F474946
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 682 | 310 | 674 | 218 |
Family's Representative Sequence
| Representative Sequence | 3300050507|nmdc:mga05p37_115691_c1|nmdc:mga05p37_115691_c1_981_1763 |
| Length | 260 |
| Sequence | VNAARSAARAGRSRRRDFCGALRFAPSVPKGVQSLAPDSEEDIMALRIGDEAPNFTAETTEGKINFHEWIGDGWAILFSHPKDFTPVCTTELGYMAKLKPEFAKRNVKVLGLSIDPVDDHKRWAKDIEETQGAAPNYPIVGDADLNVAKMYDMIHPNAAGGKRTAADNATIRSVFVVGPDKKIKLTLTYPMSTGRNFDEVLRVIDSMQLTAKHKVATPVNWKQGEDVIIVPAVSDDEAKQKFPGGWKAPKPYLRIVPQPK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2501025502 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 3 | 2510917013 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 4 | 2738541284 | Pedobacter sp. YR016 | Isolate | Unclassified |
| 5 | 2738543023 | Pedobacter sp. OK628 | Isolate | Unclassified |
| 6 | 2775506987 | Pedobacter ginsengisoli T01R-27 | Isolate | Unclassified |
| 7 | 2852627209 | Pedobacter sp. AK017 | Isolate | Rhizosphere |
| 8 | 2919186247 | Pedobacter africanus 2697 | Isolate | Rhizosphere |
| 9 | 2939664404 | Pedobacter africanus 2990 | Isolate | Rhizosphere |
| 10 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 11 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 12 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 19 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 22 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 44 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 51 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 59 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 61 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 62 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 63 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 64 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 65 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 66 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 67 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 68 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 69 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 70 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 71 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 72 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 73 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 74 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 79 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 81 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 82 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 83 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 84 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 85 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 86 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 87 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 88 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 89 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 91 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 92 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 114 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 119 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 120 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 121 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 122 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 123 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 124 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 186 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 188 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 192 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 193 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 194 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 195 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 196 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 197 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 198 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 199 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 200 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 201 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 202 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 203 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 204 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 205 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 206 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 207 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 208 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 209 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 210 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 211 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 212 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 213 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 214 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 215 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 216 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 217 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 218 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 219 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 220 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 221 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 222 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 223 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 224 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 225 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 226 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 227 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 228 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 251 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 252 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 253 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 254 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 255 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 256 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 257 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 258 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 259 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 260 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 263 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 268 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 287 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 290 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 291 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 292 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 293 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 294 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 295 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 296 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 297 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 298 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 299 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 303 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 304 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 305 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 307 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 308 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 310 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.39 |
| Metatranscriptomes | 0.44 |
| Isolates | 1.17 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.2 |
| Nodule | 0 |
| Rhizoplane | 2.64 |
| Rhizosphere | 94.57 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.59 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_490068 | 2162886007 | Bacteria | 4944 |
| 2 | JGI24744J21845_10015512 | 3300002077 | Bacteria | 1522 |
| 3 | Ga0055537_1016852 | 3300003773 | Bacteria | 1221 |
| 4 | Ga0065714_10002962 | 3300005288 | Bacteria | 12102 |
| 5 | Ga0065714_10015604 | 3300005288 | Bacteria | 2689 |
| 6 | Ga0065704_10070382 | 3300005289 | Bacteria | 27921 |
| 7 | Ga0065704_10250521 | 3300005289 | Bacteria | 990 |
| 8 | Ga0065704_10408407 | 3300005289 | Bacteria | 744 |
| 9 | Ga0070676_10019655 | 3300005328 | Bacteria | 3762 |
| 10 | Ga0070676_10107161 | 3300005328 | Bacteria | 1735 |
| 11 | Ga0070690_100164642 | 3300005330 | Bacteria | 1522 |
| 12 | Ga0070690_100273480 | 3300005330 | Bacteria | 1202 |
