F474989

General Info

Members Datasets Scaffolds Average Seq Length
683 334 1366 224

Family's Representative Sequence

Representative Sequence 3300037853|Ga0436364_0116353|Ga0436364_0116353_1233_1928
Length 231
Sequence MTQLDGPRLGAKNAKAGGKVKQLVVLLHGYGADGKDLIALGQQWQTLLPDAAFVAPNAPEPCGQAPMGRQWFALTTRDPNERWIGVNKAAPALDAFLDKELASHGLGDDKLALVGFSQGTMMALHVGLRRRRPPAAIVGFSGTLVGPEHLAAIAPAKPPPVLLTHGSDDEVIPADAMFIAAEDLAQVGIPAQWHLSAGIGHGIDGTALTHAGLFLAKGFGVRPPAKPAVKR

Samples

Sample ID Description Type Environment
1 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
55 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
58 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
59 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
60 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
61 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
62 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
63 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
66 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
67 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
68 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
80 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
95 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
96 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
97 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
98 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
110 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
111 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
112 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
161 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
162 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
165 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
166 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
167 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
168 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
169 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
170 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
171 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
172 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
173 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
174 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
175 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
176 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
177 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
178 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
179 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
180 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
181 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
182 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
183 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
184 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
185 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
186 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
187 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
188 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
189 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
190 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
191 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
192 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
193 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
194 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
195 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
196 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
197 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
198 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
199 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
200 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
201 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
202 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
203 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
204 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
205 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
206 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
207 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
208 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
209 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
210 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
211 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
212 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
213 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
214 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
215 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
216 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
217 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
218 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
219 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
220 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
221 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
222 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
223 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
224 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
225 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
226 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
227 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
228 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
229 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
230 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
231 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
232 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
233 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
234 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
235 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
236 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
237 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
238 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
239 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
240 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
241 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
242 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
243 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
244 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
245 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
246 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
247 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
248 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
249 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
250 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
251 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
252 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
253 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
254 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
255 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
256 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
257 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
258 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
259 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
260 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
261 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
262 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
263 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
264 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
265 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
266 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
267 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
268 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
269 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
270 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
271 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
272 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
273 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
274 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
275 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
276 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
277 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
278 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
279 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
280 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
281 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
282 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
283 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
