria 1190
270 Ga0207684_10060236 3300025910 Bacteria 3224
271 Ga0207707_10009131 3300025912 Bacteria 8611
272 Ga0207695_10700158 3300025913 Bacteria 894
273 Ga0207695_10870733 3300025913 Bacteria 781
274 Ga0207671_10105646 3300025914 Bacteria 2137
275 Ga0207671_10896894 3300025914 Bacteria 701
276 Ga0207671_11033018 3300025914 Bacteria 647
277 Ga0207693_10067103 3300025915 Bacteria 2809
278 Ga0207693_10100053 3300025915 Bacteria 2273
279 Ga0207693_10190573 3300025915 Bacteria 1613
280 Ga0207660_10270496 3300025917 Bacteria 1346
281 Ga0207662_10012537 3300025918 Bacteria 4723
282 Ga0207662_10092315 3300025918 Bacteria 1864
283 Ga0207662_10143468 3300025918 Bacteria 1514
284 Ga0207662_10219512 3300025918 Bacteria 1237
285 Ga0207657_10021920 3300025919 Bacteria 5998
286 Ga0207649_10118655 3300025920 Bacteria 1780
287 Ga0207649_10145433 3300025920 Bacteria 1627
288 Ga0207646_10230750 3300025922 Bacteria 1672
289 Ga0207681_10028773 3300025923 Bacteria 3603
290 Ga0207681_10581104 3300025923 Bacteria 924
291 Ga0207694_10227434 3300025924 Bacteria 1523
292 Ga0207650_10027777 3300025925 Bacteria 4053
293 Ga0207650_10029398 3300025925 Bacteria 3951
294 Ga0207659_10027691 3300025926 Bacteria 3841
295 Ga0207659_10355930 3300025926 Bacteria 1216
296 Ga0207659_10463029 3300025926 Bacteria 1069
297 Ga0207687_10020079 3300025927 Bacteria 4431
298 Ga0207687_10083433 3300025927 Bacteria 2314
299 Ga0207687_10330381 3300025927 Bacteria 1236
300 Ga0207700_10037724 3300025928 Bacteria 3502
301 Ga0207700_10414313 3300025928 Bacteria 1182
302 Ga0207644_10152425 3300025931 Bacteria 1790
303 Ga0207644_10350061 3300025931 Bacteria 1199
304 Ga0207644_10930257 3300025931 Bacteria 729
305 Ga0207690_10006529 3300025932 Bacteria 6916
306 Ga0207706_10005860 3300025933 Bacteria 11430
307 Ga0207706_10059462 3300025933 Bacteria 3365
308 Ga0207686_10652957 3300025934 Bacteria 832
309 Ga0207709_10029425 3300025935 Bacteria 3186
310 Ga0207709_10617326 3300025935 Unclassified 860
311 Ga0207670_10008610 3300025936 Bacteria 5769
312 Ga0207670_10133149 3300025936 Bacteria 1824
313 Ga0207670_10289599 3300025936 Bacteria 1279
314 Ga0207669_10043006 3300025937 Bacteria 2642
315 Ga0207669_10118992 3300025937 Bacteria 1788
316 Ga0207704_10882628 3300025938 Bacteria 751
317 Ga0207665_10016432 3300025939 Bacteria 4859
318 Ga0207691_10082085 3300025940 Bacteria 2896
319 Ga0207691_10142907 3300025940 Bacteria 2108
320 Ga0207691_10254298 3300025940 Bacteria 1516
321 Ga0207711_10014189 3300025941 Bacteria 6618
322 Ga0207711_10610964 3300025941 Bacteria 1017
323 Ga0207689_10033455 3300025942 Bacteria 4271
324 Ga0207689_10250916 3300025942 Bacteria 1463
325 Ga0207661_10019047 3300025944 Bacteria 5109
326 Ga0207679_10241223 3300025945 Bacteria 1531
327 Ga0207651_10285439 3300025960 Bacteria 1366
328 Ga0207651_10525958 3300025960 Bacteria 1025
329 Ga0207712_10003449 3300025961 Bacteria 9990
330 Ga0207712_10250865 3300025961 Bacteria 1430
331 Ga0207668_10071058 3300025972 Bacteria 2485
332 Ga0207668_10847575 3300025972 Bacteria 811
333 Ga0207658_10438028 3300025986 Bacteria 1155
334 Ga0207658_10989844 3300025986 Bacteria 767
335 Ga0207677_10222820 3300026023 Bacteria 1514
336 Ga0207677_10746693 3300026023 Bacteria 872
337 Ga0207703_10005201 3300026035 Bacteria 10517
338 Ga0207703_10147337 3300026035 Bacteria 2049
339 Ga0207639_10023555 3300026041 Bacteria 4446
340 Ga0207639_10263378 3300026041 Bacteria 1509
341 Ga0207639_10538913 3300026041 Bacteria 1070
342 Ga0207678_10028564 3300026067 Bacteria 4868
343 Ga0207678_10311129 3300026067 Bacteria 1354
344 Ga0207678_10582836 3300026067 Bacteria 980
345 Ga0207708_10002098 3300026075 Bacteria 14671
346 Ga0207708_10830621 3300026075 Bacteria 797
347 Ga0207702_10114467 3300026078 Bacteria 2404
348 Ga0207702_10119257 3300026078 Bacteria 2359
349 Ga0207641_10210699 3300026088 Bacteria 1797
350 Ga0207648_10004699 3300026089 Bacteria 13964
351 Ga0207648_10085705 3300026089 Bacteria 2748
352 Ga0207676_10006485 3300026095 Bacteria 8265
353 Ga0207676_11437041 3300026095 Bacteria 686
354 Ga0207674_10009568 3300026116 Bacteria 11059
355 Ga0207675_100031234 3300026118 Bacteria 4961
356 Ga0207675_100423152 3300026118 Bacteria 1316
357 Ga0207683_10000979 3300026121 Bacteria 26185
358 Ga0207683_10269810 3300026121 Bacteria 1554
359 Ga0207683_10521694 3300026121 Bacteria 1098
360 Ga0209179_1035642 3300027512 Bacteria 1034
361 Ga0209588_1026172 3300027671 Bacteria 1850
362 Ga0207428_10023410 3300027907 Bacteria 5194
363 Ga0207428_10104950 3300027907 Bacteria 2180
364 Ga0268265_10114982 3300028380 Bacteria 2204
365 Ga0268265_11099290 3300028380 Bacteria 789
366 Ga0268264_10509037 3300028381 Bacteria 1175
367 Ga0268264_11524949 3300028381 Bacteria 679
368 Ga0265324_10052386 3300029957 Bacteria 1402
369 Ga0265332_10017008 3300031238 Bacteria 3208
370 Ga0265325_10095672 3300031241 Bacteria 1459
371 Ga0265340_10011593 3300031247 Bacteria 4680
372 Ga0265340_10026015 3300031247 Bacteria 2961
373 Ga0265340_10047664 3300031247 Bacteria 2086
374 Ga0265340_10237550 3300031247 Bacteria 814
375 Ga0265340_10387648 3300031247 Bacteria 616
376 Ga0265339_10001375 3300031249 Bacteria 18163
377 Ga0265331_10053640 3300031250 Bacteria 1922
378 Ga0265316_10070448 3300031344 Bacteria 2697
379 Ga0265342_10000569 3300031712 Bacteria 38956
380 Ga0307415_100656512 3300032126 Bacteria 941
381 Ga0373948_0041482 3300034817 Bacteria 964
382 Ga0373958_0040803 3300034819 Bacteria 948
383 Ga0373926_0059622 3300035083 Bacteria 1389
384 Ga0373926_0281402 3300035083 Bacteria 648
385 Ga0373928_0040031 3300035084 Bacteria 1073
386 Ga0373949_0016924 3300035090 Bacteria 1639
387 Ga0373923_0003583 3300035111 Bacteria 5002
388 Ga0373932_0165899 3300035112 Bacteria 767
389 Ga0373936_0004843 3300035113 Bacteria 5076
390 Ga0373936_0087025 3300035113 Bacteria 1306
391 Ga0373941_0097299 3300035115 Bacteria 1019
392 Ga0373945_0043778 3300035116 Bacteria 1625
393 Ga0373953_0007533 3300035117 Bacteria 3651
394 Ga0373954_0001419 3300035118 Bacteria 9708
395 Ga0373943_0006089 3300035170 Bacteria 5421
396 Ga0373943_0033990 3300035170 Bacteria 2431
397 Ga0373946_0001531 3300035171 Bacteria 8036
398 Ga0373955_0002037 3300035172 Bacteria 8698
399 Ga0373962_0152550 3300035242 Bacteria 757
400 Ga0373924_0218599 3300035410 Bacteria 842
401 Ga0373931_0020363 3300035691 Bacteria 3319
402 Ga0373931_0022068 3300035691 Bacteria 3200
403 Ga0373935_0000246 3300035692 Bacteria 26648
404 Ga0373935_0274965 3300035692 Bacteria 1184
405 Ga0373927_0002984 3300035695 Bacteria 12270
406 Ga0373927_0005061 3300035695 Bacteria 9123
407 Ga0373933_0030710 3300035724 Bacteria 3112
408 Ga0373947_0000544 3300035725 Bacteria 22066
409 Ga0373947_0027120 3300035725 Bacteria 3351
410 Ga0373947_0048826 3300035725 Bacteria 2540
411 Ga0373947_0261468 3300035725 Bacteria 1147
412 Ga0373937_0000003 3300036401 Bacteria 235408
413 Ga0373937_0569510 3300036401 Bacteria 1076
414 Ga0373937_1324936 3300036401 Bacteria 668
415 Ga0373937_1514696 3300036401 Bacteria 618
416 Ga0373925_0000052 3300037068 Bacteria 127490
417 Ga0373925_0003941 3300037068 Bacteria 11329
418 Ga0373925_0395884 3300037068 Bacteria 1126
419 Ga0436364_0004209 3300037853 Bacteria 23852
420 Ga0436364_0116971 3300037853 Bacteria 1264
421 Ga0436364_0118407 3300037853 Bacteria 937
422 Ga0436364_0405847 3300037853 Bacteria 822
423 Ga0436365_0468207 3300039437 Bacteria 2344
424 Ga0436365_0689847 3300039437 Bacteria 6260
425 Ga0436365_0809682 3300039437 Bacteria 5542
426 Ga0436361_0271802 3300039447 Bacteria 1064
427 Ga0436361_0630759 3300039447 Unclassified 1160
428 Ga0436363_0193075 3300039450 Bacteria 1017
429 Ga0436363_0403809 3300039450 Bacteria 835
430 Ga0436363_0673064 3300039450 Bacteria 863
431 Ga0436362_1121268 3300039453 Bacteria 580
432 Ga0451793_0244858 3300041452 Bacteria 750
433 Ga0451800_1057318 3300041459 Bacteria 554
434 Ga0451839_0664336 3300041496 Bacteria 851
435 Ga0451851_0321573 3300041507 Bacteria 1091
436 Ga0439441_011431 3300042001 Bacteria 1506