| 13 | Ga0070670_100001819 | 3300005331 | Bacteria | 17374 |
| 14 | Ga0070670_100009968 | 3300005331 | Bacteria | 8107 |
| 15 | Ga0070677_10245983 | 3300005333 | Unclassified | 885 |
| 16 | Ga0070677_10276002 | 3300005333 | Bacteria | 845 |
| 17 | Ga0068869_100112140 | 3300005334 | Bacteria | 2076 |
| 18 | Ga0068869_100221957 | 3300005334 | Bacteria | 1498 |
| 19 | Ga0070666_10012713 | 3300005335 | Bacteria | 5320 |
| 20 | Ga0070666_10023538 | 3300005335 | Bacteria | 4010 |
| 21 | Ga0070666_10123910 | 3300005335 | Bacteria | 1793 |
| 22 | Ga0070680_100000283 | 3300005336 | Bacteria | 33791 |
| 23 | Ga0070680_100217127 | 3300005336 | Bacteria | 1614 |
| 24 | Ga0068868_100357268 | 3300005338 | Bacteria | 1252 |
| 25 | Ga0070689_100050953 | 3300005340 | Bacteria | 3198 |
| 26 | Ga0070691_10144032 | 3300005341 | Bacteria | 1217 |
| 27 | Ga0070687_100017499 | 3300005343 | Bacteria | 3297 |
| 28 | Ga0070687_100051057 | 3300005343 | Bacteria | 2139 |
| 29 | Ga0070668_100002408 | 3300005347 | Bacteria | 13768 |
| 30 | Ga0070668_100028668 | 3300005347 | Bacteria | 4224 |
| 31 | Ga0070668_100396520 | 3300005347 | Unclassified | 1177 |
| 32 | Ga0070669_100022773 | 3300005353 | Bacteria | 4480 |
| 33 | Ga0070669_100089021 | 3300005353 | Bacteria | 2311 |
| 34 | Ga0070669_100115773 | 3300005353 | Bacteria | 2039 |
| 35 | Ga0070669_100205485 | 3300005353 | Bacteria | 1551 |
| 36 | Ga0070669_100288406 | 3300005353 | Bacteria | 1317 |
| 37 | Ga0070675_100010686 | 3300005354 | Bacteria | 7179 |
| 38 | Ga0070675_100203326 | 3300005354 | Bacteria | 1719 |
| 39 | Ga0070675_100216508 | 3300005354 | Bacteria | 1666 |
| 40 | Ga0070675_100235633 | 3300005354 | Bacteria | 1598 |
| 41 | Ga0070675_100317945 | 3300005354 | Bacteria | 1375 |
| 42 | Ga0070671_100106789 | 3300005355 | Bacteria | 2350 |
| 43 | Ga0070671_100132914 | 3300005355 | Bacteria | 2096 |
| 44 | Ga0070671_100845459 | 3300005355 | Bacteria | 798 |
| 45 | Ga0070674_100083171 | 3300005356 | Bacteria | 2291 |
| 46 | Ga0070673_100029652 | 3300005364 | Bacteria | 4082 |
| 47 | Ga0070673_100045367 | 3300005364 | Bacteria | 3408 |
| 48 | Ga0070673_100101569 | 3300005364 | Bacteria | 2370 |
| 49 | Ga0070673_100182617 | 3300005364 | Bacteria | 1797 |
| 50 | Ga0070673_100286821 | 3300005364 | Bacteria | 1445 |
| 51 | Ga0070673_100569468 | 3300005364 | Bacteria | 1030 |
| 52 | Ga0070688_100208176 | 3300005365 | Bacteria | 1372 |
| 53 | Ga0070667_100001213 | 3300005367 | Bacteria | 23490 |
| 54 | Ga0070667_100096108 | 3300005367 | Unclassified | 2555 |
| 55 | Ga0070667_100244627 | 3300005367 | Bacteria | 1603 |
| 56 | Ga0070703_10042781 | 3300005406 | Bacteria | 1418 |
| 57 | Ga0070709_10161693 | 3300005434 | Bacteria | 1558 |
| 58 | Ga0070709_10175533 | 3300005434 | Bacteria | 1501 |
| 59 | Ga0070713_100189035 | 3300005436 | Bacteria | 1855 |
| 60 | Ga0070705_100074896 | 3300005440 | Bacteria | 2059 |
| 61 | Ga0070705_100307002 | 3300005440 | Bacteria | 1139 |
| 62 | Ga0070700_100067109 | 3300005441 | Bacteria | 2278 |
| 63 | Ga0070694_100279790 | 3300005444 | Bacteria | 1272 |
| 64 | Ga0070708_100014071 | 3300005445 | Bacteria | 6575 |
| 65 | Ga0070708_100020712 | 3300005445 | Bacteria | 5552 |
| 66 | Ga0070708_100024505 | 3300005445 | Bacteria | 5150 |
| 67 | Ga0070708_100037390 | 3300005445 | Bacteria | 4234 |
| 68 | Ga0070708_100217129 | 3300005445 | Bacteria | 1793 |
| 69 | Ga0070708_100764229 | 3300005445 | Bacteria | 909 |
| 70 | Ga0070678_100016719 | 3300005456 | Bacteria | 4701 |
| 71 | Ga0070678_101002772 | 3300005456 | Bacteria | 768 |
| 72 | Ga0070662_100020338 | 3300005457 | Bacteria | 4520 |
| 73 | Ga0070681_10064166 | 3300005458 | Bacteria | 3644 |
| 74 | Ga0068867_100002403 | 3300005459 | Bacteria | 13169 |
| 75 | Ga0068867_100081084 | 3300005459 | Bacteria | 2445 |
| 76 | Ga0068867_100108153 | 3300005459 | Bacteria | 2132 |
| 77 | Ga0068867_100132955 | 3300005459 | Bacteria | 1936 |
| 78 | Ga0070706_100001637 | 3300005467 | Bacteria | 23327 |
| 79 | Ga0070706_100018923 | 3300005467 | Bacteria | 6352 |
| 80 | Ga0070706_100032060 | 3300005467 | Bacteria | 4846 |
| 81 | Ga0070706_100057312 | 3300005467 | Bacteria | 3595 |
| 82 | Ga0070706_100074118 | 3300005467 | Bacteria | 3151 |
| 83 | Ga0070706_100119084 | 3300005467 | Bacteria | 2461 |
| 84 | Ga0070706_100125586 | 3300005467 | Bacteria | 2392 |
| 85 | Ga0070706_100190155 | 3300005467 | Bacteria | 1918 |
| 86 | Ga0070706_100340799 | 3300005467 | Bacteria | 1398 |
| 87 | Ga0070707_100027344 | 3300005468 | Bacteria | 5427 |
| 88 | Ga0070707_100048385 | 3300005468 | Bacteria | 4073 |
| 89 | Ga0070698_100030522 | 3300005471 | Bacteria | 5587 |
| 90 | Ga0070698_100049404 | 3300005471 | Bacteria | 4293 |
| 91 | Ga0070698_100157695 | 3300005471 | Bacteria | 2215 |
| 92 | Ga0070698_100159123 | 3300005471 | Bacteria | 2203 |
| 93 | Ga0070698_100161258 | 3300005471 | Bacteria | 2186 |
| 94 | Ga0070698_100653532 | 3300005471 | Bacteria | 993 |
| 95 | Ga0070699_100004353 | 3300005518 | Bacteria | 12517 |
| 96 | Ga0070699_100018538 | 3300005518 | Bacteria | 5978 |
| 97 | Ga0070699_100109027 | 3300005518 | Bacteria | 2430 |
| 98 | Ga0070699_100524806 | 3300005518 | Bacteria | 1077 |
| 99 | Ga0070679_100031849 | 3300005530 | Bacteria | 5213 |
| 100 | Ga0070697_100013647 | 3300005536 | Bacteria | 6373 |
| 101 | Ga0070697_100030719 | 3300005536 | Bacteria | 4316 |
| 102 | Ga0070697_100175584 | 3300005536 | Bacteria | 1815 |
| 103 | Ga0070697_100242098 | 3300005536 | Bacteria | 1541 |
| 104 | Ga0070697_100250470 | 3300005536 | Bacteria | 1514 |
| 105 | Ga0070697_100413280 | 3300005536 | Bacteria | 1172 |
| 106 | Ga0070697_100443581 | 3300005536 | Bacteria | 1130 |
| 107 | Ga0068853_100712376 | 3300005539 | Bacteria | 958 |
| 108 | Ga0070672_100000358 | 3300005543 | Bacteria | 26306 |
| 109 | Ga0070672_100322934 | 3300005543 | Bacteria | 1312 |
| 110 | Ga0070672_100419835 | 3300005543 | Bacteria | 1149 |
| 111 | Ga0070672_100424364 | 3300005543 | Unclassified | 1142 |
| 112 | Ga0070686_100362255 | 3300005544 | Bacteria | 1092 |
| 113 | Ga0070695_100001672 | 3300005545 | Bacteria | 12488 |
| 114 | Ga0070695_100299265 | 3300005545 | Bacteria | 1188 |
| 115 | Ga0070695_100361909 | 3300005545 | Bacteria | 1090 |
| 116 | Ga0070696_100037797 | 3300005546 | Bacteria | 3330 |
| 117 | Ga0070696_100116227 | 3300005546 | Bacteria | 1931 |
| 118 | Ga0070696_100311418 | 3300005546 | Bacteria | 1209 |
| 119 | Ga0070693_100235768 | 3300005547 | Bacteria | 1206 |
| 120 | Ga0070665_100087247 | 3300005548 | Bacteria | 3125 |
| 121 | Ga0070665_100249135 | 3300005548 | Bacteria | 1777 |
| 122 | Ga0070665_100365831 | 3300005548 | Bacteria | 1449 |
| 123 | Ga0070665_100718737 | 3300005548 | Bacteria | 1012 |
| 124 | Ga0070704_100024905 | 3300005549 | Bacteria | 3932 |
| 125 | Ga0070704_100287041 | 3300005549 | Bacteria | 1366 |
| 126 | Ga0068855_100014781 | 3300005563 | Bacteria | 9401 |
| 127 | Ga0070664_100060259 | 3300005564 | Bacteria | 3231 |
| 128 | Ga0070664_100378095 | 3300005564 | Bacteria | 1292 |
| 129 | Ga0068857_100002053 | 3300005577 | Bacteria | 16357 |
| 130 | Ga0068856_100155007 | 3300005614 | Bacteria | 2300 |
| 131 | Ga0068859_100004248 | 3300005617 | Bacteria | 14627 |
| 132 | Ga0068859_100098657 | 3300005617 | Bacteria | 2975 |
| 133 | Ga0068859_100336199 | 3300005617 | Bacteria | 1604 |
| 134 | Ga0068859_100640172 | 3300005617 | Bacteria | 1155 |
| 135 | Ga0068859_100764527 | 3300005617 | Bacteria | 1055 |
| 136 | Ga0068864_100000864 | 3300005618 | Bacteria | 25502 |
| 137 | Ga0068864_100002192 | 3300005618 | Bacteria | 16114 |
| 138 | Ga0068864_100046442 | 3300005618 | Bacteria | 3726 |
| 139 | Ga0068864_100228502 | 3300005618 | Bacteria | 1720 |
| 140 | Ga0068864_100230522 | 3300005618 | Bacteria | 1713 |
| 141 | Ga0068864_100286243 | 3300005618 | Bacteria | 1539 |
| 142 | Ga0068864_100909561 | 3300005618 | Bacteria | 869 |
| 143 | Ga0068866_10234940 | 3300005718 | Unclassified | 1114 |
| 144 | Ga0068861_100001505 | 3300005719 | Bacteria | 14788 |
| 145 | Ga0068861_100054706 | 3300005719 | Bacteria | 3041 |
| 146 | Ga0068861_100338774 | 3300005719 | Unclassified | 1315 |
| 147 | Ga0068870_10019068 | 3300005840 | Bacteria | 3322 |
| 148 | Ga0068870_10035750 | 3300005840 | Bacteria | 2551 |
| 149 | Ga0068870_10110510 | 3300005840 | Bacteria | 1568 |
| 150 | Ga0068870_10178857 | 3300005840 | Bacteria | 1272 |
| 151 | Ga0068863_100007858 | 3300005841 | Bacteria | 10429 |