284 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
285 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
286 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
287 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
288 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
289 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
290 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
291 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
292 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
293 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
294 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
297 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
298 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
299 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
300 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
301 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
302 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
303 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
304 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
305 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
306 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
307 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
308 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
309 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
310 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
311 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
312 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
313 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
314 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
315 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
316 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
317 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
318 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
319 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
320 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
321 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
322 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
323 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
324 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
325 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
326 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
327 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
328 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
329 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
330 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
331 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
332 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
333 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
334 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.71
Metatranscriptomes 0.29
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.39
Nodule 0
Rhizoplane 9.08
Rhizosphere 84.63
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436364_0116353 3300037853 Bacteria 2150
2 Ga0070690_100010925 3300005330 Bacteria 5299
3 Ga0070670_100046926 3300005331 Bacteria 3716
4 Ga0070670_100060473 3300005331 Bacteria 3252
5 Ga0068869_100097230 3300005334 Bacteria 2223
6 Ga0070666_10005932 3300005335 Bacteria 7500
7 Ga0070666_10619188 3300005335 Bacteria 791
8 Ga0068868_100010418 3300005338 Bacteria 6730
9 Ga0070660_100096949 3300005339 Bacteria 2332
10 Ga0070660_100132730 3300005339 Bacteria 1994
11 Ga0070689_100012423 3300005340 Bacteria 6134
12 Ga0070687_100186741 3300005343 Bacteria 1246
13 Ga0070661_100033135 3300005344 Bacteria 3741
14 Ga0070661_100119271 3300005344 Bacteria 1975
15 Ga0070692_10272966 3300005345 Bacteria 1022
16 Ga0070668_100467415 3300005347 Bacteria 1087
17 Ga0070675_100211778 3300005354 Bacteria 1685
18 Ga0070675_100391235 3300005354 Bacteria 1239
19 Ga0070671_100024390 3300005355 Bacteria 4951
20 Ga0070671_100078098 3300005355 Bacteria 2767
21 Ga0070671_100189185 3300005355 Bacteria 1744
22 Ga0070674_100021073 3300005356 Bacteria 4179
23 Ga0070674_100105943 3300005356 Bacteria 2057
24 Ga0070674_100171348 3300005356 Bacteria 1655
25 Ga0070674_100715757 3300005356 Bacteria 857
26 Ga0070673_100008910 3300005364 Bacteria 6706
27 Ga0070673_100015324 3300005364 Bacteria 5380
28 Ga0070688_100054575 3300005365 Bacteria 2503
29 Ga0070688_100553498 3300005365 Bacteria 875
30 Ga0070659_100095281 3300005366 Bacteria 2391
31 Ga0070659_100382969 3300005366 Bacteria 1185
32 Ga0070659_100625733 3300005366 Bacteria 927
33 Ga0070667_100029619 3300005367 Bacteria 4563
34 Ga0070709_10000959 3300005434 Bacteria 16036
35 Ga0070709_10006049 3300005434 Bacteria 6582
36 Ga0070709_10436594 3300005434 Bacteria 984
37 Ga0070714_100020249 3300005435 Bacteria 5430
38 Ga0070714_100189259 3300005435 Bacteria 1877
39 Ga0070714_100262854 3300005435 Bacteria 1598
40 Ga0070713_100002295 3300005436 Bacteria 12441
41 Ga0070713_100013439 3300005436 Bacteria 6045
42 Ga0070713_100059595 3300005436 Bacteria 3188
43 Ga0070713_100124356 3300005436 Bacteria 2266
44 Ga0070710_10010596 3300005437 Bacteria 4531
45 Ga0070710_10159171 3300005437 Bacteria 1399
46 Ga0070711_100013658 3300005439 Bacteria 5102
47 Ga0070711_100587496 3300005439 Bacteria 928
48 Ga0070711_100799792 3300005439 Bacteria 800
49 Ga0070694_100054554 3300005444 Bacteria 2708
50 Ga0070708_100760766 3300005445 Bacteria 911
51 Ga0070708_100856175 3300005445 Bacteria 854
52 Ga0070663_100013244 3300005455 Bacteria 5250
53 Ga0070678_100007461 3300005456 Bacteria 6493
54 Ga0070678_100085350 3300005456 Bacteria 2406
55 Ga0070678_100391868 3300005456 Bacteria 1204
56 Ga0070681_10039853 3300005458 Bacteria 4709
57 Ga0070681_10221976 3300005458 Bacteria 1805
58 Ga0068867_100158030 3300005459 Bacteria 1786
59 Ga0068867_100225594 3300005459 Bacteria 1512
60 Ga0070685_10018558 3300005466 Bacteria 3742
61 Ga0070679_100006622 3300005530 Bacteria 10800
62 Ga0070684_100041862 3300005535 Bacteria 3951
63 Ga0070672_100153214 3300005543 Bacteria 1908
64 Ga0070672_100380039 3300005543 Bacteria 1208
65 Ga0070672_100716079 3300005543 Bacteria 877
66 Ga0070686_100018613 3300005544 Bacteria 4082
67 Ga0070686_100531045 3300005544 Bacteria 917
68 Ga0070695_100397859 3300005545 Bacteria 1044
69 Ga0070696_100067508 3300005546 Bacteria 2510
70 Ga0070693_100050032 3300005547 Bacteria 2387
71 Ga0070693_100252807 3300005547 Bacteria 1169
72 Ga0070665_100035107 3300005548 Bacteria 5042
73 Ga0070665_100061187 3300005548 Bacteria 3774
74 Ga0070704_100446485 3300005549 Bacteria 1113
75 Ga0068855_100986381 3300005563 Bacteria 886
76 Ga0070664_100184197 3300005564 Bacteria 1857
77 Ga0070664_100289558 3300005564 Bacteria 1478
78 Ga0068857_100462285 3300005577 Bacteria 1188
79 Ga0068854_100365715 3300005578 Bacteria 1184
80 Ga0068856_101004331 3300005614 Bacteria 853
81 Ga0068859_100022536 3300005617 Bacteria 6316
82 Ga0068864_100017844 3300005618 Bacteria 5919
83 Ga0068864_100176869 3300005618 Bacteria 1949
84 Ga0068866_10055493 3300005718 Bacteria 2035
85 Ga0068866_10468114 3300005718 Bacteria 828
86 Ga0068851_10045804 3300005834 Bacteria 2212
87 Ga0068863_100048579 3300005841 Bacteria 4023
88 Ga0068863_100362517 3300005841 Bacteria 1413
89 Ga0068858_100025042 3300005842 Bacteria 5553
90 Ga0068858_100073327 3300005842 Bacteria 3178
91 Ga0068858_100963133 3300005842 Bacteria 835
92 Ga0068860_100102318 3300005843 Bacteria 2733
93 Ga0068860_100115640 3300005843 Bacteria 2565
94 Ga0081455_10001098 3300005937 Bacteria 33970
95 Ga0081455_10004142 3300005937 Bacteria 16369
96 Ga0081538_10120941 3300005981 Bacteria 1258
97 Ga0081540_1008984 3300005983 Bacteria 6914
98 Ga0081540_1030378 3300005983 Bacteria 2993
99 Ga0070717_10000587 3300006028 Bacteria 23227
100 Ga0070717_10092372 3300006028 Bacteria 2557
101 Ga0070717_10670651 3300006028 Bacteria 941
102 Ga0075365_10159475 3300006038 Bacteria 1571
103 Ga0075365_10323267 3300006038 Bacteria 1086
104 Ga0075368_10004405 3300006042 Bacteria 4772
105 Ga0075363_100078504 3300006048 Bacteria 1802
106 Ga0075364_10225755 3300006051 Bacteria 1271
107 Ga0075432_10182398 3300006058 Bacteria 822
108 Ga0070715_10010710 3300006163 Bacteria 3276
109 Ga0070715_10044410 3300006163 Bacteria 1879
110 Ga0070716_100006054 3300006173 Bacteria 5895
111 Ga0070712_100156935 3300006175 Bacteria 1753
112 Ga0075362_10049238 3300006177 Bacteria 1882
113 Ga0075367_10022841 3300006178 Bacteria 3513
114 Ga0075367_10236022 3300006178 Bacteria 1145
115 Ga0075369_10067388 3300006186 Bacteria 1571
116 Ga0075366_10070152 3300006195 Bacteria 2086