437 Ga0439443_010605 3300042003 Bacteria 1337
438 Ga0439446_0136507 3300042156 Bacteria 799
439 Ga0439458_0075062 3300042157 Bacteria 858
440 Ga0439435_0033938 3300042436 Bacteria 1400
441 Ga0439464_0050080 3300042439 Bacteria 1206
442 Ga0439440_0013346 3300042993 Bacteria 1760
443 Ga0453683_0032891 3300044673 Unclassified 3270
444 Ga0466966_0500830 3300044684 Bacteria 731
445 Ga0453684_0032386 3300044712 Bacteria 7317
446 Ga0451576_0242482 3300045051 Unclassified 1883
447 Ga0495627_143028 3300046453 Bacteria 670
448 Ga0495592_0000331 3300046454 Bacteria 39293
449 Ga0495629_0023386 3300046459 Bacteria 4404
450 Ga0495629_0502569 3300046459 Bacteria 817
451 Ga0495638_0009575 3300046460 Bacteria 6786
452 Ga0495641_0030923 3300046461 Bacteria 2562
453 Ga0495641_0200544 3300046461 Bacteria 894
454 Ga0495651_0000733 3300046462 Bacteria 25349
455 Ga0495653_0000071 3300046463 Bacteria 86572
456 Ga0495580_0122525 3300046472 Bacteria 1805
457 Ga0495582_0027755 3300046473 Bacteria 3104
458 Ga0495582_0039798 3300046473 Bacteria 2588
459 Ga0495582_0041190 3300046473 Bacteria 2545
460 Ga0495662_0062909 3300046476 Bacteria 1793
461 Ga0495664_0000162 3300046477 Bacteria 32874
462 Ga0495584_0083951 3300046491 Bacteria 1604
463 Ga0495594_0023885 3300046499 Bacteria 3279
464 Ga0495596_0202334 3300046500 Bacteria 772
465 Ga0495608_0000239 3300046511 Bacteria 39851
466 Ga0495618_0000022 3300046514 Bacteria 127582
467 Ga0495620_0101143 3300046515 Bacteria 1149
468 Ga0495620_0251545 3300046515 Bacteria 674
469 Ga0495628_0000011 3300046516 Bacteria 225267
470 Ga0495628_0665438 3300046516 Bacteria 738
471 Ga0495630_0005679 3300046517 Bacteria 8818
472 Ga0495630_0623853 3300046517 Bacteria 826
473 Ga0495637_0057238 3300046520 Bacteria 1611
474 Ga0495644_0044757 3300046523 Bacteria 1665
475 Ga0495666_0182560 3300046526 Bacteria 968
476 Ga0495652_0000014 3300046529 Bacteria 225484
477 Ga0495665_0049113 3300046531 Bacteria 2237
478 Ga0495665_0067289 3300046531 Bacteria 1890
479 Ga0495640_0000008 3300046533 Bacteria 220320
480 Ga0495640_0220164 3300046533 Bacteria 1197
481 Ga0495586_0479588 3300046535 Bacteria 717
482 Ga0495587_0000347 3300046536 Bacteria 33002
483 Ga0495598_0010690 3300046537 Bacteria 2205
484 Ga0495598_0032441 3300046537 Bacteria 1476
485 Ga0495609_0263836 3300046538 Bacteria 707
486 Ga0495609_0320555 3300046538 Bacteria 629
487 Ga0495621_0013947 3300046539 Bacteria 2536
488 Ga0495597_0200804 3300046542 Bacteria 799
489 Ga0495645_0000007 3300046543 Bacteria 376299
490 Ga0495622_0123314 3300046557 Bacteria 1182
491 Ga0495667_0000013 3300046559 Bacteria 220294
492 Ga0495656_0008675 3300046615 Bacteria 3637
493 Ga0495656_0081504 3300046615 Bacteria 1461
494 Ga0495668_0289082 3300046616 Bacteria 898
495 Ga0495668_0346201 3300046616 Bacteria 816
496 Ga0495634_0031786 3300046642 Bacteria 3633
497 Ga0495635_0000012 3300046663 Bacteria 225271
498 Ga0495635_0789819 3300046663 Bacteria 612
499 Ga0495661_0073697 3300046665 Bacteria 1989
500 Ga0495657_0001891 3300046675 Bacteria 17797
501 Ga0495599_0000008 3300046678 Bacteria 225534
502 Ga0495623_0000500 3300046679 Bacteria 25998
503 Ga0495646_0000004 3300046680 Bacteria 268993
504 Ga0495646_0377026 3300046680 Bacteria 740
505 Ga0495647_0161672 3300046681 Bacteria 965
506 Ga0495658_0031639 3300046683 Bacteria 2883
507 Ga0495658_0043791 3300046683 Bacteria 2505
508 Ga0495658_0209188 3300046683 Bacteria 1218
509 Ga0495669_0023183 3300046684 Bacteria 2701
510 Ga0495613_0081027 3300046689 Bacteria 2359
511 Ga0495613_0085869 3300046689 Bacteria 2283
512 Ga0495624_0069895 3300046690 Bacteria 2186
513 Ga0495624_0238601 3300046690 Bacteria 1100
514 Ga0495671_0194710 3300046692 Bacteria 984
515 Ga0495600_0000084 3300046809 Bacteria 51484
516 Ga0495600_0548270 3300046809 Bacteria 707
517 Ga0495581_0025182 3300047315 Bacteria 3451
518 Ga0495581_0122397 3300047315 Bacteria 1514
519 Ga0495604_0000001 3300047317 Bacteria 708627
520 Ga0495674_0000630 3300047319 Bacteria 33002
521 Ga0495674_0579336 3300047319 Bacteria 891
522 Ga0495676_0049040 3300047321 Bacteria 3399
523 Ga0495676_0301643 3300047321 Bacteria 1080
524 Ga0495680_0017175 3300047322 Bacteria 6189
525 Ga0495680_0615488 3300047322 Bacteria 725
526 Ga0495675_0000023 3300047444 Bacteria 111081
527 Ga0495677_0075465 3300047445 Bacteria 1260
528 Ga0495685_025593 3300047447 Bacteria 2030
529 Ga0495681_0242473 3300047470 Bacteria 715
530 Ga0495684_0000007 3300047471 Bacteria 225614
531 Ga0495593_0000918 3300047673 Bacteria 17120
532 Ga0495602_0000431 3300048088 Bacteria 39378
533 Ga0495615_0175302 3300048090 Bacteria 651
534 Ga0496100_0014276 3300048903 Bacteria 4608
535 Ga0496100_0018049 3300048903 Bacteria 4177
536 Ga0496100_0532473 3300048903 Bacteria 907
537 Ga0496101_0017659 3300048904 Bacteria 4839
538 Ga0496102_0038172 3300048905 Bacteria 4333
539 Ga0496102_0610812 3300048905 Bacteria 1013
540 Ga0496102_0995825 3300048905 Bacteria 759
541 Ga0496103_0001924 3300048906 Bacteria 13472
542 Ga0496103_0006632 3300048906 Bacteria 6906
543 Ga0496104_0002823 3300048907 Bacteria 14978
544 Ga0496104_0004892 3300048907 Bacteria 11682
545 Ga0496104_0030628 3300048907 Bacteria 5000
546 Ga0496104_0436909 3300048907 Bacteria 1220
547 Ga0496104_0523074 3300048907 Bacteria 1097
548 Ga0496105_0001515 3300048908 Bacteria 16423
549 Ga0496105_0004141 3300048908 Bacteria 10879
550 Ga0496105_0012805 3300048908 Bacteria 6647
551 Ga0496105_0021610 3300048908 Bacteria 5209
552 Ga0496106_0002907 3300048909 Bacteria 12741
553 Ga0496106_0052534 3300048909 Bacteria 3075
554 Ga0496106_0479847 3300048909 Bacteria 999
555 Ga0496106_0514473 3300048909 Bacteria 961
556 Ga0496106_0631586 3300048909 Bacteria 856
557 Ga0496107_0007785 3300048910 Bacteria 7399
558 Ga0496107_0486574 3300048910 Bacteria 915
559 Ga0496108_0001028 3300048911 Bacteria 21742
560 Ga0496108_0207454 3300048911 Bacteria 1700
561 Ga0496108_0226988 3300048911 Bacteria 1623
562 Ga0496108_0335084 3300048911 Bacteria 1319
563 Ga0496109_0002430 3300048912 Bacteria 15588
564 Ga0496109_0073398 3300048912 Bacteria 3144
565 Ga0496109_0176992 3300048912 Bacteria 2003
566 Ga0496109_0601199 3300048912 Bacteria 1036
567 Ga0496109_0789560 3300048912 Bacteria 887
568 Ga0496110_0001894 3300048913 Bacteria 15456
569 Ga0496110_0050256 3300048913 Bacteria 3660
570 Ga0496110_0140044 3300048913 Bacteria 2187
571 Ga0496110_0294605 3300048913 Bacteria 1478
572 Ga0496110_0446085 3300048913 Bacteria 1179
573 Ga0496110_0716377 3300048913 Bacteria 903
574 Ga0496111_0000436 3300048914 Bacteria 21122
575 Ga0496111_0002610 3300048914 Bacteria 10913
576 Ga0496112_0004518 3300048915 Bacteria 11815
577 Ga0496112_0064887 3300048915 Bacteria 3603
578 Ga0496113_0001213 3300048916 Bacteria 14132
579 Ga0496113_0019583 3300048916 Bacteria 4737
580 Ga0496113_0105520 3300048916 Bacteria 2188
581 Ga0496114_0184587 3300048917 Bacteria 1822
582 Ga0496114_0486369 3300048917 Bacteria 1092
583 Ga0496114_0871073 3300048917 Bacteria 781
584 Ga0496115_0015654 3300048918 Bacteria 5757
585 Ga0496115_0052838 3300048918 Bacteria 3260
586 Ga0496115_0114013 3300048918 Bacteria 2221
587 Ga0496115_0143695 3300048918 Bacteria 1968
588 Ga0496115_0639172 3300048918 Bacteria 842
589 Ga0501033_0702228 3300049570 Bacteria 688
590 Ga0501034_0765268 3300049571 Bacteria 860
591 Ga0501036_0034152 3300049572 Bacteria 4302
592 Ga0501038_0047665 3300049574 Bacteria 3711
593 Ga0501040_0768246 3300049576 Bacteria 697
594 Ga0501041_0013550 3300049577 Bacteria 4836
595 Ga0501042_0067240 3300049578 Bacteria 2562
596 Ga0501042_0286130 3300049578 Bacteria 1191
597 Ga0501042_1072346 3300049578 Unclassified 587
598 Ga0501043_0413343 3300049579 Bacteria 1018
599 Ga0501043_0950898 3300049579 Bacteria 614
600 Ga0501068_0231429 3300049584 Bacteria 1175
601 Ga0501071_0025028 3300049587 Bacteria 4179
602 Ga0501071_0416714 3300049587 Bacteria 1026
603 Ga0501072_0239009 3300049588 Bacteria 1446
604 Ga0501073_0500409 3300049589 Bacteria 840
605 Ga0501075_0024462 3300049591 Bacteria 4429
606 Ga0501075_0908199 3300049591 Bacteria 669