| 152 | Ga0068863_100018650 | 3300005841 | Bacteria | 6638 |
| 153 | Ga0068863_100025648 | 3300005841 | Bacteria | 5621 |
| 154 | Ga0068863_100182004 | 3300005841 | Bacteria | 2017 |
| 155 | Ga0068863_100273367 | 3300005841 | Bacteria | 1636 |
| 156 | Ga0068863_100450198 | 3300005841 | Bacteria | 1263 |
| 157 | Ga0068863_100668751 | 3300005841 | Bacteria | 1031 |
| 158 | Ga0068858_100003730 | 3300005842 | Bacteria | 15077 |
| 159 | Ga0068858_100836970 | 3300005842 | Bacteria | 898 |
| 160 | Ga0068858_101245948 | 3300005842 | Unclassified | 731 |
| 161 | Ga0068860_100003546 | 3300005843 | Bacteria | 16047 |
| 162 | Ga0068860_100072868 | 3300005843 | Unclassified | 3264 |
| 163 | Ga0068860_100079628 | 3300005843 | Bacteria | 3115 |
| 164 | Ga0068860_100440198 | 3300005843 | Bacteria | 1295 |
| 165 | Ga0068862_100011184 | 3300005844 | Bacteria | 7411 |
| 166 | Ga0068862_100060778 | 3300005844 | Bacteria | 3247 |
| 167 | Ga0068862_100160392 | 3300005844 | Bacteria | 2007 |
| 168 | Ga0081455_10114844 | 3300005937 | Bacteria | 2132 |
| 169 | Ga0081538_10013885 | 3300005981 | Bacteria | 6346 |
| 170 | Ga0081538_10051883 | 3300005981 | Bacteria | 2457 |
| 171 | Ga0081539_10035957 | 3300005985 | Bacteria | 2969 |
| 172 | Ga0070717_10337512 | 3300006028 | Bacteria | 1345 |
| 173 | Ga0070715_10268150 | 3300006163 | Bacteria | 900 |
| 174 | Ga0070715_10355242 | 3300006163 | Bacteria | 802 |
| 175 | Ga0070716_100003300 | 3300006173 | Bacteria | 7582 |
| 176 | Ga0070716_100311847 | 3300006173 | Bacteria | 1099 |
| 177 | Ga0070712_100006093 | 3300006175 | Bacteria | 7466 |
| 178 | Ga0070712_100013372 | 3300006175 | Bacteria | 5244 |
| 179 | Ga0070712_100297080 | 3300006175 | Bacteria | 1306 |
| 180 | Ga0075367_10012918 | 3300006178 | Bacteria | 4474 |
| 181 | Ga0075367_10238631 | 3300006178 | Bacteria | 1139 |
| 182 | Ga0097621_100043127 | 3300006237 | Bacteria | 3636 |
| 183 | Ga0097621_100064774 | 3300006237 | Bacteria | 3006 |
| 184 | Ga0068871_100033269 | 3300006358 | Bacteria | 4082 |
| 185 | Ga0068871_100096764 | 3300006358 | Bacteria | 2467 |
| 186 | Ga0068871_100125108 | 3300006358 | Unclassified | 2175 |
| 187 | Ga0068871_100311150 | 3300006358 | Bacteria | 1385 |
| 188 | Ga0075428_100005739 | 3300006844 | Bacteria | 13790 |
| 189 | Ga0075428_100008340 | 3300006844 | Bacteria | 11489 |
| 190 | Ga0075428_100025808 | 3300006844 | Bacteria | 6507 |
| 191 | Ga0075428_100060939 | 3300006844 | Bacteria | 4132 |
| 192 | Ga0075428_100095625 | 3300006844 | Bacteria | 3238 |
| 193 | Ga0075428_100138309 | 3300006844 | Bacteria | 2648 |
| 194 | Ga0075428_100557520 | 3300006844 | Bacteria | 1225 |
| 195 | Ga0075428_100672139 | 3300006844 | Bacteria | 1104 |
| 196 | Ga0075428_101207724 | 3300006844 | Bacteria | 797 |
| 197 | Ga0075430_100018379 | 3300006846 | Bacteria | 5949 |
| 198 | Ga0075430_100086442 | 3300006846 | Bacteria | 2624 |
| 199 | Ga0075431_100036382 | 3300006847 | Bacteria | 5071 |
| 200 | Ga0075431_100069065 | 3300006847 | Bacteria | 3646 |
| 201 | Ga0075431_100135129 | 3300006847 | Bacteria | 2542 |
| 202 | Ga0075431_100306138 | 3300006847 | Bacteria | 1605 |
| 203 | Ga0075433_10007413 | 3300006852 | Bacteria | 8710 |
| 204 | Ga0075433_10015885 | 3300006852 | Bacteria | 6190 |
| 205 | Ga0075433_10026125 | 3300006852 | Bacteria | 4940 |
| 206 | Ga0075433_10054540 | 3300006852 | Bacteria | 3487 |
| 207 | Ga0075433_10138956 | 3300006852 | Bacteria | 2159 |
| 208 | Ga0075433_10383538 | 3300006852 | Bacteria | 1241 |
| 209 | Ga0075433_10522671 | 3300006852 | Bacteria | 1044 |
| 210 | Ga0075433_10709229 | 3300006852 | Bacteria | 881 |
| 211 | Ga0075434_100002383 | 3300006871 | Bacteria | 16506 |
| 212 | Ga0075434_100037267 | 3300006871 | Bacteria | 4814 |
| 213 | Ga0075434_100068506 | 3300006871 | Bacteria | 3535 |
| 214 | Ga0075434_100209541 | 3300006871 | Bacteria | 1969 |
| 215 | Ga0075434_100475678 | 3300006871 | Bacteria | 1270 |
| 216 | Ga0075434_100992713 | 3300006871 | Bacteria | 854 |
| 217 | Ga0075434_101339703 | 3300006871 | Bacteria | 726 |
| 218 | Ga0075434_101432527 | 3300006871 | Bacteria | 701 |
| 219 | Ga0075429_100000438 | 3300006880 | Bacteria | 30989 |
| 220 | Ga0075429_100020642 | 3300006880 | Bacteria | 5718 |
| 221 | Ga0075429_100480429 | 3300006880 | Bacteria | 1089 |
| 222 | Ga0068865_100036155 | 3300006881 | Bacteria | 3327 |
| 223 | Ga0068865_100088799 | 3300006881 | Bacteria | 2237 |
| 224 | Ga0068865_100132904 | 3300006881 | Unclassified | 1866 |
| 225 | Ga0068865_100264030 | 3300006881 | Bacteria | 1364 |
| 226 | Ga0075436_100005505 | 3300006914 | Bacteria | 8709 |
| 227 | Ga0097620_100004248 | 3300006931 | Bacteria | 14627 |
| 228 | Ga0097620_100098658 | 3300006931 | Bacteria | 2975 |
| 229 | Ga0097620_100336204 | 3300006931 | Bacteria | 1604 |
| 230 | Ga0097620_100640176 | 3300006931 | Bacteria | 1155 |
| 231 | Ga0097620_100764480 | 3300006931 | Bacteria | 1055 |
| 232 | Ga0075435_100008699 | 3300007076 | Bacteria | 7302 |
| 233 | Ga0075435_100034312 | 3300007076 | Bacteria | 4020 |
| 234 | Ga0075435_100047941 | 3300007076 | Bacteria | 3430 |
| 235 | Ga0075435_100158037 | 3300007076 | Bacteria | 1908 |
| 236 | Ga0075435_100417383 | 3300007076 | Bacteria | 1155 |
| 237 | Ga0099794_10002165 | 3300007265 | Bacteria | 7153 |
| 238 | Ga0099794_10006118 | 3300007265 | Bacteria | 4863 |
| 239 | Ga0099794_10010440 | 3300007265 | Bacteria | 3943 |
| 240 | Ga0099794_10016223 | 3300007265 | Bacteria | 3300 |
| 241 | Ga0099794_10098468 | 3300007265 | Bacteria | 1458 |
| 242 | Ga0099794_10195594 | 3300007265 | Bacteria | 1035 |
| 243 | Ga0105240_10004543 | 3300009093 | Bacteria | 21070 |
| 244 | Ga0111539_10029130 | 3300009094 | Bacteria | 6730 |
| 245 | Ga0111539_10103699 | 3300009094 | Bacteria | 3338 |
| 246 | Ga0111539_10112374 | 3300009094 | Bacteria | 3196 |
| 247 | Ga0111539_11071655 | 3300009094 | Bacteria | 937 |
| 248 | Ga0105245_10000117 | 3300009098 | Bacteria | 76863 |
| 249 | Ga0105245_10251659 | 3300009098 | Unclassified | 1717 |
| 250 | Ga0105245_10254647 | 3300009098 | Bacteria | 1707 |
| 251 | Ga0114129_10015362 | 3300009147 | Bacteria | 10894 |
| 252 | Ga0114129_10015953 | 3300009147 | Bacteria | 10682 |
| 253 | Ga0114129_10060511 | 3300009147 | Bacteria | 5295 |
| 254 | Ga0114129_10063329 | 3300009147 | Bacteria | 5164 |
| 255 | Ga0114129_10076087 | 3300009147 | Bacteria | 4673 |
| 256 | Ga0114129_10171714 | 3300009147 | Bacteria | 2955 |
| 257 | Ga0114129_10175972 | 3300009147 | Bacteria | 2915 |
| 258 | Ga0114129_10279726 | 3300009147 | Bacteria | 2230 |
| 259 | Ga0105241_10148828 | 3300009174 | Bacteria | 1913 |
| 260 | Ga0105242_10008888 | 3300009176 | Bacteria | 7708 |
| 261 | Ga0105248_10000037 | 3300009177 | Bacteria | 180751 |
| 262 | Ga0105248_10020739 | 3300009177 | Bacteria | 7281 |
| 263 | Ga0105248_10029407 | 3300009177 | Bacteria | 6129 |
| 264 | Ga0105248_10068457 | 3300009177 | Bacteria | 3985 |
| 265 | Ga0105248_10092714 | 3300009177 | Bacteria | 3402 |
| 266 | Ga0105237_10021633 | 3300009545 | Bacteria | 6610 |
| 267 | Ga0105237_10407815 | 3300009545 | Bacteria | 1364 |
| 268 | Ga0105238_10007625 | 3300009551 | Bacteria | 10843 |
| 269 | Ga0105238_10213888 | 3300009551 | Bacteria | 1904 |
| 270 | Ga0105238_10918041 | 3300009551 | Bacteria | 894 |
| 271 | Ga0105249_10028766 | 3300009553 | Bacteria | 5016 |
| 272 | Ga0105249_10976181 | 3300009553 | Bacteria | 915 |
| 273 | Ga0105239_10632768 | 3300010375 | Bacteria | 1221 |
| 274 | Ga0105246_10012210 | 3300011119 | Bacteria | 5352 |
| 275 | Ga0105246_10153582 | 3300011119 | Bacteria | 1745 |
| 276 | Ga0157371_10004223 | 3300013102 | Bacteria | 12636 |
| 277 | Ga0157371_10036458 | 3300013102 | Bacteria | 3522 |
| 278 | Ga0157370_10001068 | 3300013104 | Bacteria | 34289 |
| 279 | Ga0157370_10038247 | 3300013104 | Bacteria | 4642 |
| 280 | Ga0157370_10154713 | 3300013104 | Bacteria | 2133 |
| 281 | Ga0157370_10340358 | 3300013104 | Bacteria | 1383 |
| 282 | Ga0157369_10000051 | 3300013105 | Bacteria | 165672 |
| 283 | Ga0157369_10006381 | 3300013105 | Bacteria | 13679 |
| 284 | Ga0157369_10008944 | 3300013105 | Bacteria | 11470 |
| 285 | Ga0157374_10116406 | 3300013296 | Bacteria | 2575 |
| 286 | Ga0157374_10127184 | 3300013296 | Unclassified | 2463 |
| 287 | Ga0157374_10890462 | 3300013296 | Bacteria | 907 |
| 288 | Ga0157378_10067430 | 3300013297 | Bacteria | 3207 |
| 289 | Ga0157378_10106520 | 3300013297 | Bacteria | 2565 |