117 Ga0075366_10150677 3300006195 Bacteria 1408
118 Ga0097621_100013014 3300006237 Bacteria 6184
119 Ga0097621_100014809 3300006237 Bacteria 5849
120 Ga0097621_100158019 3300006237 Bacteria 1947
121 Ga0075370_10136593 3300006353 Bacteria 1433
122 Ga0075370_10153934 3300006353 Bacteria 1348
123 Ga0068871_100058230 3300006358 Bacteria 3145
124 Ga0068871_100134924 3300006358 Bacteria 2095
125 Ga0075430_100000489 3300006846 Bacteria 29724
126 Ga0075433_10187038 3300006852 Bacteria 1842
127 Ga0075434_100039062 3300006871 Bacteria 4703
128 Ga0075434_100055001 3300006871 Bacteria 3955
129 Ga0075434_100152425 3300006871 Bacteria 2332
130 Ga0075434_100280966 3300006871 Bacteria 1684
131 Ga0075434_100297316 3300006871 Bacteria 1635
132 Ga0075434_101081115 3300006871 Bacteria 815
133 Ga0075429_100171739 3300006880 Bacteria 1899
134 Ga0068865_100073506 3300006881 Bacteria 2431
135 Ga0097620_100022536 3300006931 Bacteria 6316
136 Ga0075435_100130909 3300007076 Bacteria 2099
137 Ga0075435_100320337 3300007076 Bacteria 1327
138 Ga0099795_10026383 3300007788 Bacteria 1957
139 Ga0105251_10027457 3300009011 Bacteria 2886
140 Ga0111539_10048740 3300009094 Bacteria 5055
141 Ga0111539_10754462 3300009094 Bacteria 1133
142 Ga0105245_10054005 3300009098 Bacteria 3608
143 Ga0105245_10060016 3300009098 Bacteria 3426
144 Ga0105247_10022661 3300009101 Bacteria 3783
145 Ga0105247_10138355 3300009101 Bacteria 1593
146 Ga0114129_10345974 3300009147 Bacteria 1971
147 Ga0105243_10018351 3300009148 Bacteria 5298
148 Ga0105241_10013341 3300009174 Bacteria 6023
149 Ga0105241_10226581 3300009174 Bacteria 1574
150 Ga0105242_10078722 3300009176 Bacteria 2752
151 Ga0105242_10201733 3300009176 Bacteria 1767
152 Ga0105248_10028935 3300009177 Bacteria 6177
153 Ga0105248_10136044 3300009177 Bacteria 2772
154 Ga0105248_10372490 3300009177 Bacteria 1608
155 Ga0105237_10177099 3300009545 Bacteria 2133
156 Ga0105238_10123739 3300009551 Bacteria 2566
157 Ga0105249_10234089 3300009553 Bacteria 1813
158 Ga0105249_10264510 3300009553 Bacteria 1710
159 Ga0105239_10063582 3300010375 Bacteria 4052
160 Ga0105239_10069453 3300010375 Bacteria 3871
161 Ga0105239_10221589 3300010375 Bacteria 2121
162 Ga0105246_10692034 3300011119 Bacteria 892
163 Ga0105246_10694317 3300011119 Bacteria 891
164 Ga0157337_1002652 3300012483 Bacteria 1029
165 Ga0157341_1003372 3300012494 Bacteria 1113
166 Ga0157313_1001069 3300012503 Bacteria 1410
167 Ga0157373_10021474 3300013100 Bacteria 4689
168 Ga0157373_10315981 3300013100 Bacteria 1111
169 Ga0157370_10088499 3300013104 Bacteria 2908
170 Ga0157369_10091626 3300013105 Bacteria 3244
171 Ga0157369_10446264 3300013105 Bacteria 1340
172 Ga0157369_10539139 3300013105 Bacteria 1206
173 Ga0157374_10047944 3300013296 Bacteria 3963
174 Ga0157374_10063706 3300013296 Bacteria 3458
175 Ga0157378_10021332 3300013297 Bacteria 5694
176 Ga0157378_11246809 3300013297 Bacteria 784
177 Ga0163162_10059841 3300013306 Bacteria 3842
178 Ga0163162_10197408 3300013306 Bacteria 2141
179 Ga0163162_10267186 3300013306 Bacteria 1842
180 Ga0157372_10234376 3300013307 Bacteria 2129
181 Ga0157372_11274726 3300013307 Bacteria 848
182 Ga0157375_10204926 3300013308 Bacteria 2129
183 Ga0157375_10416880 3300013308 Bacteria 1509
184 Ga0163163_10029130 3300014325 Bacteria 5309
185 Ga0163163_10057142 3300014325 Bacteria 3857
186 Ga0163163_10209588 3300014325 Bacteria 1998
187 Ga0157380_10867461 3300014326 Bacteria 926
188 Ga0157379_10029360 3300014968 Bacteria 4891
189 Ga0157379_10032697 3300014968 Bacteria 4638
190 Ga0157379_10055284 3300014968 Bacteria 3546
191 Ga0157379_10218005 3300014968 Bacteria 1729
192 Ga0206353_10022509 3300020082 Bacteria 1310
193 Ga0213874_10107914 3300021377 Bacteria 933
194 Ga0213875_10000036 3300021388 Bacteria 166707
195 Ga0224572_1006068 3300024225 Bacteria 2176
196 Ga0207656_10044368 3300025321 Bacteria 1899
197 Ga0207713_1029786 3300025735 Bacteria 2439
198 Ga0207692_10090215 3300025898 Bacteria 1660
199 Ga0207692_10164398 3300025898 Bacteria 1281
200 Ga0207642_10210825 3300025899 Bacteria 1079
201 Ga0207710_10004429 3300025900 Bacteria 6133
202 Ga0207710_10085000 3300025900 Bacteria 1473
203 Ga0207688_10083227 3300025901 Bacteria 1830
204 Ga0207680_10015521 3300025903 Bacteria 3976
205 Ga0207685_10007496 3300025905 Bacteria 3045
206 Ga0207685_10087673 3300025905 Bacteria 1303
207 Ga0207699_10000725 3300025906 Bacteria 15736
208 Ga0207699_10055216 3300025906 Bacteria 2363
209 Ga0207699_10350135 3300025906 Bacteria 1042
210 Ga0207645_10547882 3300025907 Bacteria 784
211 Ga0207654_10051923 3300025911 Bacteria 2361
212 Ga0207707_10092245 3300025912 Bacteria 2647
213 Ga0207693_10006334 3300025915 Bacteria 9811
214 Ga0207693_10023398 3300025915 Bacteria 4906
215 Ga0207663_10028071 3300025916 Bacteria 3289
216 Ga0207663_10323177 3300025916 Bacteria 1160
217 Ga0207663_10680822 3300025916 Bacteria 813
218 Ga0207660_10080935 3300025917 Bacteria 2386
219 Ga0207662_10086551 3300025918 Bacteria 1921
220 Ga0207657_10321340 3300025919 Bacteria 1224
221 Ga0207652_10101268 3300025921 Bacteria 2544
222 Ga0207681_10176853 3300025923 Bacteria 1622
223 Ga0207694_10191612 3300025924 Bacteria 1661
224 Ga0207694_10465758 3300025924 Bacteria 1056
225 Ga0207650_10017115 3300025925 Bacteria 5074
226 Ga0207650_10037397 3300025925 Bacteria 3537
227 Ga0207650_10072003 3300025925 Bacteria 2601
228 Ga0207659_10041839 3300025926 Bacteria 3210
229 Ga0207659_10642460 3300025926 Bacteria 907
230 Ga0207687_10011254 3300025927 Bacteria 5845
231 Ga0207700_10001592 3300025928 Bacteria 12890
232 Ga0207700_10123616 3300025928 Bacteria 2101
233 Ga0207700_10243021 3300025928 Bacteria 1535
234 Ga0207664_10013963 3300025929 Bacteria 5789
235 Ga0207664_10325268 3300025929 Bacteria 1357
236 Ga0207644_10012131 3300025931 Bacteria 5717
237 Ga0207644_10051509 3300025931 Bacteria 2955
238 Ga0207644_10103630 3300025931 Bacteria 2141
239 Ga0207690_10122314 3300025932 Bacteria 1892
240 Ga0207706_10032496 3300025933 Bacteria 4647
241 Ga0207706_10290316 3300025933 Bacteria 1426
242 Ga0207686_10015233 3300025934 Bacteria 4295
243 Ga0207686_10322560 3300025934 Bacteria 1154
244 Ga0207709_10087159 3300025935 Bacteria 2029
245 Ga0207709_10416913 3300025935 Bacteria 1030
246 Ga0207670_10005620 3300025936 Bacteria 6895
247 Ga0207670_10627595 3300025936 Bacteria 884
248 Ga0207704_10187655 3300025938 Bacteria 1501
249 Ga0207691_10235873 3300025940 Bacteria 1583
250 Ga0207691_10333839 3300025940 Bacteria 1299
251 Ga0207711_10025137 3300025941 Bacteria 4997
252 Ga0207711_10058365 3300025941 Bacteria 3321
253 Ga0207711_10059244 3300025941 Bacteria 3297
254 Ga0207689_10027643 3300025942 Bacteria 4747
255 Ga0207689_10212673 3300025942 Bacteria 1598
256 Ga0207661_10552820 3300025944 Bacteria 1054
257 Ga0207679_10237387 3300025945 Bacteria 1543
258 Ga0207667_10474528 3300025949 Bacteria 1270
259 Ga0207651_10020138 3300025960 Bacteria 4018
260 Ga0207651_10033552 3300025960 Bacteria 3312
261 Ga0207651_10247635 3300025960 Bacteria 1456
262 Ga0207658_10025695 3300025986 Bacteria 4124
263 Ga0207677_10075303 3300026023 Bacteria 2398
264 Ga0207703_10040964 3300026035 Bacteria 3709
265 Ga0207703_10115320 3300026035 Bacteria 2298
266 Ga0207703_10409692 3300026035 Bacteria 1259
267 Ga0207703_10613505 3300026035 Bacteria 1030
268 Ga0207678_10039193 3300026067 Bacteria 4113
269 Ga0207702_10350652 3300026078 Bacteria 1412
270 Ga0207702_10355121 3300026078 Bacteria 1403
271 Ga0207702_10404836 3300026078 Bacteria 1316
272 Ga0207641_10036740 3300026088 Bacteria 4088
273 Ga0207641_10737681 3300026088 Bacteria 972
274 Ga0207676_10020867 3300026095 Bacteria 4799
275 Ga0207676_10146487 3300026095 Bacteria 2029
276 Ga0207676_10251134 3300026095 Bacteria 1592
277 Ga0207674_10507031 3300026116 Bacteria 1166
278 Ga0207683_10001587 3300026121 Bacteria 20510
279 Ga0207683_10024973 3300026121 Bacteria 5151
280 Ga0207683_10025030 3300026121 Bacteria 5146
281 Ga0207683_10266724 3300026121 Bacteria 1564
282 Ga0207683_10475363 3300026121 Bacteria 1153
283 Ga0209813_10034072 3300027866 Bacteria 1518
284 Ga0207428_10079588 3300027907 Bacteria 2562
285 Ga0268266_10007526 3300028379 Bacteria 9812
286 Ga0268264_10100470 3300028381 Bacteria 2512
287 Ga0268264_10604179 3300028381 Bacteria 1081
288 Ga0268264_11025165 3300028381 Bacteria 832
289 Ga0265318_10049023 3300028577 Bacteria 1589
290 Ga0265338_10011853 3300028800 Bacteria 10017
291 Ga0265762_1009470 3300030760 Bacteria 1736
292 Ga0265330_10030973 3300031235 Bacteria 2398
293 Ga0265332_10014555 3300031238 Bacteria 3479
294 Ga0265320_10015770 3300031240 Bacteria 4258
295 Ga0265325_10016782 3300031241 Bacteria 4086