607 Ga0501076_0024554 3300049592 Bacteria 4660
608 Ga0501077_0111939 3300049593 Bacteria 1730
609 Ga0501077_0331537 3300049593 Bacteria 970
610 Ga0501079_0002446 3300049741 Bacteria 13489
611 Ga0501079_0178249 3300049741 Bacteria 1658
612 Ga0501080_0009475 3300049742 Bacteria 8882
613 Ga0501080_1332763 3300049742 Bacteria 614
614 Ga0501081_0001816 3300049743 Bacteria 13222
615 Ga0501081_0085666 3300049743 Bacteria 2212
616 Ga0501081_0737708 3300049743 Bacteria 740
617 Ga0501083_0047883 3300049744 Bacteria 2887
618 Ga0501083_0115146 3300049744 Bacteria 1765
619 Ga0501283_053885 3300049779 Bacteria 717
620 Ga0501035_0091216 3300049822 Bacteria 2682
621 Ga0501045_0059448 3300049824 Bacteria 2800
622 Ga0501045_0644964 3300049824 Bacteria 783
623 Ga0501045_0896502 3300049824 Bacteria 652
624 nmdc:mga03683_70372_c1 3300050489 Bacteria 1495
625 nmdc:mga03n38_403599_c1 3300050490 Bacteria 753
626 nmdc:mga00v17_61181_c1 3300050491 Bacteria 2314
627 nmdc:mga0yw44_103484_c1 3300050492 Bacteria 1816
628 nmdc:mga0yw44_20097_c1 3300050492 Bacteria 3700
629 nmdc:mga0yw44_47560_c1 3300050492 Bacteria 2583
630 nmdc:mga0yw44_82900_c1 3300050492 Bacteria 2013
631 nmdc:mga0k408_560383_c1 3300050493 Bacteria 675
632 nmdc:mga0k408_7910_c1 3300050493 Bacteria 5693
633 nmdc:mga06z11_180503_c1 3300050494 Bacteria 1217
634 nmdc:mga06z11_48917_c1 3300050494 Bacteria 2154
635 nmdc:mga04h51_220919_c1 3300050495 Bacteria 751
636 nmdc:mga07m45_295972_c1 3300050496 Bacteria 941
637 nmdc:mga05p37_114859_c1 3300050507 Bacteria 3309
638 nmdc:mga05p37_11760_c1 3300050507 Bacteria 10433
639 nmdc:mga05p37_1336385_c1 3300050507 Bacteria 727
640 nmdc:mga05p37_68011_c1 3300050507 Bacteria 4381
641 nmdc:mga05p37_950322_c1 3300050507 Bacteria 920
642 nmdc:mga09592_125686_c1 3300050508 Bacteria 2204
643 nmdc:mga09592_74608_c1 3300050508 Bacteria 2882
644 nmdc:mga09592_94047_c1 3300050508 Bacteria 2563
645 nmdc:mga0qj67_1081226_c1 3300050509 Bacteria 627
646 nmdc:mga0qj67_134075_c1 3300050509 Bacteria 2006
647 nmdc:mga0qj67_144_c1 3300050509 Bacteria 48167
648 nmdc:mga0qj67_625769_c1 3300050509 Bacteria 860
649 nmdc:mga0qj67_657404_c1 3300050509 Bacteria 836
650 nmdc:mga06r32_37645_c1 3300050510 Bacteria 4576
651 nmdc:mga06r32_410386_c1 3300050510 Bacteria 1336
652 nmdc:mga06r32_575295_c1 3300050510 Bacteria 1099
653 nmdc:mga06r32_593371_c1 3300050510 Bacteria 1079
654 nmdc:mga08y16_1501240_c1 3300050511 Bacteria 634
655 nmdc:mga08y16_293814_c1 3300050511 Bacteria 1675
656 nmdc:mga08y16_31336_c1 3300050511 Bacteria 3026
657 nmdc:mga08y16_31728_c1 3300050511 Bacteria 5555
658 nmdc:mga0n895_17990_c1 3300050512 Bacteria 6531
659 nmdc:mga0n895_4803_c1 3300050512 Bacteria 11185
660 nmdc:mga0rr50_235935_c1 3300050513 Bacteria 1515
661 nmdc:mga08x19_21_c1 3300050514 Bacteria 302369
662 nmdc:mga08x19_277959_c1 3300050514 Unclassified 1160
663 Ga0495601_0000014 3300053077 Bacteria 220318
664 Ga0495612_0000123 3300053078 Bacteria 32874
665 Ga0500610_0328149 3300053079 Bacteria 660
666 Ga0495655_0011770 3300053083 Bacteria 1766
667 Ga0495655_0113560 3300053083 Bacteria 817
668 Ga0495595_0000169 3300053084 Bacteria 25717
669 Ga0495619_0000006 3300053085 Bacteria 384835
670 Ga0495619_0058304 3300053085 Bacteria 2563
671 Ga0495619_0185834 3300053085 Bacteria 1438
672 Ga0500651_0183707 3300053093 Bacteria 1241
673 Ga0500641_0053745 3300053096 Bacteria 1663
674 Ga0500641_0154990 3300053096 Bacteria 988
675 Ga0500658_0014176 3300053134 Bacteria 2949
676 Ga0500616_0003041 3300053153 Bacteria 13199
677 Ga0500622_0006576 3300053156 Bacteria 6712
678 Ga0500636_0198665 3300053177 Bacteria 1063
679 Ga0500645_111678 3300053730 Bacteria 767
680 Ga0501084_0047966 3300054114 Bacteria 3577
681 Ga0501082_0005078 3300060353 Bacteria 11472
682 Ga0501082_0082291 3300060353 Bacteria 2778
683 Ga0501082_0348961 3300060353 Bacteria 1290
684 Ga0530510_0092508 3300061734 Bacteria 2207

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006042 Ga0075368_10080575 Ga0075368_100805752 160
2 3300006353 Ga0075370_10026736 Ga0075370_100267363 160
3 3300009553 Ga0105249_10882682 Ga0105249_108826821 160
4 3300028380 Ga0268265_11099290 Ga0268265_110992901 160
5 3300050494 nmdc:mga06z11_180503_c1 nmdc:mga06z11_180503_c1_35_562 160
6 3300050495 nmdc:mga04h51_220919_c1 nmdc:mga04h51_220919_c1_35_562 160
7 3300025913 Ga0207695_10870733 Ga0207695_108707332 161
8 3300026121 Ga0207683_10521694 Ga0207683_105216942 162
9 3300032126 Ga0307415_100656512 Ga0307415_1006565122 162
10 3300049572 Ga0501036_0034152 Ga0501036_0034152_1886_2380 162
11 3300049574 Ga0501038_0047665 Ga0501038_0047665_194_688 162
12 3300049576 Ga0501040_0768246 Ga0501040_0768246_98_592 162
13 3300049577 Ga0501041_0013550 Ga0501041_0013550_1389_1883 162
14 3300049578 Ga0501042_0067240 Ga0501042_0067240_11_505 162
15 3300049578 Ga0501042_1072346 Ga0501042_1072346_79_573 162
16 3300049579 Ga0501043_0413343 Ga0501043_0413343_150_644 162
17 3300049587 Ga0501071_0025028 Ga0501071_0025028_324_818 162
18 3300049591 Ga0501075_0024462 Ga0501075_0024462_3523_4017 162
19 3300049592 Ga0501076_0024554 Ga0501076_0024554_1526_2020 162
20 3300049593 Ga0501077_0111939 Ga0501077_0111939_96_590 162
21 3300049741 Ga0501079_0002446 Ga0501079_0002446_6587_7081 162
22 3300049742 Ga0501080_0009475 Ga0501080_0009475_954_1448 162
23 3300049743 Ga0501081_0001816 Ga0501081_0001816_5080_5574 162
24 3300049743 Ga0501081_0085666 Ga0501081_0085666_918_1412 162
25 3300049779 Ga0501283_053885 Ga0501283_053885_13_516 162
26 3300049822 Ga0501035_0091216 Ga0501035_0091216_30_524 162
27 3300049824 Ga0501045_0059448 Ga0501045_0059448_1917_2411 162
28 3300054114 Ga0501084_0047966 Ga0501084_0047966_2996_3490 162
29 3300060353 Ga0501082_0005078 Ga0501082_0005078_3400_3894 162
30 3300005547 Ga0070693_100617792 Ga0070693_1006177921 164
31 3300005614 Ga0068856_100148988 Ga0068856_1001489882 164
32 3300013100 Ga0157373_10076208 Ga0157373_100762082 164
33 3300013307 Ga0157372_10024327 Ga0157372_100243272 164
34 3300026078 Ga0207702_10119257 Ga0207702_101192572 164
35 3300034817 Ga0373948_0041482 Ga0373948_0041482_397_897 164
36 3300005471 Ga0070698_100205702 Ga0070698_1002057022 166
37 3300048916 Ga0496113_0105520 Ga0496113_0105520_1286_1789 166
38 3300049742 Ga0501080_1332763 Ga0501080_1332763_84_584 166
39 3300049743 Ga0501081_0737708 Ga0501081_0737708_55_555 166
40 3300053153 Ga0500616_0003041 Ga0500616_0003041_11413_11922 166
41 3300005343 Ga0070687_100423051 Ga0070687_1004230511 167
42 3300005436 Ga0070713_100721208 Ga0070713_1007212081 167
43 3300005438 Ga0070701_10023853 Ga0070701_100238534 167
44 3300005440 Ga0070705_100321457 Ga0070705_1003214572 167
45 3300005617 Ga0068859_100069488 Ga0068859_1000694883 167
46 3300005842 Ga0068858_100098733 Ga0068858_1000987333 167
47 3300006931 Ga0097620_100069489 Ga0097620_1000694893 167
48 3300009148 Ga0105243_10120358 Ga0105243_101203582 167
49 3300025918 Ga0207662_10219512 Ga0207662_102195122 167
50 3300029957 Ga0265324_10052386 Ga0265324_100523862 167
51 3300031247 Ga0265340_10387648 Ga0265340_103876482 167
52 3300046680 Ga0495646_0377026 Ga0495646_0377026_36_563 167
53 3300049587 Ga0501071_0416714 Ga0501071_0416714_206_709 167
54 3300031344 Ga0265316_10070448 Ga0265316_100704483 168
55 3300044673 Ga0453683_0032891 Ga0453683_0032891_238_753 168
56 3300044712 Ga0453684_0032386 Ga0453684_0032386_5093_5608 168
57 3300045051 Ga0451576_0242482 Ga0451576_0242482_511_1026 168
58 3300005985 Ga0081539_10014262 Ga0081539_100142622 169
59 3300009094 Ga0111539_11321080 Ga0111539_113210802 169
60 3300050511 nmdc:mga08y16_1501240_c1 nmdc:mga08y16_1501240_c1_34_552 169
61 3300005353 Ga0070669_100481419 Ga0070669_1004814192 170
62 3300005456 Ga0070678_100569279 Ga0070678_1005692791 170
63 3300005549 Ga0070704_101264767 Ga0070704_1012647671 170
64 3300006846 Ga0075430_100677643 Ga0075430_1006776432 170
65 3300006847 Ga0075431_100112076 Ga0075431_1001120762 170
66 3300006847 Ga0075431_101211004 Ga0075431_1012110041 170
67 3300009094 Ga0111539_10211335 Ga0111539_102113352 170