| 290 | Ga0157378_10210232 | 3300013297 | Bacteria | 1845 |
| 291 | Ga0157378_10427688 | 3300013297 | Bacteria | 1310 |
| 292 | Ga0163162_10055856 | 3300013306 | Bacteria | 3976 |
| 293 | Ga0163162_10149599 | 3300013306 | Bacteria | 2452 |
| 294 | Ga0163162_10415390 | 3300013306 | Bacteria | 1478 |
| 295 | Ga0163162_10892817 | 3300013306 | Bacteria | 1002 |
| 296 | Ga0163162_10944790 | 3300013306 | Bacteria | 973 |
| 297 | Ga0157375_10192027 | 3300013308 | Bacteria | 2197 |
| 298 | Ga0157375_10267260 | 3300013308 | Bacteria | 1872 |
| 299 | Ga0163163_10002652 | 3300014325 | Bacteria | 15137 |
| 300 | Ga0163163_10032956 | 3300014325 | Bacteria | 5007 |
| 301 | Ga0163163_10119855 | 3300014325 | Bacteria | 2664 |
| 302 | Ga0157380_10018017 | 3300014326 | Bacteria | 5238 |
| 303 | Ga0157380_10025210 | 3300014326 | Bacteria | 4508 |
| 304 | Ga0157380_10590181 | 3300014326 | Bacteria | 1097 |
| 305 | Ga0157380_10715548 | 3300014326 | Bacteria | 1008 |
| 306 | Ga0182008_10000009 | 3300014497 | Bacteria | 331416 |
| 307 | Ga0157377_10043926 | 3300014745 | Bacteria | 2490 |
| 308 | Ga0157379_10001336 | 3300014968 | Bacteria | 20129 |
| 309 | Ga0157379_10260647 | 3300014968 | Bacteria | 1575 |
| 310 | Ga0157379_10558739 | 3300014968 | Bacteria | 1065 |
| 311 | Ga0157379_11084641 | 3300014968 | Bacteria | 766 |
| 312 | Ga0157376_10003314 | 3300014969 | Bacteria | 11084 |
| 313 | Ga0157376_10208027 | 3300014969 | Bacteria | 1805 |
| 314 | Ga0163161_10008265 | 3300017792 | Bacteria | 7200 |
| 315 | Ga0163161_10279279 | 3300017792 | Bacteria | 1309 |
| 316 | Ga0163161_10294203 | 3300017792 | Unclassified | 1277 |
| 317 | Ga0197907_11086676 | 3300020069 | Bacteria | 841 |
| 318 | Ga0206356_11734636 | 3300020070 | Bacteria | 818 |
| 319 | Ga0224712_10115045 | 3300022467 | Bacteria | 1158 |
| 320 | Ga0209565_1002480 | 3300025263 | Bacteria | 6601 |
| 321 | Ga0209675_1003829 | 3300025291 | Bacteria | 6938 |
| 322 | Ga0209256_1002745 | 3300025299 | Bacteria | 13607 |
| 323 | Ga0207697_10016406 | 3300025315 | Bacteria | 3051 |
| 324 | Ga0207697_10087319 | 3300025315 | Bacteria | 1319 |
| 325 | Ga0207682_10014935 | 3300025893 | Bacteria | 3024 |
| 326 | Ga0207682_10255583 | 3300025893 | Bacteria | 816 |
| 327 | Ga0207642_10236255 | 3300025899 | Bacteria | 1029 |
| 328 | Ga0207710_10008230 | 3300025900 | Bacteria | 4401 |
| 329 | Ga0207680_10184130 | 3300025903 | Bacteria | 1414 |
| 330 | Ga0207680_10305532 | 3300025903 | Unclassified | 1109 |
| 331 | Ga0207680_10520816 | 3300025903 | Bacteria | 848 |
| 332 | Ga0207685_10260158 | 3300025905 | Bacteria | 843 |
| 333 | Ga0207685_10312612 | 3300025905 | Bacteria | 781 |
| 334 | Ga0207699_10087986 | 3300025906 | Bacteria | 1943 |
| 335 | Ga0207699_10368439 | 3300025906 | Bacteria | 1017 |
| 336 | Ga0207645_10000693 | 3300025907 | Bacteria | 27991 |
| 337 | Ga0207645_10045197 | 3300025907 | Bacteria | 2815 |
| 338 | Ga0207645_10142144 | 3300025907 | Bacteria | 1564 |
| 339 | Ga0207643_10005744 | 3300025908 | Bacteria | 6633 |
| 340 | Ga0207643_10014893 | 3300025908 | Bacteria | 4230 |
| 341 | Ga0207643_10015522 | 3300025908 | Bacteria | 4147 |
| 342 | Ga0207643_10034750 | 3300025908 | Bacteria | 2825 |
| 343 | Ga0207643_10329513 | 3300025908 | Bacteria | 955 |
| 344 | Ga0207684_10005802 | 3300025910 | Bacteria | 11319 |
| 345 | Ga0207684_10016063 | 3300025910 | Bacteria | 6429 |
| 346 | Ga0207684_10016535 | 3300025910 | Bacteria | 6333 |
| 347 | Ga0207684_10027507 | 3300025910 | Bacteria | 4844 |
| 348 | Ga0207684_10073879 | 3300025910 | Bacteria | 2896 |
| 349 | Ga0207684_10113194 | 3300025910 | Bacteria | 2323 |
| 350 | Ga0207684_10160917 | 3300025910 | Bacteria | 1933 |
| 351 | Ga0207684_10200085 | 3300025910 | Bacteria | 1723 |
| 352 | Ga0207654_10044003 | 3300025911 | Bacteria | 2533 |
| 353 | Ga0207707_10000444 | 3300025912 | Bacteria | 42985 |
| 354 | Ga0207695_10003323 | 3300025913 | Bacteria | 22796 |
| 355 | Ga0207671_10328235 | 3300025914 | Bacteria | 1211 |
| 356 | Ga0207671_10547557 | 3300025914 | Bacteria | 922 |
| 357 | Ga0207693_10010601 | 3300025915 | Bacteria | 7479 |
| 358 | Ga0207693_10014404 | 3300025915 | Bacteria | 6359 |
| 359 | Ga0207693_10429199 | 3300025915 | Bacteria | 1033 |
| 360 | Ga0207663_10123058 | 3300025916 | Bacteria | 1780 |
| 361 | Ga0207660_10012178 | 3300025917 | Bacteria | 5621 |
| 362 | Ga0207660_10061905 | 3300025917 | Bacteria | 2695 |
| 363 | Ga0207662_10090633 | 3300025918 | Bacteria | 1880 |
| 364 | Ga0207657_10016994 | 3300025919 | Bacteria | 6998 |
| 365 | Ga0207652_10009506 | 3300025921 | Bacteria | 7818 |
| 366 | Ga0207646_10035728 | 3300025922 | Bacteria | 4487 |
| 367 | Ga0207646_10038200 | 3300025922 | Bacteria | 4326 |
| 368 | Ga0207646_10044568 | 3300025922 | Bacteria | 3981 |
| 369 | Ga0207646_10481291 | 3300025922 | Bacteria | 1119 |
| 370 | Ga0207681_10023410 | 3300025923 | Bacteria | 3950 |
| 371 | Ga0207681_10028678 | 3300025923 | Bacteria | 3608 |
| 372 | Ga0207681_10108116 | 3300025923 | Bacteria | 2018 |
| 373 | Ga0207681_10248427 | 3300025923 | Bacteria | 1388 |
| 374 | Ga0207694_10009800 | 3300025924 | Bacteria | 7232 |
| 375 | Ga0207650_10003440 | 3300025925 | Bacteria | 10880 |
| 376 | Ga0207650_10008000 | 3300025925 | Bacteria | 7205 |
| 377 | Ga0207650_10032114 | 3300025925 | Bacteria | 3797 |
| 378 | Ga0207650_10451302 | 3300025925 | Bacteria | 1070 |
| 379 | Ga0207659_10075488 | 3300025926 | Bacteria | 2474 |
| 380 | Ga0207659_10363272 | 3300025926 | Bacteria | 1204 |
| 381 | Ga0207687_10000070 | 3300025927 | Bacteria | 77432 |
| 382 | Ga0207687_10601370 | 3300025927 | Bacteria | 927 |
| 383 | Ga0207700_10465573 | 3300025928 | Bacteria | 1116 |
| 384 | Ga0207644_10133545 | 3300025931 | Bacteria | 1903 |
| 385 | Ga0207644_10207880 | 3300025931 | Bacteria | 1546 |
| 386 | Ga0207644_10456361 | 3300025931 | Bacteria | 1050 |
| 387 | Ga0207706_10022081 | 3300025933 | Bacteria | 5712 |
| 388 | Ga0207686_10134567 | 3300025934 | Bacteria | 1700 |
| 389 | Ga0207686_10630638 | 3300025934 | Bacteria | 846 |
| 390 | Ga0207670_10095529 | 3300025936 | Bacteria | 2111 |
| 391 | Ga0207670_10133878 | 3300025936 | Bacteria | 1820 |
| 392 | Ga0207670_10219107 | 3300025936 | Bacteria | 1456 |
| 393 | Ga0207670_10341654 | 3300025936 | Bacteria | 1183 |
| 394 | Ga0207669_10062883 | 3300025937 | Bacteria | 2288 |
| 395 | Ga0207704_10079633 | 3300025938 | Bacteria | 2112 |
| 396 | Ga0207704_10233029 | 3300025938 | Bacteria | 1370 |
| 397 | Ga0207665_10001767 | 3300025939 | Bacteria | 14524 |
| 398 | Ga0207691_10033344 | 3300025940 | Bacteria | 4794 |
| 399 | Ga0207691_10045925 | 3300025940 | Bacteria | 4015 |
| 400 | Ga0207691_10067959 | 3300025940 | Bacteria | 3221 |
| 401 | Ga0207691_10113381 | 3300025940 | Bacteria | 2409 |
| 402 | Ga0207691_10330840 | 3300025940 | Bacteria | 1305 |
| 403 | Ga0207691_10615799 | 3300025940 | Bacteria | 918 |
| 404 | Ga0207711_10000011 | 3300025941 | Bacteria | 518817 |
| 405 | Ga0207711_10039367 | 3300025941 | Bacteria | 4021 |
| 406 | Ga0207711_10053868 | 3300025941 | Bacteria | 3451 |
| 407 | Ga0207711_10209920 | 3300025941 | Bacteria | 1778 |
| 408 | Ga0207711_10328868 | 3300025941 | Bacteria | 1413 |
| 409 | Ga0207689_10001308 | 3300025942 | Bacteria | 24004 |
| 410 | Ga0207689_10034064 | 3300025942 | Bacteria | 4229 |
| 411 | Ga0207689_10089213 | 3300025942 | Bacteria | 2533 |
| 412 | Ga0207689_10184746 | 3300025942 | Bacteria | 1720 |
| 413 | Ga0207667_10004473 | 3300025949 | Bacteria | 17112 |
| 414 | Ga0207667_10726903 | 3300025949 | Bacteria | 994 |
| 415 | Ga0207651_10003683 | 3300025960 | Bacteria | 7574 |
| 416 | Ga0207651_10041582 | 3300025960 | Bacteria | 3052 |
| 417 | Ga0207651_10140188 | 3300025960 | Bacteria | 1866 |
| 418 | Ga0207712_10073277 | 3300025961 | Bacteria | 2469 |
| 419 | Ga0207712_10225928 | 3300025961 | Bacteria | 1500 |
| 420 | Ga0207712_10271732 | 3300025961 | Bacteria | 1379 |
| 421 | Ga0207668_10062041 | 3300025972 | Bacteria | 2631 |
| 422 | Ga0207668_10215387 | 3300025972 | Unclassified | 1538 |
| 423 | Ga0207658_10068022 | 3300025986 | Bacteria | 2686 |
| 424 | Ga0207658_10084191 | 3300025986 | Bacteria | 2446 |
| 425 | Ga0207658_10286669 | 3300025986 | Bacteria | 1414 |
| 426 | Ga0207658_10459261 | 3300025986 | Bacteria | 1129 |
| 427 | Ga0207677_10298583 | 3300026023 | Unclassified | 1330 |
| 428 | Ga0207703_10000470 | 3300026035 | Bacteria | 42191 |
| 429 | Ga0207703_10832661 | 3300026035 | Bacteria | 882 |