296 Ga0265325_10041342 3300031241 Bacteria 2416
297 Ga0265329_10016573 3300031242 Bacteria 2550
298 Ga0265329_10053766 3300031242 Bacteria 1279
299 Ga0265340_10000863 3300031247 Bacteria 17211
300 Ga0265340_10029135 3300031247 Bacteria 2773
301 Ga0265340_10147895 3300031247 Bacteria 1072
302 Ga0265339_10000085 3300031249 Bacteria 79483
303 Ga0265339_10006084 3300031249 Bacteria 7964
304 Ga0265339_10029739 3300031249 Bacteria 3097
305 Ga0265331_10007430 3300031250 Bacteria 6339
306 Ga0265316_10063310 3300031344 Bacteria 2868
307 Ga0265313_10000647 3300031595 Bacteria 35853
308 Ga0265313_10028797 3300031595 Bacteria 2881
309 Ga0265314_10012548 3300031711 Bacteria 6905
310 Ga0265314_10062806 3300031711 Bacteria 2523
311 Ga0265314_10124427 3300031711 Bacteria 1617
312 Ga0265342_10000148 3300031712 Bacteria 79748
313 Ga0373959_0015454 3300034820 Bacteria 1402
314 Ga0373938_0016149 3300034957 Bacteria 1455
315 Ga0373938_0017749 3300034957 Bacteria 1404
316 Ga0373926_0000295 3300035083 Bacteria 12254
317 Ga0373926_0007469 3300035083 Bacteria 3640
318 Ga0373926_0136968 3300035083 Bacteria 929
319 Ga0373929_0009300 3300035085 Bacteria 1820
320 Ga0373934_0006700 3300035086 Bacteria 4281
321 Ga0373934_0012923 3300035086 Bacteria 3156
322 Ga0373944_0002720 3300035089 Bacteria 4516
323 Ga0373944_0018519 3300035089 Bacteria 1989
324 Ga0373923_0034282 3300035111 Bacteria 2059
325 Ga0373936_0014366 3300035113 Bacteria 3025
326 Ga0373939_0005957 3300035114 Bacteria 2920
327 Ga0373945_0000594 3300035116 Bacteria 10402
328 Ga0373945_0022357 3300035116 Bacteria 2177
329 Ga0373953_0004898 3300035117 Bacteria 4305
330 Ga0373953_0073084 3300035117 Bacteria 1417
331 Ga0373953_0085596 3300035117 Bacteria 1315
332 Ga0373954_0034491 3300035118 Bacteria 2344
333 Ga0373956_0003810 3300035119 Bacteria 6061
334 Ga0373957_0013618 3300035120 Bacteria 2763
335 Ga0373957_0058854 3300035120 Bacteria 1485
336 Ga0373943_0000352 3300035170 Bacteria 19408
337 Ga0373943_0003984 3300035170 Bacteria 6720
338 Ga0373943_0005596 3300035170 Bacteria 5638
339 Ga0373943_0016762 3300035170 Bacteria 3346
340 Ga0373946_0011259 3300035171 Bacteria 3332
341 Ga0373946_0018651 3300035171 Bacteria 2666
342 Ga0373955_0004134 3300035172 Bacteria 6405
343 Ga0373955_0007219 3300035172 Bacteria 5096
344 Ga0373955_0052060 3300035172 Bacteria 2232
345 Ga0373942_0023035 3300035207 Bacteria 1587
346 Ga0373942_0054072 3300035207 Bacteria 1133
347 Ga0373961_0025803 3300035241 Bacteria 1601
348 Ga0373961_0038953 3300035241 Bacteria 1364
349 Ga0373924_0008740 3300035410 Bacteria 3693
350 Ga0373924_0105086 3300035410 Bacteria 1217
351 Ga0373924_0148793 3300035410 Bacteria 1024
352 Ga0373931_0011009 3300035691 Bacteria 4361
353 Ga0373931_0130800 3300035691 Bacteria 1444
354 Ga0373935_0014228 3300035692 Bacteria 4802
355 Ga0373935_0021699 3300035692 Bacteria 3933
356 Ga0373935_0036043 3300035692 Bacteria 3091
357 Ga0373935_0040713 3300035692 Bacteria 2916
358 Ga0373935_0068827 3300035692 Bacteria 2278
359 Ga0373935_0158693 3300035692 Bacteria 1540
360 Ga0373927_0004615 3300035695 Bacteria 9604
361 Ga0373927_0011093 3300035695 Bacteria 6001
362 Ga0373927_0044167 3300035695 Bacteria 2883
363 Ga0373927_0066068 3300035695 Bacteria 2339
364 Ga0373927_0069000 3300035695 Bacteria 2288
365 Ga0373927_0120958 3300035695 Bacteria 1708
366 Ga0373927_0121052 3300035695 Bacteria 1708
367 Ga0373933_0001315 3300035724 Bacteria 14607
368 Ga0373933_0308866 3300035724 Bacteria 1024
369 Ga0373947_0003411 3300035725 Bacteria 9404
370 Ga0373947_0029537 3300035725 Bacteria 3217
371 Ga0373947_0062080 3300035725 Bacteria 2272
372 Ga0373947_0078499 3300035725 Bacteria 2038
373 Ga0373937_0001948 3300036401 Bacteria 17286
374 Ga0373937_0002055 3300036401 Bacteria 16831
375 Ga0373937_0004401 3300036401 Bacteria 11974
376 Ga0373937_0061530 3300036401 Bacteria 3451
377 Ga0373937_0663876 3300036401 Bacteria 988
378 Ga0373925_0005584 3300037068 Bacteria 9363
379 Ga0373925_0006774 3300037068 Bacteria 8397
380 Ga0373925_0042553 3300037068 Bacteria 3369
381 Ga0373925_0118826 3300037068 Bacteria 2050
382 Ga0395900_0422222 3300037418 Bacteria 1294
383 Ga0395898_0347070 3300037466 Bacteria 1415
384 Ga0395901_0063055 3300038443 Bacteria 3857
385 Ga0436365_1398168 3300039437 Bacteria 2311
386 Ga0436365_1552596 3300039437 Bacteria 865
387 Ga0436361_0634160 3300039447 Bacteria 3120
388 Ga0436363_0142756 3300039450 Bacteria 2941
389 Ga0436363_0287204 3300039450 Bacteria 1845
390 Ga0451789_0016010 3300041443 Bacteria 859
391 Ga0451851_0712984 3300041507 Bacteria 1066
392 Ga0466959_0084976 3300045049 Bacteria 2278
393 Ga0495592_0002844 3300046454 Bacteria 12281
394 Ga0495592_0004049 3300046454 Bacteria 10657
395 Ga0495592_0141143 3300046454 Bacteria 1675
396 Ga0495603_0008434 3300046455 Bacteria 6223
397 Ga0495603_0015595 3300046455 Bacteria 4599
398 Ga0495603_0045954 3300046455 Bacteria 2602
399 Ga0495629_0006854 3300046459 Bacteria 8411
400 Ga0495629_0030785 3300046459 Bacteria 3801
401 Ga0495629_0153108 3300046459 Bacteria 1602
402 Ga0495641_0003754 3300046461 Bacteria 11172
403 Ga0495641_0105443 3300046461 Bacteria 1257
404 Ga0495651_0001330 3300046462 Bacteria 19146
405 Ga0495651_0002388 3300046462 Bacteria 14492
406 Ga0495651_0114582 3300046462 Bacteria 1989
407 Ga0495651_0316521 3300046462 Bacteria 1041
408 Ga0495653_0047273 3300046463 Bacteria 3329
409 Ga0495653_0085611 3300046463 Bacteria 2318
410 Ga0495653_0332598 3300046463 Bacteria 981
411 Ga0495580_0010086 3300046472 Bacteria 7380
412 Ga0495580_0101278 3300046472 Bacteria 2003
413 Ga0495580_0189663 3300046472 Bacteria 1418
414 Ga0495582_0004877 3300046473 Bacteria 7519
415 Ga0495582_0014883 3300046473 Bacteria 4274
416 Ga0495582_0075264 3300046473 Bacteria 1870
417 Ga0495639_0003031 3300046475 Bacteria 7312
418 Ga0495662_0003361 3300046476 Bacteria 8114
419 Ga0495662_0055625 3300046476 Bacteria 1911
420 Ga0495662_0126264 3300046476 Bacteria 1257
421 Ga0495662_0134431 3300046476 Bacteria 1216
422 Ga0495664_0020731 3300046477 Bacteria 3793
423 Ga0495664_0024906 3300046477 Bacteria 3480
424 Ga0495664_0195180 3300046477 Bacteria 1227
425 Ga0495664_0390270 3300046477 Bacteria 836
426 Ga0495584_0054689 3300046491 Bacteria 2009
427 Ga0495585_0002421 3300046492 Bacteria 13352
428 Ga0495594_0219695 3300046499 Bacteria 1083
429 Ga0495608_0000456 3300046511 Bacteria 28492
430 Ga0495618_0005620 3300046514 Bacteria 7623
431 Ga0495618_0025547 3300046514 Bacteria 3666
432 Ga0495618_0157221 3300046514 Bacteria 1450
433 Ga0495618_0292942 3300046514 Bacteria 1012
434 Ga0495628_0009470 3300046516 Bacteria 8314
435 Ga0495628_0296980 3300046516 Bacteria 1196
436 Ga0495628_0590401 3300046516 Bacteria 794
437 Ga0495630_0005356 3300046517 Bacteria 9049
438 Ga0495630_0021898 3300046517 Bacteria 4720
439 Ga0495630_0033398 3300046517 Bacteria 3837
440 Ga0495643_0136437 3300046522 Bacteria 1227
441 Ga0495644_0000971 3300046523 Bacteria 11878
442 Ga0495663_0015299 3300046525 Bacteria 2160
443 Ga0495666_0001901 3300046526 Bacteria 10299
444 Ga0495666_0010902 3300046526 Bacteria 4532
445 Ga0495666_0112551 3300046526 Bacteria 1278
446 Ga0495652_0007617 3300046529 Bacteria 9974
447 Ga0495652_0037811 3300046529 Bacteria 4185
448 Ga0495652_0107272 3300046529 Bacteria 2253
449 Ga0495665_0003424 3300046531 Bacteria 8610
450 Ga0495665_0008645 3300046531 Bacteria 5528
451 Ga0495665_0032962 3300046531 Bacteria 2771
452 Ga0495665_0263348 3300046531 Bacteria 886
453 Ga0495640_0044252 3300046533 Bacteria 3096
454 Ga0495640_0051320 3300046533 Bacteria 2835
455 Ga0495640_0083813 3300046533 Bacteria 2115
456 Ga0495640_0085475 3300046533 Bacteria 2090
457 Ga0495640_0169913 3300046533 Bacteria 1393
458 Ga0495586_0000868 3300046535 Bacteria 17317
459 Ga0495586_0011444 3300046535 Bacteria 4717
460 Ga0495587_0003989 3300046536 Bacteria 9783
461 Ga0495587_0026742 3300046536 Bacteria 3515
462 Ga0495587_0033406 3300046536 Bacteria 3106
463 Ga0495645_0040612 3300046543 Bacteria 3393
464 Ga0495645_0090024 3300046543 Bacteria 2194
465 Ga0495645_0278088 3300046543 Bacteria 1102
466 Ga0495622_0007731 3300046557 Bacteria 4992
467 Ga0495633_0001638 3300046558 Bacteria 16887
468 Ga0495667_0000832 3300046559 Bacteria 19943
469 Ga0495667_0003460 3300046559 Bacteria 10583
470 Ga0495667_0017286 3300046559 Bacteria 4872
471 Ga0495667_0335828 3300046559 Bacteria 956
472 Ga0495656_0009323 3300046615 Bacteria 3526
473 Ga0495634_0006411 3300046642 Bacteria 8941
474 Ga0495634_0018189 3300046642 Bacteria 5006
475 Ga0495634_0055698 3300046642 Bacteria 2644
476 Ga0495634_0096704 3300046642 Bacteria 1912
477 Ga0495634_0257935 3300046642 Bacteria 1064