68 3300009147 Ga0114129_10464518 Ga0114129_104645182 170
69 3300009147 Ga0114129_12284742 Ga0114129_122847421 170
70 3300025923 Ga0207681_10581104 Ga0207681_105811042 170
71 3300026121 Ga0207683_10269810 Ga0207683_102698102 170
72 3300044684 Ga0466966_0500830 Ga0466966_0500830_99_614 170
73 3300048909 Ga0496106_0479847 Ga0496106_0479847_76_588 170
74 3300050509 nmdc:mga0qj67_134075_c1 nmdc:mga0qj67_134075_c1_58_570 170
75 3300050510 nmdc:mga06r32_575295_c1 nmdc:mga06r32_575295_c1_554_1066 170
76 3300050510 nmdc:mga06r32_593371_c1 nmdc:mga06r32_593371_c1_98_610 170
77 3300050511 nmdc:mga08y16_293814_c1 nmdc:mga08y16_293814_c1_975_1487 170
78 3300006846 Ga0075430_100139470 Ga0075430_1001394702 171
79 3300006880 Ga0075429_100892749 Ga0075429_1008927491 171
80 3300009147 Ga0114129_11256463 Ga0114129_112564632 171
81 3300037853 Ga0436364_0116971 Ga0436364_0116971_615_1223 171
82 3300049824 Ga0501045_0896502 Ga0501045_0896502_82_609 171
83 3300050507 nmdc:mga05p37_950322_c1 nmdc:mga05p37_950322_c1_269_790 171
84 3300050508 nmdc:mga09592_125686_c1 nmdc:mga09592_125686_c1_1572_2093 171
85 3300005459 Ga0068867_100807287 Ga0068867_1008072871 172
86 3300005546 Ga0070696_100022673 Ga0070696_1000226732 172
87 3300005549 Ga0070704_100001844 Ga0070704_10000184410 172
88 3300006048 Ga0075363_100171698 Ga0075363_1001716981 172
89 3300006175 Ga0070712_100064607 Ga0070712_1000646072 172
90 3300006195 Ga0075366_10661938 Ga0075366_106619381 172
91 3300009094 Ga0111539_12315861 Ga0111539_123158611 172
92 3300009098 Ga0105245_10478396 Ga0105245_104783962 172
93 3300009148 Ga0105243_10285292 Ga0105243_102852922 172
94 3300009553 Ga0105249_10053275 Ga0105249_100532755 172
95 3300010159 Ga0099796_10038454 Ga0099796_100384542 172
96 3300011119 Ga0105246_11232165 Ga0105246_112321651 172
97 3300025915 Ga0207693_10190573 Ga0207693_101905731 172
98 3300025927 Ga0207687_10330381 Ga0207687_103303812 172
99 3300025935 Ga0207709_10617326 Ga0207709_106173262 172
100 3300025961 Ga0207712_10003449 Ga0207712_100034498 172
101 3300025972 Ga0207668_10847575 Ga0207668_108475752 172
102 3300026095 Ga0207676_11437041 Ga0207676_114370411 172
103 3300027512 Ga0209179_1035642 Ga0209179_10356422 172
104 3300027907 Ga0207428_10104950 Ga0207428_101049502 172
105 3300031247 Ga0265340_10011593 Ga0265340_100115932 172
106 3300042003 Ga0439443_010605 Ga0439443_010605_796_1314 172
107 3300042436 Ga0439435_0033938 Ga0439435_0033938_846_1364 172
108 3300042439 Ga0439464_0050080 Ga0439464_0050080_61_579 172
109 3300042993 Ga0439440_0013346 Ga0439440_0013346_1045_1563 172
110 3300048911 Ga0496108_0226988 Ga0496108_0226988_950_1468 172
111 3300048913 Ga0496110_0294605 Ga0496110_0294605_798_1316 172
112 3300049571 Ga0501034_0765268 Ga0501034_0765268_199_717 172
113 3300050493 nmdc:mga0k408_560383_c1 nmdc:mga0k408_560383_c1_101_619 172
114 3300005330 Ga0070690_100380331 Ga0070690_1003803311 173
115 3300005336 Ga0070680_100019906 Ga0070680_1000199063 173
116 3300005339 Ga0070660_100034493 Ga0070660_1000344934 173
117 3300005340 Ga0070689_100122565 Ga0070689_1001225651 173
118 3300005344 Ga0070661_100184432 Ga0070661_1001844321 173
119 3300005355 Ga0070671_100314078 Ga0070671_1003140782 173
120 3300005367 Ga0070667_100910209 Ga0070667_1009102092 173
121 3300005457 Ga0070662_100080077 Ga0070662_1000800773 173
122 3300005536 Ga0070697_100009157 Ga0070697_1000091577 173
123 3300005545 Ga0070695_100015964 Ga0070695_1000159642 173
124 3300005564 Ga0070664_100134650 Ga0070664_1001346503 173
125 3300005614 Ga0068856_100174392 Ga0068856_1001743922 173
126 3300005617 Ga0068859_100685491 Ga0068859_1006854912 173
127 3300005981 Ga0081538_10000146 Ga0081538_1000014611 173
128 3300006914 Ga0075436_100004215 Ga0075436_1000042157 173
129 3300006931 Ga0097620_100685443 Ga0097620_1006854432 173
130 3300007076 Ga0075435_100175400 Ga0075435_1001754004 173
131 3300009093 Ga0105240_10272542 Ga0105240_102725423 173
132 3300009098 Ga0105245_10344848 Ga0105245_103448482 173
133 3300009176 Ga0105242_10244498 Ga0105242_102444982 173
134 3300013102 Ga0157371_10015546 Ga0157371_100155464 173
135 3300014326 Ga0157380_10208632 Ga0157380_102086322 173
136 3300024225 Ga0224572_1044952 Ga0224572_10449522 173
137 3300025901 Ga0207688_10351940 Ga0207688_103519401 173
138 3300025909 Ga0207705_10231510 Ga0207705_102315102 173
139 3300025912 Ga0207707_10009131 Ga0207707_1000913112 173
140 3300025913 Ga0207695_10700158 Ga0207695_107001582 173
141 3300025917 Ga0207660_10270496 Ga0207660_102704962 173
142 3300025919 Ga0207657_10021920 Ga0207657_100219205 173
143 3300025920 Ga0207649_10145433 Ga0207649_101454332 173
144 3300025927 Ga0207687_10083433 Ga0207687_100834333 173
145 3300025931 Ga0207644_10930257 Ga0207644_109302572 173
146 3300025933 Ga0207706_10059462 Ga0207706_100594623 173
147 3300025945 Ga0207679_10241223 Ga0207679_102412232 173
148 3300026067 Ga0207678_10311129 Ga0207678_103111293 173
149 3300026078 Ga0207702_10114467 Ga0207702_101144673 173
150 3300035112 Ga0373932_0165899 Ga0373932_0165899_20_541 173
151 3300035113 Ga0373936_0087025 Ga0373936_0087025_144_665 173
152 3300035725 Ga0373947_0027120 Ga0373947_0027120_980_1501 173
153 3300046472 Ga0495580_0122525 Ga0495580_0122525_643_1164 173
154 3300046476 Ga0495662_0062909 Ga0495662_0062909_1236_1757 173
155 3300046499 Ga0495594_0023885 Ga0495594_0023885_1454_1975 173
156 3300046538 Ga0495609_0320555 Ga0495609_0320555_38_559 173
157 3300046683 Ga0495658_0031639 Ga0495658_0031639_1153_1674 173
158 3300046690 Ga0495624_0069895 Ga0495624_0069895_253_774 173
159 3300047315 Ga0495581_0025182 Ga0495581_0025182_2890_3411 173
160 3300047319 Ga0495674_0579336 Ga0495674_0579336_143_664 173
161 3300050513 nmdc:mga0rr50_235935_c1 nmdc:mga0rr50_235935_c1_85_621 173
162 3300050514 nmdc:mga08x19_21_c1 nmdc:mga08x19_21_c1_135391_135927 173
163 3300003203 JGI25406J46586_10027958 JGI25406J46586_100279582 174
164 3300005290 Ga0065712_10122210 Ga0065712_101222101 174
165 3300005328 Ga0070676_10138121 Ga0070676_101381212 174
166 3300005331 Ga0070670_100053933 Ga0070670_1000539333 174
167 3300005331 Ga0070670_100411419 Ga0070670_1004114192 174
168 3300005333 Ga0070677_10043840 Ga0070677_100438402 174
169 3300005336 Ga0070680_100220691 Ga0070680_1002206911 174
170 3300005338 Ga0068868_100238478 Ga0068868_1002384782 174
171 3300005343 Ga0070687_100152993 Ga0070687_1001529932 174
172 3300005344 Ga0070661_100666805 Ga0070661_1006668051 174
173 3300005354 Ga0070675_100224860 Ga0070675_1002248602 174
174 3300005355 Ga0070671_100207907 Ga0070671_1002079072 174
175 3300005356 Ga0070674_100235344 Ga0070674_1002353442 174
176 3300005364 Ga0070673_100111922 Ga0070673_1001119222 174
177 3300005367 Ga0070667_100038285 Ga0070667_1000382853 174
178 3300005367 Ga0070667_101387234 Ga0070667_1013872341 174
179 3300005438 Ga0070701_10526992 Ga0070701_105269921 174
180 3300005466 Ga0070685_10007977 Ga0070685_100079775 174
181 3300005466 Ga0070685_10406784 Ga0070685_104067842 174
182 3300005543 Ga0070672_100075175 Ga0070672_1000751752 174
183 3300005544 Ga0070686_100465485 Ga0070686_1004654852 174
184 3300005577 Ga0068857_100115048 Ga0068857_1001150482 174
185 3300005617 Ga0068859_100242571 Ga0068859_1002425712 174
186 3300005617 Ga0068859_100370310 Ga0068859_1003703102 174
187 3300005617 Ga0068859_100380511 Ga0068859_1003805112 174
188 3300005618 Ga0068864_100158300 Ga0068864_1001583002 174
189 3300005719 Ga0068861_100693167 Ga0068861_1006931672 174
190 3300005985 Ga0081539_10040148 Ga0081539_100401483 174
191 3300006048 Ga0075363_100350168 Ga0075363_1003501682 174
192 3300006177 Ga0075362_10020342 Ga0075362_100203423 174
193 3300006195 Ga0075366_10115064 Ga0075366_101150641 174
194 3300006844 Ga0075428_100861797 Ga0075428_1008617971 174
195 3300006846 Ga0075430_100000583 Ga0075430_10000058319 174
196 3300006881 Ga0068865_100296132 Ga0068865_1002961322 174
197 3300006931 Ga0097620_100242557 Ga0097620_1002425572 174
198 3300006931 Ga0097620_100370288 Ga0097620_1003702882 174