| 430 | Ga0207708_10039049 | 3300026075 | Bacteria | 3616 |
| 431 | Ga0207708_10266152 | 3300026075 | Bacteria | 1385 |
| 432 | Ga0207708_10466459 | 3300026075 | Unclassified | 1054 |
| 433 | Ga0207702_10058778 | 3300026078 | Bacteria | 3273 |
| 434 | Ga0207641_10001041 | 3300026088 | Bacteria | 28118 |
| 435 | Ga0207641_10006512 | 3300026088 | Bacteria | 9831 |
| 436 | Ga0207641_10008144 | 3300026088 | Bacteria | 8678 |
| 437 | Ga0207641_10024153 | 3300026088 | Bacteria | 5010 |
| 438 | Ga0207641_10467967 | 3300026088 | Bacteria | 1220 |
| 439 | Ga0207641_10554674 | 3300026088 | Bacteria | 1121 |
| 440 | Ga0207641_10725536 | 3300026088 | Bacteria | 980 |
| 441 | Ga0207648_10001098 | 3300026089 | Bacteria | 30333 |
| 442 | Ga0207648_10004247 | 3300026089 | Bacteria | 14803 |
| 443 | Ga0207648_10196293 | 3300026089 | Bacteria | 1790 |
| 444 | Ga0207648_10778166 | 3300026089 | Bacteria | 890 |
| 445 | Ga0207676_10000609 | 3300026095 | Bacteria | 29375 |
| 446 | Ga0207676_10020005 | 3300026095 | Bacteria | 4891 |
| 447 | Ga0207676_10023135 | 3300026095 | Bacteria | 4579 |
| 448 | Ga0207676_10097755 | 3300026095 | Bacteria | 2426 |
| 449 | Ga0207676_10182757 | 3300026095 | Bacteria | 1838 |
| 450 | Ga0207676_10281865 | 3300026095 | Bacteria | 1509 |
| 451 | Ga0207674_10016097 | 3300026116 | Bacteria | 8192 |
| 452 | Ga0207674_10054049 | 3300026116 | Bacteria | 4090 |
| 453 | Ga0207674_11233114 | 3300026116 | Bacteria | 717 |
| 454 | Ga0207675_100004806 | 3300026118 | Bacteria | 13012 |
| 455 | Ga0207675_100118736 | 3300026118 | Unclassified | 2501 |
| 456 | Ga0207675_100188790 | 3300026118 | Bacteria | 1976 |
| 457 | Ga0207675_100262994 | 3300026118 | Bacteria | 1673 |
| 458 | Ga0207675_100551473 | 3300026118 | Bacteria | 1152 |
| 459 | Ga0207675_100662384 | 3300026118 | Bacteria | 1051 |
| 460 | Ga0207683_10000597 | 3300026121 | Bacteria | 33268 |
| 461 | Ga0207683_10024812 | 3300026121 | Bacteria | 5165 |
| 462 | Ga0207683_10531298 | 3300026121 | Bacteria | 1087 |
| 463 | Ga0207698_10000015 | 3300026142 | Bacteria | 207368 |
| 464 | Ga0209969_1003758 | 3300027360 | Bacteria | 2104 |
| 465 | Ga0209981_1026487 | 3300027378 | Bacteria | 842 |
| 466 | Ga0209996_1004862 | 3300027395 | Bacteria | 1716 |
| 467 | Ga0210000_1007296 | 3300027462 | Bacteria | 1617 |
| 468 | Ga0209968_1026750 | 3300027526 | Bacteria | 954 |
| 469 | Ga0209982_1006376 | 3300027552 | Bacteria | 1715 |
| 470 | Ga0209588_1086658 | 3300027671 | Bacteria | 1010 |
| 471 | Ga0209966_1003774 | 3300027695 | Bacteria | 2557 |
| 472 | Ga0209813_10118384 | 3300027866 | Bacteria | 919 |
| 473 | Ga0209974_10009220 | 3300027876 | Bacteria | 3349 |
| 474 | Ga0207428_10110103 | 3300027907 | Bacteria | 2121 |
| 475 | Ga0207428_10207971 | 3300027907 | Bacteria | 1471 |
| 476 | Ga0268266_10058741 | 3300028379 | Bacteria | 3312 |
| 477 | Ga0268266_10060714 | 3300028379 | Bacteria | 3259 |
| 478 | Ga0268266_10094242 | 3300028379 | Bacteria | 2628 |
| 479 | Ga0268266_10423475 | 3300028379 | Bacteria | 1262 |
| 480 | Ga0268266_10654619 | 3300028379 | Bacteria | 1011 |
| 481 | Ga0268265_10045824 | 3300028380 | Bacteria | 3266 |
| 482 | Ga0268265_10079704 | 3300028380 | Bacteria | 2580 |
| 483 | Ga0268265_11245790 | 3300028380 | Bacteria | 743 |
| 484 | Ga0268264_10001168 | 3300028381 | Bacteria | 25525 |
| 485 | Ga0268264_10021674 | 3300028381 | Bacteria | 5246 |
| 486 | Ga0268264_10046403 | 3300028381 | Bacteria | 3608 |
| 487 | Ga0268264_10358856 | 3300028381 | Unclassified | 1389 |
| 488 | Ga0265332_10001631 | 3300031238 | Bacteria | 12270 |
| 489 | Ga0265328_10140402 | 3300031239 | Bacteria | 906 |
| 490 | Ga0265320_10205784 | 3300031240 | Bacteria | 878 |
| 491 | Ga0265325_10019135 | 3300031241 | Bacteria | 3790 |
| 492 | Ga0265329_10002664 | 3300031242 | Bacteria | 8040 |
| 493 | Ga0265340_10190041 | 3300031247 | Bacteria | 926 |
| 494 | Ga0265339_10038117 | 3300031249 | Bacteria | 2683 |
| 495 | Ga0265339_10054872 | 3300031249 | Bacteria | 2163 |
| 496 | Ga0265331_10000972 | 3300031250 | Bacteria | 22763 |
| 497 | Ga0265327_10001720 | 3300031251 | Bacteria | 25945 |
| 498 | Ga0265313_10000367 | 3300031595 | Bacteria | 48929 |
| 499 | Ga0265314_10002346 | 3300031711 | Bacteria | 19541 |
| 500 | Ga0307406_10546335 | 3300031901 | Bacteria | 947 |
| 501 | Ga0307412_10000084 | 3300031911 | Bacteria | 90908 |
| 502 | Ga0307409_100942419 | 3300031995 | Bacteria | 879 |
| 503 | Ga0307414_10007545 | 3300032004 | Bacteria | 6114 |
| 504 | Ga0307414_10013020 | 3300032004 | Bacteria | 4941 |
| 505 | Ga0307414_10371062 | 3300032004 | Bacteria | 1234 |
| 506 | Ga0307414_10878888 | 3300032004 | Bacteria | 821 |
| 507 | Ga0307411_10142885 | 3300032005 | Bacteria | 1767 |
| 508 | Ga0373941_0010854 | 3300035115 | Bacteria | 2340 |
| 509 | Ga0373957_0134314 | 3300035120 | Bacteria | 1009 |
| 510 | Ga0373942_0034947 | 3300035207 | Bacteria | 1347 |
| 511 | Ga0373931_0050743 | 3300035691 | Bacteria | 2208 |
| 512 | Ga0373937_0185814 | 3300036401 | Bacteria | 1952 |
| 513 | Ga0373937_0190282 | 3300036401 | Bacteria | 1928 |
| 514 | Ga0395900_0001825 | 3300037418 | Bacteria | 24311 |
| 515 | Ga0395905_0985416 | 3300037471 | Bacteria | 746 |
| 516 | Ga0436363_0274523 | 3300039450 | Bacteria | 915 |
| 517 | Ga0436362_0660881 | 3300039453 | Bacteria | 2735 |
| 518 | Ga0439433_0011951 | 3300041999 | Bacteria | 1902 |
| 519 | Ga0439445_0049919 | 3300042004 | Bacteria | 1127 |
| 520 | Ga0439450_010825 | 3300042008 | Bacteria | 1770 |
| 521 | Ga0466969_0068440 | 3300044656 | Bacteria | 1710 |
| 522 | Ga0466966_0081788 | 3300044684 | Bacteria | 2010 |
| 523 | Ga0466961_0085858 | 3300044693 | Bacteria | 1989 |
| 524 | Ga0466964_0044895 | 3300044706 | Bacteria | 1797 |
| 525 | Ga0466971_0038182 | 3300044719 | Bacteria | 2154 |
| 526 | Ga0466968_0099621 | 3300044735 | Bacteria | 1296 |
| 527 | Ga0466957_0031538 | 3300044842 | Bacteria | 3168 |
| 528 | Ga0466959_0045596 | 3300045049 | Bacteria | 3228 |
| 529 | Ga0451576_0039530 | 3300045051 | Bacteria | 4992 |
| 530 | Ga0495592_0000007 | 3300046454 | Bacteria | 180892 |
| 531 | Ga0495603_0102801 | 3300046455 | Bacteria | 1668 |
| 532 | Ga0495651_0316105 | 3300046462 | Bacteria | 1042 |
| 533 | Ga0495662_0007164 | 3300046476 | Bacteria | 5524 |
| 534 | Ga0495584_0356729 | 3300046491 | Bacteria | 743 |
| 535 | Ga0495594_0302623 | 3300046499 | Bacteria | 911 |
| 536 | Ga0495583_0082127 | 3300046506 | Bacteria | 1399 |
| 537 | Ga0495618_0053006 | 3300046514 | Bacteria | 2565 |
| 538 | Ga0495628_0032027 | 3300046516 | Bacteria | 4249 |
| 539 | Ga0495630_0002686 | 3300046517 | Bacteria | 12345 |
| 540 | Ga0495630_0154664 | 3300046517 | Bacteria | 1746 |
| 541 | Ga0495666_0038496 | 3300046526 | Bacteria | 2325 |
| 542 | Ga0495652_0184762 | 3300046529 | Bacteria | 1596 |
| 543 | Ga0495640_0105875 | 3300046533 | Bacteria | 1842 |
| 544 | Ga0495586_0001436 | 3300046535 | Bacteria | 13162 |
| 545 | Ga0495656_0018601 | 3300046615 | Bacteria | 2671 |
| 546 | Ga0495599_0001504 | 3300046678 | Bacteria | 13418 |
| 547 | Ga0495623_0230849 | 3300046679 | Bacteria | 1050 |
| 548 | Ga0495669_0038812 | 3300046684 | Bacteria | 2109 |
| 549 | Ga0495624_0084818 | 3300046690 | Bacteria | 1957 |
| 550 | Ga0495670_0255915 | 3300046691 | Bacteria | 934 |
| 551 | Ga0495604_0132875 | 3300047317 | Bacteria | 1787 |
| 552 | Ga0495636_0009050 | 3300047318 | Bacteria | 3915 |
| 553 | Ga0496103_0258096 | 3300048906 | Bacteria | 1121 |
| 554 | Ga0496103_0329590 | 3300048906 | Bacteria | 982 |
| 555 | Ga0496104_0013290 | 3300048907 | Bacteria | 7422 |
| 556 | Ga0496104_0634176 | 3300048907 | Bacteria | 978 |
| 557 | Ga0496105_0010192 | 3300048908 | Bacteria | 7386 |
| 558 | Ga0496105_0552482 | 3300048908 | Bacteria | 898 |
| 559 | Ga0496107_0281914 | 3300048910 | Bacteria | 1237 |
| 560 | Ga0496108_0000005 | 3300048911 | Bacteria | 535059 |
| 561 | Ga0496108_0169425 | 3300048911 | Bacteria | 1889 |
| 562 | Ga0496108_0396466 | 3300048911 | Bacteria | 1205 |
| 563 | Ga0496109_0000002 | 3300048912 | Bacteria | 443393 |
| 564 | Ga0496109_0014019 | 3300048912 | Bacteria | 6968 |
| 565 | Ga0496110_0623424 | 3300048913 | Bacteria | 977 |
| 566 | Ga0496110_0674231 | 3300048913 | Bacteria | 934 |
| 567 | Ga0496111_0097265 | 3300048914 | Bacteria | 2161 |
| 568 | Ga0496112_0208667 | 3300048915 | Bacteria | 1911 |
| 569 | Ga0496112_0683917 | 3300048915 | Bacteria | 954 |