478 Ga0495635_0002323 3300046663 Bacteria 12923
479 Ga0495635_0023508 3300046663 Bacteria 4293
480 Ga0495635_0140124 3300046663 Bacteria 1647
481 Ga0495659_0020725 3300046664 Bacteria 2211
482 Ga0495588_0000486 3300046674 Bacteria 19669
483 Ga0495588_0031230 3300046674 Bacteria 2680
484 Ga0495657_0013851 3300046675 Bacteria 5935
485 Ga0495657_0134925 3300046675 Bacteria 1543
486 Ga0495657_0188921 3300046675 Bacteria 1260
487 Ga0495599_0007889 3300046678 Bacteria 6455
488 Ga0495599_0012721 3300046678 Bacteria 5190
489 Ga0495599_0017231 3300046678 Bacteria 4490
490 Ga0495623_0004185 3300046679 Bacteria 9508
491 Ga0495623_0062235 3300046679 Bacteria 2339
492 Ga0495646_0021750 3300046680 Bacteria 4051
493 Ga0495647_0004781 3300046681 Bacteria 4420
494 Ga0495647_0229528 3300046681 Bacteria 821
495 Ga0495658_0000479 3300046683 Bacteria 22023
496 Ga0495658_0017638 3300046683 Bacteria 3692
497 Ga0495658_0036508 3300046683 Bacteria 2711
498 Ga0495658_0129546 3300046683 Bacteria 1534
499 Ga0495613_0006828 3300046689 Bacteria 8523
500 Ga0495613_0007639 3300046689 Bacteria 8044
501 Ga0495613_0046405 3300046689 Bacteria 3213
502 Ga0495613_0131447 3300046689 Bacteria 1792
503 Ga0495624_0007919 3300046690 Bacteria 7452
504 Ga0495589_0030357 3300046794 Bacteria 2722
505 Ga0495600_0001355 3300046809 Bacteria 13523
506 Ga0495600_0010644 3300046809 Bacteria 5715
507 Ga0495600_0134162 3300046809 Bacteria 1608
508 Ga0495581_0010299 3300047315 Bacteria 5407
509 Ga0495581_0013719 3300047315 Bacteria 4699
510 Ga0495581_0143797 3300047315 Bacteria 1392
511 Ga0495581_0166896 3300047315 Bacteria 1287
512 Ga0495581_0332587 3300047315 Bacteria 887
513 Ga0495604_0001255 3300047317 Bacteria 20785
514 Ga0495604_0034295 3300047317 Bacteria 4015
515 Ga0495674_0023889 3300047319 Bacteria 5626
516 Ga0495674_0073436 3300047319 Bacteria 2948
517 Ga0495674_0165794 3300047319 Bacteria 1846
518 Ga0495672_0196034 3300047320 Bacteria 1013
519 Ga0495676_0008847 3300047321 Bacteria 9204
520 Ga0495676_0053520 3300047321 Bacteria 3216
521 Ga0495676_0085811 3300047321 Bacteria 2371
522 Ga0495676_0089423 3300047321 Bacteria 2307
523 Ga0495680_0014480 3300047322 Bacteria 6828
524 Ga0495680_0018883 3300047322 Bacteria 5838
525 Ga0495680_0021820 3300047322 Bacteria 5351
526 Ga0495680_0105517 3300047322 Bacteria 2095
527 Ga0495675_0000731 3300047444 Bacteria 20534
528 Ga0495675_0116414 3300047444 Bacteria 1666
529 Ga0495679_044332 3300047446 Bacteria 1363
530 Ga0495684_0007415 3300047471 Bacteria 8501
531 Ga0495684_0010871 3300047471 Bacteria 7037
532 Ga0495684_0010887 3300047471 Bacteria 7032
533 Ga0495684_0016146 3300047471 Bacteria 5749
534 Ga0495684_0101556 3300047471 Bacteria 2174
535 Ga0495684_0550385 3300047471 Bacteria 786
536 Ga0495593_0005475 3300047673 Bacteria 7496
537 Ga0495593_0008885 3300047673 Bacteria 5830
538 Ga0495593_0029345 3300047673 Bacteria 3016
539 Ga0495593_0031194 3300047673 Bacteria 2913
540 Ga0495593_0090623 3300047673 Bacteria 1575
541 Ga0495602_0001314 3300048088 Bacteria 24503
542 Ga0495602_0080260 3300048088 Bacteria 2749
543 Ga0495602_0252739 3300048088 Bacteria 1312
544 Ga0495614_0008988 3300048089 Bacteria 4434
545 Ga0496100_0004724 3300048903 Bacteria 7262
546 Ga0496100_0031903 3300048903 Bacteria 3279
547 Ga0496100_0227802 3300048903 Bacteria 1370
548 Ga0496101_0005150 3300048904 Bacteria 8317
549 Ga0496101_0035050 3300048904 Bacteria 3548
550 Ga0496101_0041512 3300048904 Bacteria 3280
551 Ga0496101_0072341 3300048904 Bacteria 2531
552 Ga0496102_0020649 3300048905 Bacteria 5820
553 Ga0496102_0053178 3300048905 Bacteria 3692
554 Ga0496102_0192482 3300048905 Bacteria 1922
555 Ga0496102_0210449 3300048905 Bacteria 1833
556 Ga0496102_0328760 3300048905 Bacteria 1440
557 Ga0496103_0085095 3300048906 Bacteria 1992
558 Ga0496103_0126593 3300048906 Bacteria 1629
559 Ga0496103_0329884 3300048906 Bacteria 981
560 Ga0496104_0002585 3300048907 Bacteria 15610
561 Ga0496104_0023182 3300048907 Bacteria 5706
562 Ga0496104_0051967 3300048907 Bacteria 3870
563 Ga0496104_0069653 3300048907 Bacteria 3344
564 Ga0496104_0072685 3300048907 Bacteria 3270
565 Ga0496104_0898952 3300048907 Bacteria 790
566 Ga0496105_0026580 3300048908 Bacteria 4723
567 Ga0496105_0058562 3300048908 Bacteria 3179
568 Ga0496105_0328016 3300048908 Bacteria 1226
569 Ga0496105_0636227 3300048908 Bacteria 824
570 Ga0496106_0027162 3300048909 Bacteria 4262
571 Ga0496106_0041261 3300048909 Bacteria 3457
572 Ga0496106_0694145 3300048909 Bacteria 811
573 Ga0496107_0018247 3300048910 Bacteria 4938
574 Ga0496107_0082716 3300048910 Bacteria 2341
575 Ga0496107_0110243 3300048910 Bacteria 2022
576 Ga0496107_0121847 3300048910 Bacteria 1921
577 Ga0496107_0162882 3300048910 Bacteria 1653
578 Ga0496108_0002626 3300048911 Bacteria 14399
579 Ga0496108_0083037 3300048911 Bacteria 2717
580 Ga0496108_0230984 3300048911 Bacteria 1608
581 Ga0496108_0237047 3300048911 Bacteria 1587
582 Ga0496108_0400830 3300048911 Bacteria 1198
583 Ga0496109_0008762 3300048912 Bacteria 8614
584 Ga0496109_0046963 3300048912 Bacteria 3923
585 Ga0496109_0238383 3300048912 Bacteria 1712
586 Ga0496110_0066510 3300048913 Bacteria 3187
587 Ga0496110_0097753 3300048913 Bacteria 2630
588 Ga0496110_0125838 3300048913 Bacteria 2312
589 Ga0496110_0699672 3300048913 Bacteria 915
590 Ga0496111_0068838 3300048914 Bacteria 2573
591 Ga0496111_0117970 3300048914 Bacteria 1958
592 Ga0496111_0353232 3300048914 Bacteria 1088
593 Ga0496112_0335297 3300048915 Bacteria 1456
594 Ga0496112_0383881 3300048915 Bacteria 1345
595 Ga0496113_0002614 3300048916 Bacteria 10536
596 Ga0496113_0656844 3300048916 Bacteria 838
597 Ga0496114_0003376 3300048917 Bacteria 12256
598 Ga0496114_0399804 3300048917 Bacteria 1216
599 Ga0496114_0415358 3300048917 Bacteria 1192
600 Ga0496114_0768193 3300048917 Bacteria 841
601 Ga0496115_0008582 3300048918 Bacteria 7563
602 Ga0496115_0059120 3300048918 Bacteria 3086
603 Ga0496115_0160402 3300048918 Bacteria 1858
604 Ga0496115_0174056 3300048918 Bacteria 1780
605 Ga0496115_0388635 3300048918 Bacteria 1133
606 Ga0496118_0312136 3300048921 Bacteria 857
607 Ga0496121_0242482 3300048924 Bacteria 1255
608 Ga0496125_0057680 3300048928 Bacteria 3143
609 Ga0496126_0497256 3300048929 Bacteria 975
610 Ga0496126_0750827 3300048929 Bacteria 753
611 Ga0501032_0129562 3300049569 Bacteria 1665
612 Ga0501038_0233153 3300049574 Bacteria 1464
613 Ga0501041_0278119 3300049577 Bacteria 1053
614 Ga0501042_0076686 3300049578 Bacteria 2393
615 Ga0501048_0097127 3300049582 Bacteria 2078
616 Ga0501071_0075851 3300049587 Bacteria 2455
617 Ga0501072_0062563 3300049588 Bacteria 2936
618 Ga0501072_0294505 3300049588 Bacteria 1290
619 Ga0501073_0024561 3300049589 Bacteria 4327
620 Ga0501073_0103298 3300049589 Bacteria 1979
621 Ga0501073_0425509 3300049589 Bacteria 918
622 Ga0501074_0519082 3300049590 Bacteria 844
623 Ga0501075_0041788 3300049591 Bacteria 3437
624 Ga0501076_0186034 3300049592 Bacteria 1694
625 Ga0501077_0128208 3300049593 Bacteria 1608
626 Ga0501079_0333600 3300049741 Bacteria 1188
627 Ga0501080_0126220 3300049742 Bacteria 2370
628 Ga0501080_0206640 3300049742 Bacteria 1801
629 Ga0501081_0047056 3300049743 Bacteria 2967
630 Ga0501081_0264306 3300049743 Bacteria 1258
631 Ga0501083_0140615 3300049744 Bacteria 1581
632 Ga0501035_0293351 3300049822 Bacteria 1372
633 Ga0501045_0408351 3300049824 Bacteria 1010
634 nmdc:mga03683_114355_c1 3300050489 Bacteria 1196
635 nmdc:mga03n38_225594_c1 3300050490 Bacteria 980
636 nmdc:mga0yw44_37612_c1 3300050492 Bacteria 2858
637 nmdc:mga0yw44_435985_c1 3300050492 Bacteria 888
638 nmdc:mga0yw44_5709_c1 3300050492 Bacteria 5927
639 nmdc:mga0k408_36837_c1 3300050493 Bacteria 2808
640 nmdc:mga0k408_39245_c1 3300050493 Bacteria 2719
641 nmdc:mga06z11_98250_c1 3300050494 Bacteria 1602
642 nmdc:mga04h51_112435_c1 3300050495 Bacteria 1006
643 nmdc:mga07m45_355829_c1 3300050496 Bacteria 851
644 nmdc:mga07m45_85580_c1 3300050496 Bacteria 1803
645 nmdc:mga05p37_130701_c1 3300050507 Bacteria 3081
646 nmdc:mga05p37_767418_c1 3300050507 Bacteria 1060
647 nmdc:mga0qj67_293783_c1 3300050509 Bacteria 1317
648 nmdc:mga0qj67_300_c1 3300050509 Bacteria 34395
649 nmdc:mga08y16_61532_c1 3300050511 Bacteria 3920
650 nmdc:mga08y16_967888_c1 3300050511 Bacteria 833
651 nmdc:mga0n895_1454_c1 3300050512 Bacteria 17715
652 nmdc:mga0n895_235132_c1 3300050512 Bacteria 1860
653 nmdc:mga0n895_84791_c1 3300050512 Bacteria 3162
654 nmdc:mga0rr50_198143_c1 3300050513 Bacteria 1649
655 nmdc:mga0rr50_27487_c1 3300050513 Bacteria 3984
656 nmdc:mga0rr50_28959_c1 3300050513 Bacteria 3899
657 nmdc:mga0rr50_292555_c1 3300050513 Bacteria 1361