199 3300006931 Ga0097620_100380494 Ga0097620_1003804942 174
200 3300009093 Ga0105240_10180116 Ga0105240_101801162 174
201 3300009098 Ga0105245_10382313 Ga0105245_103823131 174
202 3300009101 Ga0105247_10017488 Ga0105247_100174882 174
203 3300009147 Ga0114129_10290189 Ga0114129_102901892 174
204 3300009148 Ga0105243_10392293 Ga0105243_103922932 174
205 3300009148 Ga0105243_10458637 Ga0105243_104586372 174
206 3300009174 Ga0105241_10211087 Ga0105241_102110872 174
207 3300009177 Ga0105248_10395254 Ga0105248_103952542 174
208 3300009545 Ga0105237_10797347 Ga0105237_107973472 174
209 3300009551 Ga0105238_10140449 Ga0105238_101404493 174
210 3300009553 Ga0105249_10255227 Ga0105249_102552272 174
211 3300009553 Ga0105249_11892871 Ga0105249_118928711 174
212 3300011119 Ga0105246_10069686 Ga0105246_100696862 174
213 3300011119 Ga0105246_10193564 Ga0105246_101935642 174
214 3300013297 Ga0157378_10096003 Ga0157378_100960032 174
215 3300013306 Ga0163162_10840882 Ga0163162_108408822 174
216 3300013308 Ga0157375_10523055 Ga0157375_105230552 174
217 3300013308 Ga0157375_10723075 Ga0157375_107230751 174
218 3300014325 Ga0163163_10192445 Ga0163163_101924451 174
219 3300014325 Ga0163163_10303310 Ga0163163_103033101 174
220 3300017792 Ga0163161_10260789 Ga0163161_102607892 174
221 3300025893 Ga0207682_10005543 Ga0207682_100055436 174
222 3300025901 Ga0207688_10094238 Ga0207688_100942382 174
223 3300025907 Ga0207645_10107807 Ga0207645_101078072 174
224 3300025908 Ga0207643_10444541 Ga0207643_104445412 174
225 3300025914 Ga0207671_10896894 Ga0207671_108968941 174
226 3300025914 Ga0207671_11033018 Ga0207671_110330181 174
227 3300025918 Ga0207662_10092315 Ga0207662_100923152 174
228 3300025918 Ga0207662_10143468 Ga0207662_101434682 174
229 3300025923 Ga0207681_10028773 Ga0207681_100287732 174
230 3300025924 Ga0207694_10227434 Ga0207694_102274342 174
231 3300025926 Ga0207659_10355930 Ga0207659_103559302 174
232 3300025926 Ga0207659_10463029 Ga0207659_104630292 174
233 3300025931 Ga0207644_10152425 Ga0207644_101524252 174
234 3300025934 Ga0207686_10652957 Ga0207686_106529572 174
235 3300025935 Ga0207709_10029425 Ga0207709_100294251 174
236 3300025936 Ga0207670_10133149 Ga0207670_101331492 174
237 3300025937 Ga0207669_10118992 Ga0207669_101189922 174
238 3300025938 Ga0207704_10882628 Ga0207704_108826282 174
239 3300025940 Ga0207691_10082085 Ga0207691_100820852 174
240 3300025940 Ga0207691_10254298 Ga0207691_102542982 174
241 3300025941 Ga0207711_10610964 Ga0207711_106109642 174
242 3300025942 Ga0207689_10250916 Ga0207689_102509162 174
243 3300025960 Ga0207651_10285439 Ga0207651_102854392 174
244 3300025960 Ga0207651_10525958 Ga0207651_105259582 174
245 3300025961 Ga0207712_10250865 Ga0207712_102508651 174
246 3300025986 Ga0207658_10989844 Ga0207658_109898442 174
247 3300026023 Ga0207677_10222820 Ga0207677_102228202 174
248 3300026023 Ga0207677_10746693 Ga0207677_107466931 174
249 3300026041 Ga0207639_10263378 Ga0207639_102633782 174
250 3300026041 Ga0207639_10538913 Ga0207639_105389132 174
251 3300026089 Ga0207648_10085705 Ga0207648_100857052 174
252 3300026116 Ga0207674_10009568 Ga0207674_1000956811 174
253 3300026118 Ga0207675_100423152 Ga0207675_1004231522 174
254 3300026121 Ga0207683_10000979 Ga0207683_1000097930 174
255 3300037853 Ga0436364_0118407 Ga0436364_0118407_64_597 174
256 3300037853 Ga0436364_0405847 Ga0436364_0405847_61_660 174
257 3300039437 Ga0436365_0809682 Ga0436365_0809682_48_572 174
258 3300039450 Ga0436363_0403809 Ga0436363_0403809_10_534 174
259 3300042001 Ga0439441_011431 Ga0439441_011431_89_613 174
260 3300042156 Ga0439446_0136507 Ga0439446_0136507_86_610 174
261 3300046460 Ga0495638_0009575 Ga0495638_0009575_3076_3600 174
262 3300046537 Ga0495598_0032441 Ga0495598_0032441_239_763 174
263 3300046539 Ga0495621_0013947 Ga0495621_0013947_1160_1684 174
264 3300046615 Ga0495656_0081504 Ga0495656_0081504_394_918 174
265 3300046616 Ga0495668_0346201 Ga0495668_0346201_17_541 174
266 3300047447 Ga0495685_025593 Ga0495685_025593_357_881 174
267 3300048913 Ga0496110_0716377 Ga0496110_0716377_157_681 174
268 3300048918 Ga0496115_0639172 Ga0496115_0639172_172_696 174
269 3300049588 Ga0501072_0239009 Ga0501072_0239009_136_660 174
270 3300049744 Ga0501083_0047883 Ga0501083_0047883_1943_2467 174
271 3300049744 Ga0501083_0115146 Ga0501083_0115146_435_959 174
272 3300050489 nmdc:mga03683_70372_c1 nmdc:mga03683_70372_c1_177_701 174
273 3300050490 nmdc:mga03n38_403599_c1 nmdc:mga03n38_403599_c1_177_701 174
274 3300050491 nmdc:mga00v17_61181_c1 nmdc:mga00v17_61181_c1_1415_1939 174
275 3300050493 nmdc:mga0k408_7910_c1 nmdc:mga0k408_7910_c1_3761_4285 174
276 3300050496 nmdc:mga07m45_295972_c1 nmdc:mga07m45_295972_c1_131_655 174
277 3300050507 nmdc:mga05p37_114859_c1 nmdc:mga05p37_114859_c1_960_1484 174
278 3300050509 nmdc:mga0qj67_1081226_c1 nmdc:mga0qj67_1081226_c1_77_601 174
279 3300050509 nmdc:mga0qj67_144_c1 nmdc:mga0qj67_144_c1_39779_40303 174
280 3300053079 Ga0500610_0328149 Ga0500610_0328149_111_635 174
281 3300053083 Ga0495655_0113560 Ga0495655_0113560_200_724 174
282 3300053093 Ga0500651_0183707 Ga0500651_0183707_204_728 174
283 3300053096 Ga0500641_0154990 Ga0500641_0154990_307_831 174
284 3300053134 Ga0500658_0014176 Ga0500658_0014176_1234_1758 174
285 3300053177 Ga0500636_0198665 Ga0500636_0198665_418_942 174
286 3300060353 Ga0501082_0082291 Ga0501082_0082291_287_811 174
287 3300002070 JGI24750J21931_1003979 JGI24750J21931_10039792 175
288 3300002077 JGI24744J21845_10009127 JGI24744J21845_100091272 175
289 3300002459 JGI24751J29686_10004761 JGI24751J29686_100047612 175
290 3300005327 Ga0070658_10351382 Ga0070658_103513821 175
291 3300005329 Ga0070683_100270444 Ga0070683_1002704442 175
292 3300005330 Ga0070690_100041527 Ga0070690_1000415271 175
293 3300005331 Ga0070670_100026862 Ga0070670_1000268624 175
294 3300005335 Ga0070666_10072282 Ga0070666_100722823 175
295 3300005338 Ga0068868_100004148 Ga0068868_10000414810 175
296 3300005340 Ga0070689_100004242 Ga0070689_1000042423 175
297 3300005340 Ga0070689_100383534 Ga0070689_1003835342 175
298 3300005343 Ga0070687_100145372 Ga0070687_1001453722 175
299 3300005345 Ga0070692_10155262 Ga0070692_101552622 175
300 3300005347 Ga0070668_100007545 Ga0070668_1000075456 175
301 3300005347 Ga0070668_100097606 Ga0070668_1000976062 175
302 3300005353 Ga0070669_100027678 Ga0070669_1000276782 175
303 3300005354 Ga0070675_100150284 Ga0070675_1001502842 175
304 3300005355 Ga0070671_100108048 Ga0070671_1001080482 175
305 3300005364 Ga0070673_100181988 Ga0070673_1001819882 175
306 3300005364 Ga0070673_101226332 Ga0070673_1012263321 175
307 3300005367 Ga0070667_100020104 Ga0070667_1000201044 175
308 3300005367 Ga0070667_100131123 Ga0070667_1001311233 175
309 3300005367 Ga0070667_101027359 Ga0070667_1010273591 175
310 3300005434 Ga0070709_10073862 Ga0070709_100738621 175
311 3300005435 Ga0070714_100183202 Ga0070714_1001832022 175
312 3300005435 Ga0070714_100554465 Ga0070714_1005544652 175
313 3300005436 Ga0070713_100051720 Ga0070713_1000517205 175
314 3300005436 Ga0070713_100097916 Ga0070713_1000979164 175
315 3300005437 Ga0070710_10035150 Ga0070710_100351503 175
316 3300005437 Ga0070710_10075928 Ga0070710_100759282 175
317 3300005438 Ga0070701_10036830 Ga0070701_100368303 175
318 3300005439 Ga0070711_100898707 Ga0070711_1008987071 175
319 3300005440 Ga0070705_100304212 Ga0070705_1003042122 175
320 3300005441 Ga0070700_100001737 Ga0070700_1000017374 175
321 3300005444 Ga0070694_100722551 Ga0070694_1007225511 175
322 3300005455 Ga0070663_100060419 Ga0070663_1000604192 175
323 3300005455 Ga0070663_100431890 Ga0070663_1004318901 175
324 3300005457 Ga0070662_100692017 Ga0070662_1006920171 175
325 3300005459 Ga0068867_100007687 Ga0068867_1000076877 175
326 3300005468 Ga0070707_100278025 Ga0070707_1002780252 175
327 3300005471 Ga0070698_100138153 Ga0070698_1001381532 175
328 3300005471 Ga0070698_100699697 Ga0070698_1006996971 175
329 3300005518 Ga0070699_100020079 Ga0070699_1000200795 175
330 3300005518 Ga0070699_100620378 Ga0070699_1006203781 175