| 570 | Ga0496114_0261223 | 3300048917 | Bacteria | 1525 |
| 571 | Ga0501031_0002036 | 3300049568 | Bacteria | 12729 |
| 572 | Ga0501032_0012383 | 3300049569 | Bacteria | 6097 |
| 573 | Ga0501033_0004584 | 3300049570 | Bacteria | 11071 |
| 574 | Ga0501033_0250732 | 3300049570 | Bacteria | 1255 |
| 575 | Ga0501034_0005792 | 3300049571 | Bacteria | 13441 |
| 576 | Ga0501034_0041105 | 3300049571 | Bacteria | 4678 |
| 577 | Ga0501036_0005255 | 3300049572 | Bacteria | 10475 |
| 578 | Ga0501036_0007868 | 3300049572 | Bacteria | 8718 |
| 579 | Ga0501036_0172621 | 3300049572 | Bacteria | 1821 |
| 580 | Ga0501037_0023566 | 3300049573 | Bacteria | 4551 |
| 581 | Ga0501037_0148346 | 3300049573 | Bacteria | 1677 |
| 582 | Ga0501038_0003383 | 3300049574 | Bacteria | 14871 |
| 583 | Ga0501039_0059077 | 3300049575 | Bacteria | 2970 |
| 584 | Ga0501040_0058576 | 3300049576 | Bacteria | 2645 |
| 585 | Ga0501041_0007372 | 3300049577 | Bacteria | 6458 |
| 586 | Ga0501042_0036907 | 3300049578 | Bacteria | 3467 |
| 587 | Ga0501042_0401170 | 3300049578 | Bacteria | 993 |
| 588 | Ga0501043_0083284 | 3300049579 | Bacteria | 2515 |
| 589 | Ga0501043_0171499 | 3300049579 | Bacteria | 1692 |
| 590 | Ga0501047_0004800 | 3300049581 | Bacteria | 12722 |
| 591 | Ga0501048_0159320 | 3300049582 | Bacteria | 1597 |
| 592 | Ga0501067_0073097 | 3300049583 | Bacteria | 1900 |
| 593 | Ga0501068_0021587 | 3300049584 | Bacteria | 3760 |
| 594 | Ga0501068_0246236 | 3300049584 | Bacteria | 1138 |
| 595 | Ga0501070_0004048 | 3300049586 | Bacteria | 12595 |
| 596 | Ga0501071_0006328 | 3300049587 | Bacteria | 7680 |
| 597 | Ga0501072_0073852 | 3300049588 | Bacteria | 2696 |
| 598 | Ga0501072_0076507 | 3300049588 | Bacteria | 2648 |
| 599 | Ga0501074_0619555 | 3300049590 | Bacteria | 765 |
| 600 | Ga0501075_0566242 | 3300049591 | Bacteria | 867 |
| 601 | Ga0501076_0031457 | 3300049592 | Bacteria | 4139 |
| 602 | Ga0501076_0042445 | 3300049592 | Bacteria | 3580 |
| 603 | Ga0501076_0204919 | 3300049592 | Bacteria | 1611 |
| 604 | Ga0501077_0017812 | 3300049593 | Bacteria | 4488 |
| 605 | Ga0501079_0006518 | 3300049741 | Bacteria | 8770 |
| 606 | Ga0501079_0758004 | 3300049741 | Bacteria | 764 |
| 607 | Ga0501081_0125829 | 3300049743 | Bacteria | 1828 |
| 608 | Ga0501081_0246573 | 3300049743 | Bacteria | 1303 |
| 609 | Ga0501083_0323197 | 3300049744 | Bacteria | 1003 |
| 610 | Ga0501083_0402568 | 3300049744 | Bacteria | 890 |
| 611 | Ga0501241_005494 | 3300049758 | Bacteria | 2361 |
| 612 | Ga0501035_0007782 | 3300049822 | Bacteria | 10012 |
| 613 | Ga0501045_0053512 | 3300049824 | Bacteria | 2950 |
| 614 | nmdc:mga00v17_249462_c1 | 3300050491 | Bacteria | 1151 |
| 615 | nmdc:mga0k408_280071_c1 | 3300050493 | Bacteria | 995 |
| 616 | nmdc:mga06z11_12011_c1 | 3300050494 | Bacteria | 3754 |
| 617 | nmdc:mga06z11_34465_c1 | 3300050494 | Bacteria | 1150 |
| 618 | nmdc:mga04h51_112268_c1 | 3300050495 | Bacteria | 1006 |
| 619 | nmdc:mga05p37_101521_c1 | 3300050507 | Bacteria | 3542 |
| 620 | nmdc:mga05p37_115691_c1 | 3300050507 | Bacteria | 3296 |
| 621 | nmdc:mga05p37_1566_c1 | 3300050507 | Bacteria | 26569 |
| 622 | nmdc:mga05p37_189483_c2 | 3300050507 | Bacteria | 1909 |
| 623 | nmdc:mga05p37_216758_c1 | 3300050507 | Bacteria | 2311 |
| 624 | nmdc:mga05p37_314381_c1 | 3300050507 | Bacteria | 1856 |
| 625 | nmdc:mga05p37_352777_c1 | 3300050507 | Bacteria | 1732 |
| 626 | nmdc:mga05p37_512767_c1 | 3300050507 | Bacteria | 1373 |
| 627 | nmdc:mga05p37_555612_c1 | 3300050507 | Bacteria | 1306 |
| 628 | nmdc:mga05p37_566662_c1 | 3300050507 | Bacteria | 1289 |
| 629 | nmdc:mga05p37_87419_c1 | 3300050507 | Bacteria | 3841 |
| 630 | nmdc:mga09592_297430_c1 | 3300050508 | Bacteria | 1399 |
| 631 | nmdc:mga09592_465_c1 | 3300050508 | Bacteria | 30281 |
| 632 | nmdc:mga0qj67_212152_c1 | 3300050509 | Bacteria | 1572 |
| 633 | nmdc:mga0qj67_311310_c1 | 3300050509 | Bacteria | 1275 |
| 634 | nmdc:mga0qj67_31516_c1 | 3300050509 | Bacteria | 4130 |
| 635 | nmdc:mga0qj67_448806_c1 | 3300050509 | Bacteria | 1039 |
| 636 | nmdc:mga06r32_140111_c1 | 3300050510 | Bacteria | 2394 |
| 637 | nmdc:mga06r32_209097_c1 | 3300050510 | Bacteria | 1939 |
| 638 | nmdc:mga06r32_231220_c1 | 3300050510 | Bacteria | 1837 |
| 639 | nmdc:mga06r32_232604_c1 | 3300050510 | Bacteria | 1831 |
| 640 | nmdc:mga06r32_437652_c1 | 3300050510 | Bacteria | 1288 |
| 641 | nmdc:mga08y16_104222_c1 | 3300050511 | Bacteria | 2953 |
| 642 | nmdc:mga08y16_130619_c1 | 3300050511 | Bacteria | 2612 |
| 643 | nmdc:mga08y16_220229_c1 | 3300050511 | Bacteria | 1965 |
| 644 | nmdc:mga08y16_316607_c1 | 3300050511 | Bacteria | 1607 |
| 645 | nmdc:mga0n895_108063_c1 | 3300050512 | Bacteria | 2796 |
| 646 | nmdc:mga0n895_1172732_c1 | 3300050512 | Bacteria | 743 |
| 647 | nmdc:mga0n895_174164_c1 | 3300050512 | Bacteria | 2183 |
| 648 | nmdc:mga0n895_32780_c1 | 3300050512 | Bacteria | 4988 |
| 649 | nmdc:mga0n895_34597_c1 | 3300050512 | Bacteria | 4865 |
| 650 | nmdc:mga0n895_47148_c1 | 3300050512 | Bacteria | 4213 |
| 651 | nmdc:mga0n895_47472_c1 | 3300050512 | Bacteria | 4198 |
| 652 | nmdc:mga0n895_497453_c1 | 3300050512 | Bacteria | 1228 |
| 653 | nmdc:mga0n895_74139_c1 | 3300050512 | Bacteria | 3380 |
| 654 | nmdc:mga0n895_802989_c1 | 3300050512 | Bacteria | 931 |
| 655 | nmdc:mga0n895_88855_c1 | 3300050512 | Bacteria | 3090 |
| 656 | nmdc:mga0rr50_27949_c1 | 3300050513 | Bacteria | 3958 |
| 657 | nmdc:mga0rr50_351017_c1 | 3300050513 | Bacteria | 1241 |
| 658 | nmdc:mga0rr50_6374_c1 | 3300050513 | Bacteria | 7174 |
| 659 | nmdc:mga08x19_15022_c1 | 3300050514 | Bacteria | 4702 |
| 660 | nmdc:mga08x19_280436_c1 | 3300050514 | Bacteria | 1155 |
| 661 | nmdc:mga0a205_12985_c1 | 3300050515 | Bacteria | 7732 |
| 662 | nmdc:mga0a205_29970_c1 | 3300050515 | Bacteria | 5208 |
| 663 | nmdc:mga0a205_352697_c1 | 3300050515 | Bacteria | 1338 |
| 664 | nmdc:mga0a205_3800_c1 | 3300050515 | Bacteria | 12405 |
| 665 | nmdc:mga0a205_607146_c1 | 3300050515 | Bacteria | 947 |
| 666 | Ga0500651_0007451 | 3300053093 | Bacteria | 6392 |
| 667 | Ga0500611_056231 | 3300053727 | Bacteria | 918 |
| 668 | Ga0500645_026192 | 3300053730 | Bacteria | 1774 |
| 669 | Ga0501084_0057087 | 3300054114 | Bacteria | 3267 |
| 670 | Ga0590071_017845 | 3300059421 | Bacteria | 1668 |
| 671 | Ga0590077_005668 | 3300059426 | Bacteria | 2553 |
| 672 | Ga0501082_0727405 | 3300060353 | Bacteria | 869 |
| 673 | Ga0466962_0017548 | 3300061719 | Bacteria | 3445 |
| 674 | Ga0530510_0007826 | 3300061734 | Bacteria | 7452 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300026088 | Ga0207641_10001041 | Ga0207641_1000104123 | 176 |
| 2 | 3300049741 | Ga0501079_0758004 | Ga0501079_0758004_187_750 | 178 |
| 3 | 3300047317 | Ga0495604_0132875 | Ga0495604_0132875_18_599 | 184 |
| 4 | iso_pu_bacteria | 2501025502 | 2501084461 | 206 |
| 5 | iso_pu_bacteria | 2510917013 | 2511088463 | 206 |
| 6 | 3300005467 | Ga0070706_100119084 | Ga0070706_1001190842 | 207 |
| 7 | 3300005536 | Ga0070697_100413280 | Ga0070697_1004132801 | 207 |
| 8 | 3300006028 | Ga0070717_10337512 | Ga0070717_103375121 | 207 |
| 9 | iso_pu_bacteria | 2738541284 | 2738762799 | 207 |
| 10 | iso_pu_bacteria | 2738543023 | 2739300479 | 207 |
| 11 | iso_pu_bacteria | 2775506987 | 2776614362 | 207 |
| 12 | iso_pu_bacteria | 2852627209 | 2852630259 | 207 |
| 13 | iso_pu_bacteria | 2919186247 | 2919190026 | 207 |
| 14 | iso_pu_bacteria | 2939664404 | 2939668307 | 207 |
| 15 | 3300005842 | Ga0068858_100836970 | Ga0068858_1008369701 | 208 |
| 16 | 3300005937 | Ga0081455_10114844 | Ga0081455_101148442 | 208 |
| 17 | 3300006844 | Ga0075428_100138309 | Ga0075428_1001383091 | 208 |
| 18 | 3300006847 | Ga0075431_100036382 | Ga0075431_1000363824 | 208 |
| 19 | 3300028380 | Ga0268265_11245790 | Ga0268265_112457901 | 208 |
| 20 | 3300005355 | Ga0070671_100845459 | Ga0070671_1008454591 | 209 |
| 21 | 3300005471 | Ga0070698_100161258 | Ga0070698_1001612582 | 209 |
| 22 | 3300006358 | Ga0068871_100311150 | Ga0068871_1003111502 | 209 |
| 23 | 3300006881 | Ga0068865_100264030 | Ga0068865_1002640302 | 209 |
| 24 | 3300013308 | Ga0157375_10267260 | Ga0157375_102672602 | 209 |
| 25 | 3300025916 | Ga0207663_10123058 | Ga0207663_101230583 | 209 |
| 26 | 3300025927 | Ga0207687_10601370 | Ga0207687_106013701 | 209 |
| 27 | 3300025938 | Ga0207704_10233029 | Ga0207704_102330292 | 209 |
| 28 | 3300026088 | Ga0207641_10554674 | Ga0207641_105546741 | 209 |