658 nmdc:mga0rr50_470594_c1 3300050513 Bacteria 1067
659 nmdc:mga08x19_23223_c1 3300050514 Bacteria 3846
660 nmdc:mga0a205_206434_c1 3300050515 Bacteria 1854
661 Ga0495601_0009500 3300053077 Bacteria 5756
662 Ga0495601_0058921 3300053077 Bacteria 2434
663 Ga0495612_0006783 3300053078 Bacteria 4690
664 Ga0495612_0012419 3300053078 Bacteria 3433
665 Ga0495612_0017979 3300053078 Bacteria 2829
666 Ga0495612_0063204 3300053078 Bacteria 1535
667 Ga0495595_0003325 3300053084 Bacteria 6379
668 Ga0495595_0009755 3300053084 Bacteria 3977
669 Ga0495595_0112983 3300053084 Bacteria 1318
670 Ga0495619_0001702 3300053085 Bacteria 14564
671 Ga0495619_0002347 3300053085 Bacteria 12456
672 Ga0495619_0009169 3300053085 Bacteria 6249
673 Ga0495619_0009580 3300053085 Bacteria 6110
674 Ga0495619_0144278 3300053085 Bacteria 1641
675 Ga0500595_002962 3300053119 Bacteria 8088
676 Ga0500616_0053230 3300053153 Bacteria 2124
677 Ga0500616_0082299 3300053153 Bacteria 1615
678 Ga0500616_0090864 3300053153 Bacteria 1512
679 Ga0500627_0040489 3300053158 Bacteria 2000
680 Ga0501084_0040498 3300054114 Bacteria 3898
681 Ga0501084_0238849 3300054114 Bacteria 1534
682 Ga0501082_0802561 3300060353 Bacteria 823
683 Ga0530510_0113363 3300061734 Bacteria 1987
684 Ga0436364_0116353
685 Ga0070690_100010925
686 Ga0070670_100046926
687 Ga0070670_100060473
688 Ga0068869_100097230
689 Ga0070666_10005932
690 Ga0070666_10619188
691 Ga0068868_100010418
692 Ga0070660_100096949
693 Ga0070660_100132730
694 Ga0070689_100012423
695 Ga0070687_100186741
696 Ga0070661_100033135
697 Ga0070661_100119271
698 Ga0070692_10272966
699 Ga0070668_100467415
700 Ga0070675_100211778
701 Ga0070675_100391235
702 Ga0070671_100024390
703 Ga0070671_100078098
704 Ga0070671_100189185
705 Ga0070674_100021073
706 Ga0070674_100105943
707 Ga0070674_100171348
708 Ga0070674_100715757
709 Ga0070673_100008910
710 Ga0070673_100015324
711 Ga0070688_100054575
712 Ga0070688_100553498
713 Ga0070659_100095281
714 Ga0070659_100382969
715 Ga0070659_100625733
716 Ga0070667_100029619
717 Ga0070709_10000959
718 Ga0070709_10006049
719 Ga0070709_10436594
720 Ga0070714_100020249
721 Ga0070714_100189259
722 Ga0070714_100262854
723 Ga0070713_100002295
724 Ga0070713_100013439
725 Ga0070713_100059595
726 Ga0070713_100124356
727 Ga0070710_10010596
728 Ga0070710_10159171
729 Ga0070711_100013658
730 Ga0070711_100587496
731 Ga0070711_100799792
732 Ga0070694_100054554
733 Ga0070708_100760766
734 Ga0070708_100856175
735 Ga0070663_100013244
736 Ga0070678_100007461
737 Ga0070678_100085350
738 Ga0070678_100391868
739 Ga0070681_10039853
740 Ga0070681_10221976
741 Ga0068867_100158030
742 Ga0068867_100225594
743 Ga0070685_10018558
744 Ga0070679_100006622
745 Ga0070684_100041862
746 Ga0070672_100153214
747 Ga0070672_100380039
748 Ga0070672_100716079
749 Ga0070686_100018613
750 Ga0070686_100531045
751 Ga0070695_100397859
752 Ga0070696_100067508
753 Ga0070693_100050032
754 Ga0070693_100252807
755 Ga0070665_100035107
756 Ga0070665_100061187
757 Ga0070704_100446485
758 Ga0068855_100986381
759 Ga0070664_100184197
760 Ga0070664_100289558
761 Ga0068857_100462285
762 Ga0068854_100365715
763 Ga0068856_101004331
764 Ga0068859_100022536
765 Ga0068864_100017844
766 Ga0068864_100176869
767 Ga0068866_10055493
768 Ga0068866_10468114
769 Ga0068851_10045804
770 Ga0068863_100048579
771 Ga0068863_100362517
772 Ga0068858_100025042
773 Ga0068858_100073327
774 Ga0068858_100963133
775 Ga0068860_100102318
776 Ga0068860_100115640
777 Ga0081455_10001098
778 Ga0081455_10004142
779 Ga0081538_10120941
780 Ga0081540_1008984
781 Ga0081540_1030378
782 Ga0070717_10000587
783 Ga0070717_10092372
784 Ga0070717_10670651
785 Ga0075365_10159475
786 Ga0075365_10323267
787 Ga0075368_10004405
788 Ga0075363_100078504
789 Ga0075364_10225755
790 Ga0075432_10182398
791 Ga0070715_10010710
792 Ga0070715_10044410
793 Ga0070716_100006054
794 Ga0070712_100156935
795 Ga0075362_10049238
796 Ga0075367_10022841
797 Ga0075367_10236022
798 Ga0075369_10067388
799 Ga0075366_10070152
800 Ga0075366_10150677
801 Ga0097621_100013014
802 Ga0097621_100014809
803 Ga0097621_100158019
804 Ga0075370_10136593
805 Ga0075370_10153934
806 Ga0068871_100058230
807 Ga0068871_100134924
808 Ga0075430_100000489
809 Ga0075433_10187038
810 Ga0075434_100039062
811 Ga0075434_100055001
812 Ga0075434_100152425
813 Ga0075434_100280966
814 Ga0075434_100297316
815 Ga0075434_101081115
816 Ga0075429_100171739
817 Ga0068865_100073506
818 Ga0097620_100022536
819 Ga0075435_100130909
820 Ga0075435_100320337
821 Ga0099795_10026383
822 Ga0105251_10027457
823 Ga0111539_10048740
824 Ga0111539_10754462
825 Ga0105245_10054005
826 Ga0105245_10060016
827 Ga0105247_10022661
828 Ga0105247_10138355
829 Ga0114129_10345974
830 Ga0105243_10018351
831 Ga0105241_10013341
832 Ga0105241_10226581
833 Ga0105242_10078722
834 Ga0105242_10201733
835 Ga0105248_10028935
836 Ga0105248_10136044
837 Ga0105248_10372490
838 Ga0105237_10177099
839 Ga0105238_10123739
840 Ga0105249_10234089
841 Ga0105249_10264510
842 Ga0105239_10063582
843 Ga0105239_10069453
844 Ga0105239_10221589
845 Ga0105246_10692034
846 Ga0105246_10694317
847 Ga0157337_1002652
848 Ga0157341_1003372
849 Ga0157313_1001069
850 Ga0157373_10021474
851 Ga0157373_10315981
852 Ga0157370_10088499
853 Ga0157369_10091626
854 Ga0157369_10446264
855 Ga0157369_10539139
856 Ga0157374_10047944
857 Ga0157374_10063706
858 Ga0157378_10021332
859 Ga0157378_11246809
860 Ga0163162_10059841
861 Ga0163162_10197408
862 Ga0163162_10267186
863 Ga0157372_10234376
864 Ga0157372_11274726
865 Ga0157375_10204926
866 Ga0157375_10416880
867 Ga0163163_10029130
868 Ga0163163_10057142
869 Ga0163163_10209588
870 Ga0157380_10867461
871 Ga0157379_10029360
872 Ga0157379_10032697
873 Ga0157379_10055284
874 Ga0157379_10218005
875 Ga0206353_10022509
876 Ga0213874_10107914
877 Ga0213875_10000036
878 Ga0224572_1006068
879 Ga0207656_10044368
880 Ga0207713_1029786
881 Ga0207692_10090215
882 Ga0207692_10164398
883 Ga0207642_10210825
884 Ga0207710_10004429
885 Ga0207710_10085000
886 Ga0207688_10083227
887 Ga0207680_10015521
888 Ga0207685_10007496
889 Ga0207685_10087673
890 Ga0207699_10000725
891 Ga0207699_10055216
892 Ga0207699_10350135
893 Ga0207645_10547882
894 Ga0207654_10051923
895 Ga0207707_10092245
896 Ga0207693_10006334
897 Ga0207693_10023398
898 Ga0207663_10028071
899 Ga0207663_10323177
900 Ga0207663_10680822
901 Ga0207660_10080935
902 Ga0207662_10086551
903 Ga0207657_10321340
904 Ga0207652_10101268
905 Ga0207681_10176853
906 Ga0207694_10191612
907 Ga0207694_10465758
908 Ga0207650_10017115
909 Ga0207650_10037397
910 Ga0207650_10072003
911 Ga0207659_10041839
912 Ga0207659_10642460
913 Ga0207687_10011254
914 Ga0207700_10001592
915 Ga0207700_10123616
916 Ga0207700_10243021
917 Ga0207664_10013963
918 Ga0207664_10325268
919 Ga0207644_10012131
920 Ga0207644_10051509
921 Ga0207644_10103630
922 Ga0207690_10122314
923 Ga0207706_10032496
924 Ga0207706_10290316
925 Ga0207686_10015233
926 Ga0207686_10322560
927 Ga0207709_10087159
928 Ga0207709_10416913
929 Ga0207670_10005620
930 Ga0207670_10627595
931 Ga0207704_10187655
932 Ga0207691_10235873
933 Ga0207691_10333839
934 Ga0207711_10025137
935 Ga0207711_10058365
936 Ga0207711_10059244
937 Ga0207689_10027643
938 Ga0207689_10212673
939 Ga0207661_10552820
940 Ga0207679_10237387
941 Ga0207667_10474528
942 Ga0207651_10020138
943 Ga0207651_10033552
944 Ga0207651_10247635
945 Ga0207658_10025695
946 Ga0207677_10075303
947 Ga0207703_10040964
948 Ga0207703_10115320
949 Ga0207703_10409692
950 Ga0207703_10613505
951 Ga0207678_10039193
952 Ga0207702_10350652
953 Ga0207702_10355121
954 Ga0207702_10404836
955 Ga0207641_10036740
956 Ga0207641_10737681
957 Ga0207676_10020867
958 Ga0207676_10146487
959 Ga0207676_10251134
960 Ga0207674_10507031
961 Ga0207683_10001587
962 Ga0207683_10024973
963 Ga0207683_10025030
964 Ga0207683_10266724
965 Ga0207683_10475363
966 Ga0209813_10034072
967 Ga0207428_10079588
968 Ga0268266_10007526
969 Ga0268264_10100470
970 Ga0268264_10604179
971 Ga0268264_11025165
972 Ga0265318_10049023
973 Ga0265338_10011853
974 Ga0265762_1009470
975 Ga0265330_10030973
976 Ga0265332_10014555
977 Ga0265320_10015770
978 Ga0265325_10016782
979 Ga0265325_10041342
980 Ga0265329_10016573
981 Ga0265329_10053766
982 Ga0265340_10000863
983 Ga0265340_10029135
984 Ga0265340_10147895
985 Ga0265339_10000085
986 Ga0265339_10006084
987 Ga0265339_10029739
988 Ga0265331_10007430
989 Ga0265316_10063310
990 Ga0265313_10000647
991 Ga0265313_10028797
992 Ga0265314_10012548
993 Ga0265314_10062806
994 Ga0265314_10124427
995 Ga0265342_10000148
996 Ga0373959_0015454
997 Ga0373938_0016149
998 Ga0373938_0017749
999 Ga0373926_0000295