331 3300005530 Ga0070679_100970310 Ga0070679_1009703101 175
332 3300005535 Ga0070684_100075565 Ga0070684_1000755652 175
333 3300005543 Ga0070672_100525359 Ga0070672_1005253592 175
334 3300005544 Ga0070686_100675000 Ga0070686_1006750002 175
335 3300005545 Ga0070695_100630242 Ga0070695_1006302422 175
336 3300005546 Ga0070696_100897459 Ga0070696_1008974591 175
337 3300005549 Ga0070704_100384246 Ga0070704_1003842462 175
338 3300005564 Ga0070664_100131849 Ga0070664_1001318493 175
339 3300005564 Ga0070664_100158765 Ga0070664_1001587652 175
340 3300005615 Ga0070702_100001567 Ga0070702_1000015679 175
341 3300005615 Ga0070702_100211050 Ga0070702_1002110502 175
342 3300005616 Ga0068852_100096596 Ga0068852_1000965963 175
343 3300005618 Ga0068864_100021281 Ga0068864_1000212815 175
344 3300005718 Ga0068866_10013349 Ga0068866_100133492 175
345 3300005719 Ga0068861_100088205 Ga0068861_1000882054 175
346 3300005834 Ga0068851_10135286 Ga0068851_101352861 175
347 3300005840 Ga0068870_10002141 Ga0068870_100021414 175
348 3300005841 Ga0068863_100300488 Ga0068863_1003004882 175
349 3300005842 Ga0068858_100006326 Ga0068858_1000063268 175
350 3300005842 Ga0068858_100553498 Ga0068858_1005534982 175
351 3300005843 Ga0068860_100028301 Ga0068860_1000283013 175
352 3300005843 Ga0068860_100513631 Ga0068860_1005136311 175
353 3300005844 Ga0068862_100012692 Ga0068862_1000126923 175
354 3300005937 Ga0081455_10003757 Ga0081455_1000375714 175
355 3300005937 Ga0081455_10030575 Ga0081455_100305754 175
356 3300005937 Ga0081455_10046628 Ga0081455_100466282 175
357 3300005981 Ga0081538_10021756 Ga0081538_100217564 175
358 3300005983 Ga0081540_1012665 Ga0081540_10126657 175
359 3300006028 Ga0070717_10134085 Ga0070717_101340852 175
360 3300006028 Ga0070717_10643995 Ga0070717_106439952 175
361 3300006038 Ga0075365_10053135 Ga0075365_100531352 175
362 3300006038 Ga0075365_10107326 Ga0075365_101073262 175
363 3300006038 Ga0075365_10497928 Ga0075365_104979281 175
364 3300006048 Ga0075363_100386543 Ga0075363_1003865432 175
365 3300006051 Ga0075364_10113068 Ga0075364_101130682 175
366 3300006163 Ga0070715_10007987 Ga0070715_100079872 175
367 3300006173 Ga0070716_100038326 Ga0070716_1000383262 175
368 3300006173 Ga0070716_100644051 Ga0070716_1006440512 175
369 3300006175 Ga0070712_100116633 Ga0070712_1001166332 175
370 3300006175 Ga0070712_100232547 Ga0070712_1002325472 175
371 3300006178 Ga0075367_10073575 Ga0075367_100735753 175
372 3300006178 Ga0075367_10165656 Ga0075367_101656562 175
373 3300006178 Ga0075367_10224412 Ga0075367_102244122 175
374 3300006237 Ga0097621_100010895 Ga0097621_1000108951 175
375 3300006358 Ga0068871_100271209 Ga0068871_1002712091 175
376 3300006844 Ga0075428_100085901 Ga0075428_1000859012 175
377 3300006847 Ga0075431_100220278 Ga0075431_1002202782 175
378 3300006847 Ga0075431_100924884 Ga0075431_1009248841 175
379 3300006871 Ga0075434_100010388 Ga0075434_1000103885 175
380 3300006871 Ga0075434_100164343 Ga0075434_1001643432 175
381 3300006880 Ga0075429_100153262 Ga0075429_1001532622 175
382 3300006880 Ga0075429_100897059 Ga0075429_1008970592 175
383 3300006914 Ga0075436_100408703 Ga0075436_1004087032 175
384 3300007076 Ga0075435_101078401 Ga0075435_1010784012 175
385 3300007265 Ga0099794_10060226 Ga0099794_100602262 175
386 3300009094 Ga0111539_10013535 Ga0111539_100135359 175
387 3300009094 Ga0111539_10231184 Ga0111539_102311843 175
388 3300009098 Ga0105245_10123903 Ga0105245_101239032 175
389 3300009101 Ga0105247_10002289 Ga0105247_100022894 175
390 3300009101 Ga0105247_10555182 Ga0105247_105551821 175
391 3300009147 Ga0114129_10132354 Ga0114129_101323542 175
392 3300009147 Ga0114129_10150021 Ga0114129_101500213 175
393 3300009147 Ga0114129_11176658 Ga0114129_111766582 175
394 3300009176 Ga0105242_10033647 Ga0105242_100336476 175
395 3300009177 Ga0105248_10008256 Ga0105248_100082564 175
396 3300009545 Ga0105237_10029785 Ga0105237_100297855 175
397 3300009551 Ga0105238_10149332 Ga0105238_101493322 175
398 3300009553 Ga0105249_10030751 Ga0105249_100307514 175
399 3300010375 Ga0105239_10183580 Ga0105239_101835803 175
400 3300010375 Ga0105239_10327719 Ga0105239_103277192 175
401 3300011119 Ga0105246_10284799 Ga0105246_102847992 175
402 3300011119 Ga0105246_11533473 Ga0105246_115334731 175
403 3300013296 Ga0157374_10008420 Ga0157374_100084205 175
404 3300013297 Ga0157378_10538162 Ga0157378_105381622 175
405 3300013306 Ga0163162_10801181 Ga0163162_108011812 175
406 3300013308 Ga0157375_12085772 Ga0157375_120857721 175
407 3300014325 Ga0163163_10071017 Ga0163163_100710174 175
408 3300014745 Ga0157377_10005919 Ga0157377_100059196 175
409 3300014745 Ga0157377_10266837 Ga0157377_102668372 175
410 3300014968 Ga0157379_10020263 Ga0157379_100202637 175
411 3300014969 Ga0157376_10017126 Ga0157376_100171263 175
412 3300017792 Ga0163161_10086802 Ga0163161_100868022 175
413 3300021384 Ga0213876_10004487 Ga0213876_100044875 175
414 3300021388 Ga0213875_10000040 Ga0213875_10000040125 175
415 3300025321 Ga0207656_10005379 Ga0207656_100053792 175
416 3300025898 Ga0207692_10268360 Ga0207692_102683602 175
417 3300025898 Ga0207692_10449511 Ga0207692_104495112 175
418 3300025899 Ga0207642_10004584 Ga0207642_100045844 175
419 3300025900 Ga0207710_10021632 Ga0207710_100216322 175
420 3300025900 Ga0207710_10271822 Ga0207710_102718221 175
421 3300025901 Ga0207688_10000480 Ga0207688_1000048014 175
422 3300025904 Ga0207647_10045019 Ga0207647_100450193 175
423 3300025906 Ga0207699_10896179 Ga0207699_108961792 175
424 3300025907 Ga0207645_10008758 Ga0207645_100087586 175
425 3300025908 Ga0207643_10017874 Ga0207643_100178742 175
426 3300025909 Ga0207705_10321200 Ga0207705_103212002 175
427 3300025910 Ga0207684_10060236 Ga0207684_100602363 175
428 3300025914 Ga0207671_10105646 Ga0207671_101056462 175
429 3300025915 Ga0207693_10067103 Ga0207693_100671033 175
430 3300025915 Ga0207693_10100053 Ga0207693_101000532 175
431 3300025918 Ga0207662_10012537 Ga0207662_100125377 175
432 3300025920 Ga0207649_10118655 Ga0207649_101186552 175
433 3300025922 Ga0207646_10230750 Ga0207646_102307502 175
434 3300025925 Ga0207650_10027777 Ga0207650_100277772 175
435 3300025925 Ga0207650_10029398 Ga0207650_100293982 175
436 3300025926 Ga0207659_10027691 Ga0207659_100276912 175
437 3300025927 Ga0207687_10020079 Ga0207687_100200794 175
438 3300025928 Ga0207700_10037724 Ga0207700_100377245 175
439 3300025928 Ga0207700_10414313 Ga0207700_104143132 175
440 3300025931 Ga0207644_10350061 Ga0207644_103500612 175
441 3300025932 Ga0207690_10006529 Ga0207690_100065299 175
442 3300025933 Ga0207706_10005860 Ga0207706_1000586012 175
443 3300025936 Ga0207670_10008610 Ga0207670_100086107 175
444 3300025936 Ga0207670_10289599 Ga0207670_102895992 175
445 3300025937 Ga0207669_10043006 Ga0207669_100430062 175
446 3300025939 Ga0207665_10016432 Ga0207665_100164325 175
447 3300025940 Ga0207691_10142907 Ga0207691_101429073 175
448 3300025941 Ga0207711_10014189 Ga0207711_100141891 175
449 3300025942 Ga0207689_10033455 Ga0207689_100334553 175
450 3300025944 Ga0207661_10019047 Ga0207661_100190472 175
451 3300025972 Ga0207668_10071058 Ga0207668_100710582 175
452 3300025986 Ga0207658_10438028 Ga0207658_104380282 175
453 3300026035 Ga0207703_10005201 Ga0207703_1000520110 175
454 3300026035 Ga0207703_10147337 Ga0207703_101473372 175
455 3300026041 Ga0207639_10023555 Ga0207639_100235552 175
456 3300026067 Ga0207678_10028564 Ga0207678_100285644 175
457 3300026067 Ga0207678_10582836 Ga0207678_105828361 175
458 3300026075 Ga0207708_10002098 Ga0207708_1000209811 175
459 3300026075 Ga0207708_10830621 Ga0207708_108306211 175
460 3300026088 Ga0207641_10210699 Ga0207641_102106992 175
461 3300026089 Ga0207648_10004699 Ga0207648_1000469913 175
462 3300026095 Ga0207676_10006485 Ga0207676_100064853 175
463 3300026118 Ga0207675_100031234 Ga0207675_1000312344 175
464 3300027671 Ga0209588_1026172 Ga0209588_10261722 175
465 3300027907 Ga0207428_10023410 Ga0207428_100234104 175
466 3300028380 Ga0268265_10114982 Ga0268265_101149822 175