| 29 | 3300048908 | Ga0496105_0552482 | Ga0496105_0552482_121_750 | 209 |
| 30 | 3300048910 | Ga0496107_0281914 | Ga0496107_0281914_334_963 | 209 |
| 31 | 3300048913 | Ga0496110_0623424 | Ga0496110_0623424_144_773 | 209 |
| 32 | 3300049588 | Ga0501072_0073852 | Ga0501072_0073852_970_1626 | 209 |
| 33 | 3300050507 | nmdc:mga05p37_512767_c1 | nmdc:mga05p37_512767_c1_546_1193 | 209 |
| 34 | 3300050507 | nmdc:mga05p37_566662_c1 | nmdc:mga05p37_566662_c1_461_1090 | 209 |
| 35 | 3300050510 | nmdc:mga06r32_437652_c1 | nmdc:mga06r32_437652_c1_58_705 | 209 |
| 36 | 3300050511 | nmdc:mga08y16_130619_c1 | nmdc:mga08y16_130619_c1_26_673 | 209 |
| 37 | 3300050512 | nmdc:mga0n895_74139_c1 | nmdc:mga0n895_74139_c1_1805_2467 | 209 |
| 38 | 3300060353 | Ga0501082_0727405 | Ga0501082_0727405_189_845 | 209 |
| 39 | 3300003773 | Ga0055537_1016852 | Ga0055537_10168522 | 210 |
| 40 | 3300005289 | Ga0065704_10408407 | Ga0065704_104084071 | 210 |
| 41 | 3300005328 | Ga0070676_10019655 | Ga0070676_100196552 | 210 |
| 42 | 3300005328 | Ga0070676_10107161 | Ga0070676_101071612 | 210 |
| 43 | 3300005330 | Ga0070690_100164642 | Ga0070690_1001646422 | 210 |
| 44 | 3300005330 | Ga0070690_100273480 | Ga0070690_1002734801 | 210 |
| 45 | 3300005331 | Ga0070670_100001819 | Ga0070670_1000018194 | 210 |
| 46 | 3300005333 | Ga0070677_10276002 | Ga0070677_102760021 | 210 |
| 47 | 3300005334 | Ga0068869_100221957 | Ga0068869_1002219571 | 210 |
| 48 | 3300005335 | Ga0070666_10023538 | Ga0070666_100235382 | 210 |
| 49 | 3300005335 | Ga0070666_10123910 | Ga0070666_101239102 | 210 |
| 50 | 3300005336 | Ga0070680_100000283 | Ga0070680_10000028311 | 210 |
| 51 | 3300005340 | Ga0070689_100050953 | Ga0070689_1000509532 | 210 |
| 52 | 3300005341 | Ga0070691_10144032 | Ga0070691_101440322 | 210 |
| 53 | 3300005343 | Ga0070687_100017499 | Ga0070687_1000174992 | 210 |
| 54 | 3300005343 | Ga0070687_100051057 | Ga0070687_1000510572 | 210 |
| 55 | 3300005347 | Ga0070668_100002408 | Ga0070668_10000240812 | 210 |
| 56 | 3300005347 | Ga0070668_100028668 | Ga0070668_1000286682 | 210 |
| 57 | 3300005353 | Ga0070669_100022773 | Ga0070669_1000227731 | 210 |
| 58 | 3300005353 | Ga0070669_100089021 | Ga0070669_1000890212 | 210 |
| 59 | 3300005353 | Ga0070669_100115773 | Ga0070669_1001157732 | 210 |
| 60 | 3300005353 | Ga0070669_100205485 | Ga0070669_1002054852 | 210 |
| 61 | 3300005353 | Ga0070669_100288406 | Ga0070669_1002884062 | 210 |
| 62 | 3300005354 | Ga0070675_100010686 | Ga0070675_1000106861 | 210 |
| 63 | 3300005354 | Ga0070675_100216508 | Ga0070675_1002165082 | 210 |
| 64 | 3300005354 | Ga0070675_100235633 | Ga0070675_1002356331 | 210 |
| 65 | 3300005354 | Ga0070675_100317945 | Ga0070675_1003179452 | 210 |
| 66 | 3300005355 | Ga0070671_100106789 | Ga0070671_1001067892 | 210 |
| 67 | 3300005355 | Ga0070671_100132914 | Ga0070671_1001329142 | 210 |
| 68 | 3300005356 | Ga0070674_100083171 | Ga0070674_1000831712 | 210 |
| 69 | 3300005364 | Ga0070673_100029652 | Ga0070673_1000296523 | 210 |
| 70 | 3300005364 | Ga0070673_100045367 | Ga0070673_1000453672 | 210 |
| 71 | 3300005364 | Ga0070673_100101569 | Ga0070673_1001015692 | 210 |
| 72 | 3300005364 | Ga0070673_100182617 | Ga0070673_1001826171 | 210 |
| 73 | 3300005364 | Ga0070673_100286821 | Ga0070673_1002868212 | 210 |
| 74 | 3300005364 | Ga0070673_100569468 | Ga0070673_1005694682 | 210 |
| 75 | 3300005365 | Ga0070688_100208176 | Ga0070688_1002081762 | 210 |
| 76 | 3300005367 | Ga0070667_100001213 | Ga0070667_1000012135 | 210 |
| 77 | 3300005367 | Ga0070667_100244627 | Ga0070667_1002446272 | 210 |
| 78 | 3300005406 | Ga0070703_10042781 | Ga0070703_100427811 | 210 |
| 79 | 3300005434 | Ga0070709_10161693 | Ga0070709_101616932 | 210 |
| 80 | 3300005434 | Ga0070709_10175533 | Ga0070709_101755332 | 210 |
| 81 | 3300005436 | Ga0070713_100189035 | Ga0070713_1001890352 | 210 |
| 82 | 3300005440 | Ga0070705_100074896 | Ga0070705_1000748962 | 210 |
| 83 | 3300005440 | Ga0070705_100307002 | Ga0070705_1003070021 | 210 |
| 84 | 3300005441 | Ga0070700_100067109 | Ga0070700_1000671092 | 210 |
| 85 | 3300005444 | Ga0070694_100279790 | Ga0070694_1002797901 | 210 |
| 86 | 3300005445 | Ga0070708_100014071 | Ga0070708_1000140713 | 210 |
| 87 | 3300005445 | Ga0070708_100020712 | Ga0070708_10002071210 | 210 |
| 88 | 3300005445 | Ga0070708_100024505 | Ga0070708_1000245052 | 210 |
| 89 | 3300005445 | Ga0070708_100037390 | Ga0070708_1000373903 | 210 |
| 90 | 3300005445 | Ga0070708_100217129 | Ga0070708_1002171292 | 210 |
| 91 | 3300005445 | Ga0070708_100764229 | Ga0070708_1007642291 | 210 |
| 92 | 3300005456 | Ga0070678_101002772 | Ga0070678_1010027721 | 210 |
| 93 | 3300005457 | Ga0070662_100020338 | Ga0070662_1000203382 | 210 |
| 94 | 3300005458 | Ga0070681_10064166 | Ga0070681_100641662 | 210 |
| 95 | 3300005459 | Ga0068867_100002403 | Ga0068867_1000024032 | 210 |
| 96 | 3300005459 | Ga0068867_100081084 | Ga0068867_1000810842 | 210 |
| 97 | 3300005459 | Ga0068867_100132955 | Ga0068867_1001329551 | 210 |
| 98 | 3300005467 | Ga0070706_100001637 | Ga0070706_10000163720 | 210 |
| 99 | 3300005467 | Ga0070706_100018923 | Ga0070706_1000189238 | 210 |
| 100 | 3300005467 | Ga0070706_100032060 | Ga0070706_1000320603 | 210 |
| 101 | 3300005467 | Ga0070706_100057312 | Ga0070706_1000573122 | 210 |
| 102 | 3300005467 | Ga0070706_100074118 | Ga0070706_1000741184 | 210 |
| 103 | 3300005467 | Ga0070706_100125586 | Ga0070706_1001255862 | 210 |
| 104 | 3300005467 | Ga0070706_100340799 | Ga0070706_1003407993 | 210 |
| 105 | 3300005468 | Ga0070707_100027344 | Ga0070707_1000273442 | 210 |
| 106 | 3300005468 | Ga0070707_100048385 | Ga0070707_1000483852 | 210 |
| 107 | 3300005471 | Ga0070698_100030522 | Ga0070698_1000305223 | 210 |
| 108 | 3300005471 | Ga0070698_100049404 | Ga0070698_1000494043 | 210 |
| 109 | 3300005471 | Ga0070698_100157695 | Ga0070698_1001576952 | 210 |
| 110 | 3300005471 | Ga0070698_100159123 | Ga0070698_1001591231 | 210 |
| 111 | 3300005471 | Ga0070698_100653532 | Ga0070698_1006535322 | 210 |
| 112 | 3300005518 | Ga0070699_100004353 | Ga0070699_1000043532 | 210 |
| 113 | 3300005518 | Ga0070699_100018538 | Ga0070699_1000185384 | 210 |
| 114 | 3300005518 | Ga0070699_100109027 | Ga0070699_1001090272 | 210 |
| 115 | 3300005530 | Ga0070679_100031849 | Ga0070679_1000318492 | 210 |
| 116 | 3300005536 | Ga0070697_100013647 | Ga0070697_1000136472 | 210 |
| 117 | 3300005536 | Ga0070697_100242098 | Ga0070697_1002420982 | 210 |
| 118 | 3300005536 | Ga0070697_100250470 | Ga0070697_1002504702 | 210 |
| 119 | 3300005539 | Ga0068853_100712376 | Ga0068853_1007123761 | 210 |
| 120 | 3300005543 | Ga0070672_100000358 | Ga0070672_1000003584 | 210 |
| 121 | 3300005543 | Ga0070672_100322934 | Ga0070672_1003229342 | 210 |
| 122 | 3300005543 | Ga0070672_100419835 | Ga0070672_1004198352 | 210 |
| 123 | 3300005544 | Ga0070686_100362255 | Ga0070686_1003622551 | 210 |
| 124 | 3300005545 | Ga0070695_100001672 | Ga0070695_1000016722 | 210 |
| 125 | 3300005545 | Ga0070695_100361909 | Ga0070695_1003619092 | 210 |
| 126 | 3300005546 | Ga0070696_100037797 | Ga0070696_1000377973 | 210 |
| 127 | 3300005546 | Ga0070696_100116227 | Ga0070696_1001162271 | 210 |
| 128 | 3300005546 | Ga0070696_100311418 | Ga0070696_1003114182 | 210 |
| 129 | 3300005547 | Ga0070693_100235768 | Ga0070693_1002357681 | 210 |
| 130 | 3300005548 | Ga0070665_100365831 | Ga0070665_1003658312 | 210 |
| 131 | 3300005548 | Ga0070665_100718737 | Ga0070665_1007187371 | 210 |
| 132 | 3300005549 | Ga0070704_100024905 | Ga0070704_1000249053 | 210 |
| 133 | 3300005549 | Ga0070704_100287041 | Ga0070704_1002870412 | 210 |
| 134 | 3300005563 | Ga0068855_100014781 | Ga0068855_1000147815 | 210 |
| 135 | 3300005564 | Ga0070664_100060259 | Ga0070664_1000602593 | 210 |
| 136 | 3300005564 | Ga0070664_100378095 | Ga0070664_1003780952 | 210 |
| 137 | 3300005577 | Ga0068857_100002053 | Ga0068857_10000205310 | 210 |
| 138 | 3300005617 | Ga0068859_100004248 | Ga0068859_10000424814 | 210 |
| 139 | 3300005617 | Ga0068859_100098657 | Ga0068859_1000986572 | 210 |
| 140 | 3300005617 | Ga0068859_100336199 | Ga0068859_1003361992 | 210 |
| 141 | 3300005617 | Ga0068859_100640172 | Ga0068859_1006401722 | 210 |
| 142 | 3300005617 | Ga0068859_100764527 | Ga0068859_1007645272 | 210 |
| 143 | 3300005618 | Ga0068864_100000864 | Ga0068864_10000086416 | 210 |
| 144 | 3300005618 | Ga0068864_100002192 | Ga0068864_1000021922 | 210 |
| 145 | 3300005618 | Ga0068864_100046442 | Ga0068864_1000464422 | 210 |