1000 Ga0373926_0007469
1001 Ga0373926_0136968
1002 Ga0373929_0009300
1003 Ga0373934_0006700
1004 Ga0373934_0012923
1005 Ga0373944_0002720
1006 Ga0373944_0018519
1007 Ga0373923_0034282
1008 Ga0373936_0014366
1009 Ga0373939_0005957
1010 Ga0373945_0000594
1011 Ga0373945_0022357
1012 Ga0373953_0004898
1013 Ga0373953_0073084
1014 Ga0373953_0085596
1015 Ga0373954_0034491
1016 Ga0373956_0003810
1017 Ga0373957_0013618
1018 Ga0373957_0058854
1019 Ga0373943_0000352
1020 Ga0373943_0003984
1021 Ga0373943_0005596
1022 Ga0373943_0016762
1023 Ga0373946_0011259
1024 Ga0373946_0018651
1025 Ga0373955_0004134
1026 Ga0373955_0007219
1027 Ga0373955_0052060
1028 Ga0373942_0023035
1029 Ga0373942_0054072
1030 Ga0373961_0025803
1031 Ga0373961_0038953
1032 Ga0373924_0008740
1033 Ga0373924_0105086
1034 Ga0373924_0148793
1035 Ga0373931_0011009
1036 Ga0373931_0130800
1037 Ga0373935_0014228
1038 Ga0373935_0021699
1039 Ga0373935_0036043
1040 Ga0373935_0040713
1041 Ga0373935_0068827
1042 Ga0373935_0158693
1043 Ga0373927_0004615
1044 Ga0373927_0011093
1045 Ga0373927_0044167
1046 Ga0373927_0066068
1047 Ga0373927_0069000
1048 Ga0373927_0120958
1049 Ga0373927_0121052
1050 Ga0373933_0001315
1051 Ga0373933_0308866
1052 Ga0373947_0003411
1053 Ga0373947_0029537
1054 Ga0373947_0062080
1055 Ga0373947_0078499
1056 Ga0373937_0001948
1057 Ga0373937_0002055
1058 Ga0373937_0004401
1059 Ga0373937_0061530
1060 Ga0373937_0663876
1061 Ga0373925_0005584
1062 Ga0373925_0006774
1063 Ga0373925_0042553
1064 Ga0373925_0118826
1065 Ga0395900_0422222
1066 Ga0395898_0347070
1067 Ga0395901_0063055
1068 Ga0436365_1398168
1069 Ga0436365_1552596
1070 Ga0436361_0634160
1071 Ga0436363_0142756
1072 Ga0436363_0287204
1073 Ga0451789_0016010
1074 Ga0451851_0712984
1075 Ga0466959_0084976
1076 Ga0495592_0002844
1077 Ga0495592_0004049
1078 Ga0495592_0141143
1079 Ga0495603_0008434
1080 Ga0495603_0015595
1081 Ga0495603_0045954
1082 Ga0495629_0006854
1083 Ga0495629_0030785
1084 Ga0495629_0153108
1085 Ga0495641_0003754
1086 Ga0495641_0105443
1087 Ga0495651_0001330
1088 Ga0495651_0002388
1089 Ga0495651_0114582
1090 Ga0495651_0316521
1091 Ga0495653_0047273
1092 Ga0495653_0085611
1093 Ga0495653_0332598
1094 Ga0495580_0010086
1095 Ga0495580_0101278
1096 Ga0495580_0189663
1097 Ga0495582_0004877
1098 Ga0495582_0014883
1099 Ga0495582_0075264
1100 Ga0495639_0003031
1101 Ga0495662_0003361
1102 Ga0495662_0055625
1103 Ga0495662_0126264
1104 Ga0495662_0134431
1105 Ga0495664_0020731
1106 Ga0495664_0024906
1107 Ga0495664_0195180
1108 Ga0495664_0390270
1109 Ga0495584_0054689
1110 Ga0495585_0002421
1111 Ga0495594_0219695
1112 Ga0495608_0000456
1113 Ga0495618_0005620
1114 Ga0495618_0025547
1115 Ga0495618_0157221
1116 Ga0495618_0292942
1117 Ga0495628_0009470
1118 Ga0495628_0296980
1119 Ga0495628_0590401
1120 Ga0495630_0005356
1121 Ga0495630_0021898
1122 Ga0495630_0033398
1123 Ga0495643_0136437
1124 Ga0495644_0000971
1125 Ga0495663_0015299
1126 Ga0495666_0001901
1127 Ga0495666_0010902
1128 Ga0495666_0112551
1129 Ga0495652_0007617
1130 Ga0495652_0037811
1131 Ga0495652_0107272
1132 Ga0495665_0003424
1133 Ga0495665_0008645
1134 Ga0495665_0032962
1135 Ga0495665_0263348
1136 Ga0495640_0044252
1137 Ga0495640_0051320
1138 Ga0495640_0083813
1139 Ga0495640_0085475
1140 Ga0495640_0169913
1141 Ga0495586_0000868
1142 Ga0495586_0011444
1143 Ga0495587_0003989
1144 Ga0495587_0026742
1145 Ga0495587_0033406
1146 Ga0495645_0040612
1147 Ga0495645_0090024
1148 Ga0495645_0278088
1149 Ga0495622_0007731
1150 Ga0495633_0001638
1151 Ga0495667_0000832
1152 Ga0495667_0003460
1153 Ga0495667_0017286
1154 Ga0495667_0335828
1155 Ga0495656_0009323
1156 Ga0495634_0006411
1157 Ga0495634_0018189
1158 Ga0495634_0055698
1159 Ga0495634_0096704
1160 Ga0495634_0257935
1161 Ga0495635_0002323
1162 Ga0495635_0023508
1163 Ga0495635_0140124
1164 Ga0495659_0020725
1165 Ga0495588_0000486
1166 Ga0495588_0031230
1167 Ga0495657_0013851
1168 Ga0495657_0134925
1169 Ga0495657_0188921
1170 Ga0495599_0007889
1171 Ga0495599_0012721
1172 Ga0495599_0017231
1173 Ga0495623_0004185
1174 Ga0495623_0062235
1175 Ga0495646_0021750
1176 Ga0495647_0004781
1177 Ga0495647_0229528
1178 Ga0495658_0000479
1179 Ga0495658_0017638
1180 Ga0495658_0036508
1181 Ga0495658_0129546
1182 Ga0495613_0006828
1183 Ga0495613_0007639
1184 Ga0495613_0046405
1185 Ga0495613_0131447
1186 Ga0495624_0007919
1187 Ga0495589_0030357
1188 Ga0495600_0001355
1189 Ga0495600_0010644
1190 Ga0495600_0134162
1191 Ga0495581_0010299
1192 Ga0495581_0013719
1193 Ga0495581_0143797
1194 Ga0495581_0166896
1195 Ga0495581_0332587
1196 Ga0495604_0001255
1197 Ga0495604_0034295
1198 Ga0495674_0023889
1199 Ga0495674_0073436
1200 Ga0495674_0165794
1201 Ga0495672_0196034
1202 Ga0495676_0008847
1203 Ga0495676_0053520
1204 Ga0495676_0085811
1205 Ga0495676_0089423
1206 Ga0495680_0014480
1207 Ga0495680_0018883
1208 Ga0495680_0021820
1209 Ga0495680_0105517
1210 Ga0495675_0000731
1211 Ga0495675_0116414
1212 Ga0495679_044332
1213 Ga0495684_0007415
1214 Ga0495684_0010871
1215 Ga0495684_0010887
1216 Ga0495684_0016146
1217 Ga0495684_0101556
1218 Ga0495684_0550385
1219 Ga0495593_0005475
1220 Ga0495593_0008885
1221 Ga0495593_0029345
1222 Ga0495593_0031194
1223 Ga0495593_0090623
1224 Ga0495602_0001314
1225 Ga0495602_0080260
1226 Ga0495602_0252739
1227 Ga0495614_0008988
1228 Ga0496100_0004724
1229 Ga0496100_0031903
1230 Ga0496100_0227802
1231 Ga0496101_0005150
1232 Ga0496101_0035050
1233 Ga0496101_0041512
1234 Ga0496101_0072341
1235 Ga0496102_0020649
1236 Ga0496102_0053178
1237 Ga0496102_0192482
1238 Ga0496102_0210449
1239 Ga0496102_0328760
1240 Ga0496103_0085095
1241 Ga0496103_0126593
1242 Ga0496103_0329884
1243 Ga0496104_0002585
1244 Ga0496104_0023182
1245 Ga0496104_0051967
1246 Ga0496104_0069653
1247 Ga0496104_0072685
1248 Ga0496104_0898952
1249 Ga0496105_0026580
1250 Ga0496105_0058562
1251 Ga0496105_0328016
1252 Ga0496105_0636227
1253 Ga0496106_0027162
1254 Ga0496106_0041261
1255 Ga0496106_0694145
1256 Ga0496107_0018247
1257 Ga0496107_0082716
1258 Ga0496107_0110243
1259 Ga0496107_0121847
1260 Ga0496107_0162882
1261 Ga0496108_0002626
1262 Ga0496108_0083037
1263 Ga0496108_0230984
1264 Ga0496108_0237047
1265 Ga0496108_0400830
1266 Ga0496109_0008762
1267 Ga0496109_0046963
1268 Ga0496109_0238383
1269 Ga0496110_0066510
1270 Ga0496110_0097753
1271 Ga0496110_0125838
1272 Ga0496110_0699672
1273 Ga0496111_0068838
1274 Ga0496111_0117970
1275 Ga0496111_0353232
1276 Ga0496112_0335297
1277 Ga0496112_0383881
1278 Ga0496113_0002614
1279 Ga0496113_0656844
1280 Ga0496114_0003376
1281 Ga0496114_0399804
1282 Ga0496114_0415358
1283 Ga0496114_0768193
1284 Ga0496115_0008582
1285 Ga0496115_0059120
1286 Ga0496115_0160402
1287 Ga0496115_0174056
1288 Ga0496115_0388635
1289 Ga0496118_0312136
1290 Ga0496121_0242482
1291 Ga0496125_0057680
1292 Ga0496126_0497256
1293 Ga0496126_0750827
1294 Ga0501032_0129562
1295 Ga0501038_0233153
1296 Ga0501041_0278119
1297 Ga0501042_0076686
1298 Ga0501048_0097127
1299 Ga0501071_0075851
1300 Ga0501072_0062563
1301 Ga0501072_0294505
1302 Ga0501073_0024561
1303 Ga0501073_0103298
1304 Ga0501073_0425509
1305 Ga0501074_0519082
1306 Ga0501075_0041788
1307 Ga0501076_0186034
1308 Ga0501077_0128208
1309 Ga0501079_0333600
1310 Ga0501080_0126220
1311 Ga0501080_0206640
1312 Ga0501081_0047056
1313 Ga0501081_0264306
1314 Ga0501083_0140615
1315 Ga0501035_0293351
1316 Ga0501045_0408351
1317 nmdc:mga03683_114355_c1
1318 nmdc:mga03n38_225594_c1
1319 nmdc:mga0yw44_37612_c1
1320 nmdc:mga0yw44_435985_c1
1321 nmdc:mga0yw44_5709_c1
1322 nmdc:mga0k408_36837_c1
1323 nmdc:mga0k408_39245_c1
1324 nmdc:mga06z11_98250_c1
1325 nmdc:mga04h51_112435_c1
1326 nmdc:mga07m45_355829_c1
1327 nmdc:mga07m45_85580_c1
1328 nmdc:mga05p37_130701_c1
1329 nmdc:mga05p37_767418_c1
1330 nmdc:mga0qj67_293783_c1
1331 nmdc:mga0qj67_300_c1
1332 nmdc:mga08y16_61532_c1
1333 nmdc:mga08y16_967888_c1
1334 nmdc:mga0n895_1454_c1
1335 nmdc:mga0n895_235132_c1
1336 nmdc:mga0n895_84791_c1
1337 nmdc:mga0rr50_198143_c1
1338 nmdc:mga0rr50_27487_c1
1339 nmdc:mga0rr50_28959_c1
1340 nmdc:mga0rr50_292555_c1
1341 nmdc:mga0rr50_470594_c1
1342 nmdc:mga08x19_23223_c1
1343 nmdc:mga0a205_206434_c1
1344 Ga0495601_0009500
1345 Ga0495601_0058921
1346 Ga0495612_0006783
1347 Ga0495612_0012419
1348 Ga0495612_0017979
1349 Ga0495612_0063204
1350 Ga0495595_0003325
1351 Ga0495595_0009755
1352 Ga0495595_0112983
1353 Ga0495619_0001702
1354 Ga0495619_0002347
1355 Ga0495619_0009169
1356 Ga0495619_0009580
1357 Ga0495619_0144278
1358 Ga0500595_002962
1359 Ga0500616_0053230
1360 Ga0500616_0082299
1361 Ga0500616_0090864
1362 Ga0500627_0040489
1363 Ga0501084_0040498
1364 Ga0501084_0238849
1365 Ga0501082_0802561
1366 Ga0530510_0113363