467 3300028381 Ga0268264_10509037 Ga0268264_105090372 175
468 3300028381 Ga0268264_11524949 Ga0268264_115249491 175
469 3300031238 Ga0265332_10017008 Ga0265332_100170083 175
470 3300031241 Ga0265325_10095672 Ga0265325_100956721 175
471 3300031247 Ga0265340_10026015 Ga0265340_100260152 175
472 3300031247 Ga0265340_10047664 Ga0265340_100476641 175
473 3300031247 Ga0265340_10237550 Ga0265340_102375501 175
474 3300031249 Ga0265339_10001375 Ga0265339_100013755 175
475 3300031250 Ga0265331_10053640 Ga0265331_100536402 175
476 3300031712 Ga0265342_10000569 Ga0265342_100005696 175
477 3300034819 Ga0373958_0040803 Ga0373958_0040803_201_728 175
478 3300035083 Ga0373926_0059622 Ga0373926_0059622_194_721 175
479 3300035083 Ga0373926_0281402 Ga0373926_0281402_20_547 175
480 3300035084 Ga0373928_0040031 Ga0373928_0040031_159_686 175
481 3300035090 Ga0373949_0016924 Ga0373949_0016924_400_927 175
482 3300035111 Ga0373923_0003583 Ga0373923_0003583_117_644 175
483 3300035113 Ga0373936_0004843 Ga0373936_0004843_335_862 175
484 3300035115 Ga0373941_0097299 Ga0373941_0097299_101_628 175
485 3300035116 Ga0373945_0043778 Ga0373945_0043778_1055_1582 175
486 3300035117 Ga0373953_0007533 Ga0373953_0007533_2047_2574 175
487 3300035118 Ga0373954_0001419 Ga0373954_0001419_1934_2461 175
488 3300035170 Ga0373943_0006089 Ga0373943_0006089_32_559 175
489 3300035170 Ga0373943_0033990 Ga0373943_0033990_113_640 175
490 3300035171 Ga0373946_0001531 Ga0373946_0001531_3025_3552 175
491 3300035172 Ga0373955_0002037 Ga0373955_0002037_226_753 175
492 3300035242 Ga0373962_0152550 Ga0373962_0152550_196_723 175
493 3300035410 Ga0373924_0218599 Ga0373924_0218599_64_591 175
494 3300035691 Ga0373931_0020363 Ga0373931_0020363_1557_2084 175
495 3300035691 Ga0373931_0022068 Ga0373931_0022068_1297_1824 175
496 3300035692 Ga0373935_0000246 Ga0373935_0000246_22125_22652 175
497 3300035692 Ga0373935_0274965 Ga0373935_0274965_120_647 175
498 3300035695 Ga0373927_0002984 Ga0373927_0002984_8090_8617 175
499 3300035695 Ga0373927_0005061 Ga0373927_0005061_1267_1794 175
500 3300035724 Ga0373933_0030710 Ga0373933_0030710_1265_1792 175
501 3300035725 Ga0373947_0000544 Ga0373947_0000544_19575_20102 175
502 3300035725 Ga0373947_0048826 Ga0373947_0048826_1917_2444 175
503 3300035725 Ga0373947_0261468 Ga0373947_0261468_585_1112 175
504 3300036401 Ga0373937_0000003 Ga0373937_0000003_211596_212123 175
505 3300036401 Ga0373937_0569510 Ga0373937_0569510_139_666 175
506 3300036401 Ga0373937_1324936 Ga0373937_1324936_96_623 175
507 3300036401 Ga0373937_1514696 Ga0373937_1514696_21_548 175
508 3300037068 Ga0373925_0000052 Ga0373925_0000052_103678_104205 175
509 3300037068 Ga0373925_0003941 Ga0373925_0003941_2950_3477 175
510 3300037068 Ga0373925_0395884 Ga0373925_0395884_431_958 175
511 3300037853 Ga0436364_0004209 Ga0436364_0004209_16217_16744 175
512 3300039437 Ga0436365_0468207 Ga0436365_0468207_1561_2097 175
513 3300039437 Ga0436365_0689847 Ga0436365_0689847_3596_4132 175
514 3300039447 Ga0436361_0271802 Ga0436361_0271802_168_695 175
515 3300039447 Ga0436361_0630759 Ga0436361_0630759_594_1142 175
516 3300039450 Ga0436363_0193075 Ga0436363_0193075_144_671 175
517 3300039450 Ga0436363_0673064 Ga0436363_0673064_179_715 175
518 3300039453 Ga0436362_1121268 Ga0436362_1121268_33_560 175
519 3300041452 Ga0451793_0244858 Ga0451793_0244858_174_701 175
520 3300041459 Ga0451800_1057318 Ga0451800_1057318_10_537 175
521 3300041496 Ga0451839_0664336 Ga0451839_0664336_57_584 175
522 3300041507 Ga0451851_0321573 Ga0451851_0321573_52_579 175
523 3300042157 Ga0439458_0075062 Ga0439458_0075062_188_715 175
524 3300046453 Ga0495627_143028 Ga0495627_143028_57_614 175
525 3300046454 Ga0495592_0000331 Ga0495592_0000331_15481_16008 175
526 3300046459 Ga0495629_0023386 Ga0495629_0023386_32_559 175
527 3300046459 Ga0495629_0502569 Ga0495629_0502569_52_579 175
528 3300046461 Ga0495641_0030923 Ga0495641_0030923_1163_1690 175
529 3300046461 Ga0495641_0200544 Ga0495641_0200544_130_657 175
530 3300046462 Ga0495651_0000733 Ga0495651_0000733_15486_16013 175
531 3300046463 Ga0495653_0000071 Ga0495653_0000071_76675_77202 175
532 3300046473 Ga0495582_0027755 Ga0495582_0027755_1405_1932 175
533 3300046473 Ga0495582_0039798 Ga0495582_0039798_1633_2160 175
534 3300046473 Ga0495582_0041190 Ga0495582_0041190_1917_2444 175
535 3300046477 Ga0495664_0000162 Ga0495664_0000162_23286_23813 175
536 3300046491 Ga0495584_0083951 Ga0495584_0083951_30_557 175
537 3300046500 Ga0495596_0202334 Ga0495596_0202334_26_553 175
538 3300046511 Ga0495608_0000239 Ga0495608_0000239_15565_16092 175
539 3300046514 Ga0495618_0000022 Ga0495618_0000022_103794_104321 175
540 3300046515 Ga0495620_0101143 Ga0495620_0101143_124_651 175
541 3300046515 Ga0495620_0251545 Ga0495620_0251545_91_618 175
542 3300046516 Ga0495628_0000011 Ga0495628_0000011_23286_23813 175
543 3300046516 Ga0495628_0665438 Ga0495628_0665438_91_618 175
544 3300046517 Ga0495630_0005679 Ga0495630_0005679_6910_7437 175
545 3300046517 Ga0495630_0623853 Ga0495630_0623853_20_547 175
546 3300046520 Ga0495637_0057238 Ga0495637_0057238_273_800 175
547 3300046523 Ga0495644_0044757 Ga0495644_0044757_1059_1586 175
548 3300046526 Ga0495666_0182560 Ga0495666_0182560_67_594 175
549 3300046529 Ga0495652_0000014 Ga0495652_0000014_201672_202199 175
550 3300046531 Ga0495665_0049113 Ga0495665_0049113_547_1074 175
551 3300046531 Ga0495665_0067289 Ga0495665_0067289_122_649 175
552 3300046533 Ga0495640_0000008 Ga0495640_0000008_23286_23813 175
553 3300046533 Ga0495640_0220164 Ga0495640_0220164_11_538 175
554 3300046535 Ga0495586_0479588 Ga0495586_0479588_15_542 175
555 3300046536 Ga0495587_0000347 Ga0495587_0000347_23286_23813 175
556 3300046537 Ga0495598_0010690 Ga0495598_0010690_1574_2101 175
557 3300046538 Ga0495609_0263836 Ga0495609_0263836_108_635 175
558 3300046542 Ga0495597_0200804 Ga0495597_0200804_50_577 175
559 3300046543 Ga0495645_0000007 Ga0495645_0000007_360190_360717 175
560 3300046557 Ga0495622_0123314 Ga0495622_0123314_525_1052 175
561 3300046559 Ga0495667_0000013 Ga0495667_0000013_23272_23799 175
562 3300046615 Ga0495656_0008675 Ga0495656_0008675_2349_2876 175
563 3300046616 Ga0495668_0289082 Ga0495668_0289082_109_636 175
564 3300046642 Ga0495634_0031786 Ga0495634_0031786_2182_2709 175
565 3300046663 Ga0495635_0000012 Ga0495635_0000012_201459_201986 175
566 3300046663 Ga0495635_0789819 Ga0495635_0789819_52_579 175
567 3300046665 Ga0495661_0073697 Ga0495661_0073697_1142_1669 175
568 3300046675 Ga0495657_0001891 Ga0495657_0001891_15189_15716 175
569 3300046678 Ga0495599_0000008 Ga0495599_0000008_201722_202249 175
570 3300046679 Ga0495623_0000500 Ga0495623_0000500_23270_23797 175
571 3300046680 Ga0495646_0000004 Ga0495646_0000004_71940_72467 175
572 3300046681 Ga0495647_0161672 Ga0495647_0161672_64_618 175
573 3300046683 Ga0495658_0043791 Ga0495658_0043791_542_1069 175
574 3300046683 Ga0495658_0209188 Ga0495658_0209188_631_1158 175
575 3300046684 Ga0495669_0023183 Ga0495669_0023183_1058_1585 175
576 3300046689 Ga0495613_0081027 Ga0495613_0081027_1465_1992 175
577 3300046689 Ga0495613_0085869 Ga0495613_0085869_1732_2259 175
578 3300046690 Ga0495624_0238601 Ga0495624_0238601_482_1009 175
579 3300046692 Ga0495671_0194710 Ga0495671_0194710_63_590 175
580 3300046809 Ga0495600_0000084 Ga0495600_0000084_35426_35953 175
581 3300046809 Ga0495600_0548270 Ga0495600_0548270_151_678 175
582 3300047315 Ga0495581_0122397 Ga0495581_0122397_581_1108 175
583 3300047317 Ga0495604_0000001 Ga0495604_0000001_307879_308406 175
584 3300047319 Ga0495674_0000630 Ga0495674_0000630_9190_9717 175
585 3300047321 Ga0495676_0049040 Ga0495676_0049040_1008_1535 175
586 3300047321 Ga0495676_0301643 Ga0495676_0301643_462_989 175
587 3300047322 Ga0495680_0017175 Ga0495680_0017175_4980_5507 175
588 3300047322 Ga0495680_0615488 Ga0495680_0615488_65_592 175
589 3300047444 Ga0495675_0000023 Ga0495675_0000023_87269_87796 175
590 3300047445 Ga0495677_0075465 Ga0495677_0075465_651_1178 175
591 3300047470 Ga0495681_0242473 Ga0495681_0242473_74_601 175
592 3300047471 Ga0495684_0000007 Ga0495684_0000007_201532_202059 175
593 3300047673 Ga0495593_0000918 Ga0495593_0000918_1069_1596 175
594 3300048088 Ga0495602_0000431 Ga0495602_0000431_23286_23813 175
595 3300048090 Ga0495615_0175302 Ga0495615_0175302_44_571 175
596 3300048903 Ga0496100_0014276 Ga0496100_0014276_4053_4580 175
597 3300048903 Ga0496100_0018049 Ga0496100_0018049_2839_3366 175
598 3300048903 Ga0496100_0532473 Ga0496100_0532473_138_665 175
599 3300048904 Ga0496101_0017659 Ga0496101_0017659_4053_4580 175
600 3300048905 Ga0496102_0038172 Ga0496102_0038172_1555_2082 175
601 3300048905 Ga0496102_0610812 Ga0496102_0610812_106_633 175
602 3300048905 Ga0496102_0995825 Ga0496102_0995825_177_704 175
603 3300048906 Ga0496103_0001924 Ga0496103_0001924_1359_1886 175
604 3300048906 Ga0496103_0006632 Ga0496103_0006632_4966_5493 175
605 3300048907 Ga0496104_0002823 Ga0496104_0002823_12818_13357 175
606 3300048907 Ga0496104_0004892 Ga0496104_0004892_9349_9888 175
607 3300048907 Ga0496104_0030628 Ga0496104_0030628_3617_4144 175
608 3300048907 Ga0496104_0436909 Ga0496104_0436909_434_961 175
609 3300048907 Ga0496104_0523074 Ga0496104_0523074_75_602 175
610 3300048908 Ga0496105_0001515 Ga0496105_0001515_11579_12106 175
611 3300048908 Ga0496105_0004141 Ga0496105_0004141_2777_3304 175
612 3300048908 Ga0496105_0012805 Ga0496105_0012805_2642_3181 175
613 3300048908 Ga0496105_0021610 Ga0496105_0021610_360_899 175
614 3300048909 Ga0496106_0002907 Ga0496106_0002907_2517_3044 175
615 3300048909 Ga0496106_0052534 Ga0496106_0052534_1136_1663 175
616 3300048909 Ga0496106_0514473 Ga0496106_0514473_204_731 175
617 3300048909 Ga0496106_0631586 Ga0496106_0631586_25_552 175
618 3300048910 Ga0496107_0007785 Ga0496107_0007785_77_604 175
619 3300048910 Ga0496107_0486574 Ga0496107_0486574_255_794 175
620 3300048911 Ga0496108_0001028 Ga0496108_0001028_9348_9875 175
621 3300048911 Ga0496108_0207454 Ga0496108_0207454_668_1195 175
622 3300048911 Ga0496108_0335084 Ga0496108_0335084_448_987 175
623 3300048912 Ga0496109_0002430 Ga0496109_0002430_4447_4974 175
624 3300048912 Ga0496109_0073398 Ga0496109_0073398_1503_2042 175
625 3300048912 Ga0496109_0176992 Ga0496109_0176992_1177_1716 175
626 3300048912 Ga0496109_0601199 Ga0496109_0601199_149_676 175
627 3300048912 Ga0496109_0789560 Ga0496109_0789560_106_633 175
628 3300048913 Ga0496110_0001894 Ga0496110_0001894_14901_15428 175
629 3300048913 Ga0496110_0050256 Ga0496110_0050256_1109_1636 175
630 3300048913 Ga0496110_0140044 Ga0496110_0140044_1586_2125 175
631 3300048913 Ga0496110_0446085 Ga0496110_0446085_338_865 175
632 3300048914 Ga0496111_0000436 Ga0496111_0000436_14594_15121 175
633 3300048914 Ga0496111_0002610 Ga0496111_0002610_2905_3432 175
634 3300048915 Ga0496112_0004518 Ga0496112_0004518_8468_8995 175
635 3300048915 Ga0496112_0064887 Ga0496112_0064887_234_761 175
636 3300048916 Ga0496113_0001213 Ga0496113_0001213_11169_11696 175
637 3300048916 Ga0496113_0019583 Ga0496113_0019583_669_1196 175
638 3300048917 Ga0496114_0184587 Ga0496114_0184587_790_1317 175
639 3300048917 Ga0496114_0486369 Ga0496114_0486369_38_577 175
640 3300048917 Ga0496114_0871073 Ga0496114_0871073_187_714 175
641 3300048918 Ga0496115_0015654 Ga0496115_0015654_2388_2915 175
642 3300048918 Ga0496115_0052838 Ga0496115_0052838_2232_2771 175
643 3300048918 Ga0496115_0114013 Ga0496115_0114013_241_768 175
644 3300048918 Ga0496115_0143695 Ga0496115_0143695_189_728 175
645 3300049570 Ga0501033_0702228 Ga0501033_0702228_40_567 175
646 3300049578 Ga0501042_0286130 Ga0501042_0286130_212_739 175
647 3300049579 Ga0501043_0950898 Ga0501043_0950898_65_592 175
648 3300049584 Ga0501068_0231429 Ga0501068_0231429_371_898 175
649 3300049589 Ga0501073_0500409 Ga0501073_0500409_186_713 175
650 3300049591 Ga0501075_0908199 Ga0501075_0908199_58_585 175
651 3300049593 Ga0501077_0331537 Ga0501077_0331537_176_703 175
652 3300049741 Ga0501079_0178249 Ga0501079_0178249_459_986 175
653 3300049824 Ga0501045_0644964 Ga0501045_0644964_193_720 175
654 3300050492 nmdc:mga0yw44_103484_c1 nmdc:mga0yw44_103484_c1_1244_1771 175
655 3300050492 nmdc:mga0yw44_20097_c1 nmdc:mga0yw44_20097_c1_666_1193 175
656 3300050492 nmdc:mga0yw44_47560_c1 nmdc:mga0yw44_47560_c1_756_1283 175
657 3300050492 nmdc:mga0yw44_82900_c1 nmdc:mga0yw44_82900_c1_55_582 175
658 3300050494 nmdc:mga06z11_48917_c1 nmdc:mga06z11_48917_c1_921_1472 175
659 3300050507 nmdc:mga05p37_11760_c1 nmdc:mga05p37_11760_c1_5407_5934 175
660 3300050507 nmdc:mga05p37_1336385_c1 nmdc:mga05p37_1336385_c1_124_651 175
661 3300050507 nmdc:mga05p37_68011_c1 nmdc:mga05p37_68011_c1_2216_2743 175
662 3300050508 nmdc:mga09592_74608_c1 nmdc:mga09592_74608_c1_1370_1897 175
663 3300050508 nmdc:mga09592_94047_c1 nmdc:mga09592_94047_c1_336_914 175
664 3300050509 nmdc:mga0qj67_625769_c1 nmdc:mga0qj67_625769_c1_85_663 175
665 3300050509 nmdc:mga0qj67_657404_c1 nmdc:mga0qj67_657404_c1_54_581 175
666 3300050510 nmdc:mga06r32_37645_c1 nmdc:mga06r32_37645_c1_455_982 175
667 3300050510 nmdc:mga06r32_410386_c1 nmdc:mga06r32_410386_c1_197_724 175
668 3300050511 nmdc:mga08y16_31336_c1 nmdc:mga08y16_31336_c1_1471_1998 175
669 3300050511 nmdc:mga08y16_31728_c1 nmdc:mga08y16_31728_c1_747_1274 175
670 3300050512 nmdc:mga0n895_17990_c1 nmdc:mga0n895_17990_c1_1581_2108 175
671 3300050512 nmdc:mga0n895_4803_c1 nmdc:mga0n895_4803_c1_4359_4886 175
672 3300050514 nmdc:mga08x19_277959_c1 nmdc:mga08x19_277959_c1_208_735 175
673 3300053077 Ga0495601_0000014 Ga0495601_0000014_196506_197033 175
674 3300053078 Ga0495612_0000123 Ga0495612_0000123_23286_23813 175
675 3300053083 Ga0495655_0011770 Ga0495655_0011770_783_1310 175
676 3300053084 Ga0495595_0000169 Ga0495595_0000169_9517_10044 175
677 3300053085 Ga0495619_0000006 Ga0495619_0000006_23286_23813 175
678 3300053085 Ga0495619_0058304 Ga0495619_0058304_2008_2535 175
679 3300053085 Ga0495619_0185834 Ga0495619_0185834_326_853 175
680 3300053096 Ga0500641_0053745 Ga0500641_0053745_486_1034 175
681 3300053156 Ga0500622_0006576 Ga0500622_0006576_1197_1727 175
682 3300053730 Ga0500645_111678 Ga0500645_111678_230_757 175
683 3300060353 Ga0501082_0348961 Ga0501082_0348961_55_582 175
684 3300061734 Ga0530510_0092508 Ga0530510_0092508_72_599 175

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03205

MobB

Molybdopterin guanine dinucleotide synthesis protein B

9

139

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3pg5-assembly6.cif.gz_D crystal structure of protein dip2308 from corynebacterium diphtheriae, northeast structural genomics consortium target cdr78 0.7674 1 36
1p9n-assembly1.cif.gz_B crystal structure of escherichia coli mobb. 0.7551 1 160
1np6-assembly1.cif.gz_B crystal structure of escherichia coli mobb 0.739 1 160
1np6-assembly1.cif.gz_A crystal structure of escherichia coli mobb 0.7364 1 160
1p9n-assembly1.cif.gz_B crystal structure of escherichia coli mobb. 0.7203 1 160
ID Description Score Start End Superfamily
1rz3A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8892 4 36 3.40.50.300
1p9nB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8164 1 160 3.40.50.300
1ihuA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8149 3 38 3.40.50.300
1p9nB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7811 1 160 3.40.50.300
3pg5A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7557 2 36 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7C4BS80-F1-model_v4 Molybdopterin-guanine dinucleotide biosynthesis protein B 0.956 7 64 GO:0005525
GO:0006777
AF-A0A843EQH1-F1-model_v4 Molybdopterin-guanine dinucleotide biosynthesis protein B 0.9345 1 64 GO:0005525
GO:0006777
AF-A0A352PNV1-F1-model_v4 Molybdopterin-guanine dinucleotide biosynthesis protein B 0.9335 7 66 GO:0005525
GO:0006777
AF-A0A1F8P987-F1-model_v4 Molybdopterin-guanine dinucleotide biosynthesis protein B 0.9314 7 70 GO:0005525
GO:0006777
AF-A0A1G0E9H6-F1-model_v4 Molybdopterin-guanine dinucleotide biosynthesis protein B 0.919 7 69 GO:0005525
GO:0006777

Feature Viewer

pLDDT pTM Quality
87.94 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map