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02230

Abhydrolase_2

Phospholipase/Carboxylesterase

11

218

0.95

PF01738

DLH

Dienelactone hydrolase family

80

206

0.81

PF03959

FSH1

Serine hydrolase (FSH1)

19

186

0.68

Structural Annotation

Top 5 Hits

ID Description Score Start End
5dwd-assembly1.cif.gz_A crystal structure of esterase pe8 0.9489 2 219
5dwd-assembly1.cif.gz_A crystal structure of esterase pe8 0.9446 2 219
4fhz-assembly1.cif.gz_A-2 crystal structure of a carboxyl esterase at 2.0 angstrom resolution 0.9354 3 219
4ftw-assembly1.cif.gz_A-2 crystal structure of a carboxyl esterase n110c/l145h at 2.3 angstrom resolution 0.9311 3 219
4fhz-assembly1.cif.gz_A-2 crystal structure of a carboxyl esterase at 2.0 angstrom resolution 0.9107 3 219
ID Description Score Start End Superfamily
5dwdA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9489 2 219 3.40.50.1820
5dwdA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9446 2 219 3.40.50.1820
4ftwA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9311 3 219 3.40.50.1820
4ftwA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9065 3 219 3.40.50.1820
af_P76561_1_206_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.882 3 223 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A327JVD3-F1-model_v4 deleted 0.9791 2 221
AF-A0A3D5UVL8-F1-model_v4 Phospholipase 0.9747 3 122 GO:0016787
AF-A0A6C1KYG3-F1-model_v4 Phospholipase 0.9729 4 219 GO:0016787
AF-A0A812QUR1-F1-model_v4 deleted 0.9721 2 221
AF-A0A2E5Z8M1-F1-model_v4 Phospholipase 0.9704 1 219 GO:0016787

Map