| 146 | 3300005618 | Ga0068864_100228502 | Ga0068864_1002285021 | 210 |
| 147 | 3300005618 | Ga0068864_100230522 | Ga0068864_1002305222 | 210 |
| 148 | 3300005618 | Ga0068864_100286243 | Ga0068864_1002862432 | 210 |
| 149 | 3300005719 | Ga0068861_100001505 | Ga0068861_10000150513 | 210 |
| 150 | 3300005719 | Ga0068861_100054706 | Ga0068861_1000547064 | 210 |
| 151 | 3300005840 | Ga0068870_10019068 | Ga0068870_100190683 | 210 |
| 152 | 3300005840 | Ga0068870_10110510 | Ga0068870_101105101 | 210 |
| 153 | 3300005840 | Ga0068870_10178857 | Ga0068870_101788572 | 210 |
| 154 | 3300005841 | Ga0068863_100007858 | Ga0068863_1000078588 | 210 |
| 155 | 3300005841 | Ga0068863_100018650 | Ga0068863_1000186504 | 210 |
| 156 | 3300005841 | Ga0068863_100025648 | Ga0068863_1000256486 | 210 |
| 157 | 3300005841 | Ga0068863_100182004 | Ga0068863_1001820042 | 210 |
| 158 | 3300005841 | Ga0068863_100273367 | Ga0068863_1002733672 | 210 |
| 159 | 3300005841 | Ga0068863_100450198 | Ga0068863_1004501982 | 210 |
| 160 | 3300005841 | Ga0068863_100668751 | Ga0068863_1006687512 | 210 |
| 161 | 3300005842 | Ga0068858_100003730 | Ga0068858_10000373014 | 210 |
| 162 | 3300005842 | Ga0068858_101245948 | Ga0068858_1012459481 | 210 |
| 163 | 3300005843 | Ga0068860_100003546 | Ga0068860_1000035462 | 210 |
| 164 | 3300005843 | Ga0068860_100079628 | Ga0068860_1000796283 | 210 |
| 165 | 3300005843 | Ga0068860_100440198 | Ga0068860_1004401981 | 210 |
| 166 | 3300005844 | Ga0068862_100011184 | Ga0068862_1000111843 | 210 |
| 167 | 3300005844 | Ga0068862_100060778 | Ga0068862_1000607782 | 210 |
| 168 | 3300005844 | Ga0068862_100160392 | Ga0068862_1001603921 | 210 |
| 169 | 3300006163 | Ga0070715_10268150 | Ga0070715_102681501 | 210 |
| 170 | 3300006163 | Ga0070715_10355242 | Ga0070715_103552421 | 210 |
| 171 | 3300006173 | Ga0070716_100003300 | Ga0070716_1000033004 | 210 |
| 172 | 3300006173 | Ga0070716_100311847 | Ga0070716_1003118471 | 210 |
| 173 | 3300006175 | Ga0070712_100006093 | Ga0070712_1000060936 | 210 |
| 174 | 3300006175 | Ga0070712_100013372 | Ga0070712_1000133725 | 210 |
| 175 | 3300006175 | Ga0070712_100297080 | Ga0070712_1002970802 | 210 |
| 176 | 3300006178 | Ga0075367_10012918 | Ga0075367_100129183 | 210 |
| 177 | 3300006178 | Ga0075367_10238631 | Ga0075367_102386312 | 210 |
| 178 | 3300006237 | Ga0097621_100064774 | Ga0097621_1000647742 | 210 |
| 179 | 3300006358 | Ga0068871_100033269 | Ga0068871_1000332692 | 210 |
| 180 | 3300006358 | Ga0068871_100096764 | Ga0068871_1000967642 | 210 |
| 181 | 3300006844 | Ga0075428_100005739 | Ga0075428_1000057393 | 210 |
| 182 | 3300006844 | Ga0075428_100008340 | Ga0075428_10000834011 | 210 |
| 183 | 3300006844 | Ga0075428_100025808 | Ga0075428_1000258084 | 210 |
| 184 | 3300006844 | Ga0075428_100060939 | Ga0075428_1000609393 | 210 |
| 185 | 3300006844 | Ga0075428_100095625 | Ga0075428_1000956255 | 210 |
| 186 | 3300006844 | Ga0075428_100557520 | Ga0075428_1005575202 | 210 |
| 187 | 3300006844 | Ga0075428_100672139 | Ga0075428_1006721392 | 210 |
| 188 | 3300006844 | Ga0075428_101207724 | Ga0075428_1012077241 | 210 |
| 189 | 3300006846 | Ga0075430_100018379 | Ga0075430_1000183796 | 210 |
| 190 | 3300006846 | Ga0075430_100086442 | Ga0075430_1000864421 | 210 |
| 191 | 3300006847 | Ga0075431_100069065 | Ga0075431_1000690653 | 210 |
| 192 | 3300006847 | Ga0075431_100135129 | Ga0075431_1001351294 | 210 |
| 193 | 3300006847 | Ga0075431_100306138 | Ga0075431_1003061382 | 210 |
| 194 | 3300006852 | Ga0075433_10007413 | Ga0075433_100074134 | 210 |
| 195 | 3300006852 | Ga0075433_10015885 | Ga0075433_100158853 | 210 |
| 196 | 3300006852 | Ga0075433_10026125 | Ga0075433_100261252 | 210 |
| 197 | 3300006852 | Ga0075433_10054540 | Ga0075433_100545402 | 210 |
| 198 | 3300006852 | Ga0075433_10383538 | Ga0075433_103835382 | 210 |
| 199 | 3300006852 | Ga0075433_10522671 | Ga0075433_105226711 | 210 |
| 200 | 3300006852 | Ga0075433_10709229 | Ga0075433_107092291 | 210 |
| 201 | 3300006871 | Ga0075434_100002383 | Ga0075434_1000023833 | 210 |
| 202 | 3300006871 | Ga0075434_100037267 | Ga0075434_1000372672 | 210 |
| 203 | 3300006871 | Ga0075434_100068506 | Ga0075434_1000685062 | 210 |
| 204 | 3300006871 | Ga0075434_100209541 | Ga0075434_1002095414 | 210 |
| 205 | 3300006871 | Ga0075434_100475678 | Ga0075434_1004756781 | 210 |
| 206 | 3300006871 | Ga0075434_100992713 | Ga0075434_1009927131 | 210 |
| 207 | 3300006871 | Ga0075434_101432527 | Ga0075434_1014325271 | 210 |
| 208 | 3300006880 | Ga0075429_100000438 | Ga0075429_10000043814 | 210 |
| 209 | 3300006880 | Ga0075429_100020642 | Ga0075429_1000206425 | 210 |
| 210 | 3300006880 | Ga0075429_100480429 | Ga0075429_1004804292 | 210 |
| 211 | 3300006881 | Ga0068865_100036155 | Ga0068865_1000361554 | 210 |
| 212 | 3300006881 | Ga0068865_100088799 | Ga0068865_1000887992 | 210 |
| 213 | 3300006914 | Ga0075436_100005505 | Ga0075436_1000055056 | 210 |
| 214 | 3300006931 | Ga0097620_100004248 | Ga0097620_1000042482 | 210 |
| 215 | 3300006931 | Ga0097620_100098658 | Ga0097620_1000986582 | 210 |
| 216 | 3300006931 | Ga0097620_100336204 | Ga0097620_1003362042 | 210 |
| 217 | 3300006931 | Ga0097620_100640176 | Ga0097620_1006401762 | 210 |
| 218 | 3300006931 | Ga0097620_100764480 | Ga0097620_1007644801 | 210 |
| 219 | 3300007076 | Ga0075435_100008699 | Ga0075435_1000086993 | 210 |
| 220 | 3300007076 | Ga0075435_100034312 | Ga0075435_1000343124 | 210 |
| 221 | 3300007076 | Ga0075435_100158037 | Ga0075435_1001580374 | 210 |
| 222 | 3300007076 | Ga0075435_100417383 | Ga0075435_1004173832 | 210 |
| 223 | 3300007265 | Ga0099794_10002165 | Ga0099794_100021651 | 210 |
| 224 | 3300007265 | Ga0099794_10006118 | Ga0099794_100061185 | 210 |
| 225 | 3300007265 | Ga0099794_10010440 | Ga0099794_100104402 | 210 |
| 226 | 3300007265 | Ga0099794_10016223 | Ga0099794_100162233 | 210 |
| 227 | 3300007265 | Ga0099794_10098468 | Ga0099794_100984682 | 210 |
| 228 | 3300007265 | Ga0099794_10195594 | Ga0099794_101955942 | 210 |
| 229 | 3300009093 | Ga0105240_10004543 | Ga0105240_100045439 | 210 |
| 230 | 3300009094 | Ga0111539_10029130 | Ga0111539_100291304 | 210 |
| 231 | 3300009094 | Ga0111539_10103699 | Ga0111539_101036992 | 210 |
| 232 | 3300009094 | Ga0111539_10112374 | Ga0111539_101123742 | 210 |
| 233 | 3300009094 | Ga0111539_11071655 | Ga0111539_110716552 | 210 |
| 234 | 3300009098 | Ga0105245_10251659 | Ga0105245_102516591 | 210 |
| 235 | 3300009098 | Ga0105245_10254647 | Ga0105245_102546472 | 210 |
| 236 | 3300009147 | Ga0114129_10015362 | Ga0114129_1001536213 | 210 |
| 237 | 3300009147 | Ga0114129_10015953 | Ga0114129_1001595311 | 210 |
| 238 | 3300009147 | Ga0114129_10060511 | Ga0114129_100605112 | 210 |
| 239 | 3300009147 | Ga0114129_10063329 | Ga0114129_100633293 | 210 |
| 240 | 3300009147 | Ga0114129_10076087 | Ga0114129_100760872 | 210 |
| 241 | 3300009147 | Ga0114129_10171714 | Ga0114129_101717143 | 210 |
| 242 | 3300009147 | Ga0114129_10175972 | Ga0114129_101759721 | 210 |
| 243 | 3300009177 | Ga0105248_10020739 | Ga0105248_100207392 | 210 |
| 244 | 3300009177 | Ga0105248_10029407 | Ga0105248_100294072 | 210 |
| 245 | 3300009177 | Ga0105248_10068457 | Ga0105248_100684576 | 210 |
| 246 | 3300009177 | Ga0105248_10092714 | Ga0105248_100927142 | 210 |
| 247 | 3300009545 | Ga0105237_10021633 | Ga0105237_100216334 | 210 |
| 248 | 3300009545 | Ga0105237_10407815 | Ga0105237_104078152 | 210 |
| 249 | 3300009551 | Ga0105238_10007625 | Ga0105238_100076259 | 210 |
| 250 | 3300009551 | Ga0105238_10918041 | Ga0105238_109180411 | 210 |
| 251 | 3300009553 | Ga0105249_10028766 | Ga0105249_100287662 | 210 |
| 252 | 3300009553 | Ga0105249_10976181 | Ga0105249_109761811 | 210 |
| 253 | 3300010375 | Ga0105239_10632768 | Ga0105239_106327682 | 210 |
| 254 | 3300011119 | Ga0105246_10153582 | Ga0105246_101535822 | 210 |
| 255 | 3300013102 | Ga0157371_10036458 | Ga0157371_100364584 | 210 |
| 256 | 3300013104 | Ga0157370_10001068 | Ga0157370_100010689 | 210 |
| 257 | 3300013105 | Ga0157369_10008944 | Ga0157369_100089444 | 210 |
| 258 | 3300013297 | Ga0157378_10067430 | Ga0157378_100674302 | 210 |
| 259 | 3300013297 | Ga0157378_10106520 | Ga0157378_101065203 | 210 |
| 260 | 3300013297 | Ga0157378_10427688 | Ga0157378_104276881 | 210 |
| 261 | 3300013306 | Ga0163162_10055856 | Ga0163162_100558562 | 210 |
| 262 | 3300013306 | Ga0163162_10149599 | Ga0163162_101495992 | 210 |
| 263 | 3300013306 | Ga0163162_10415390 | Ga0163162_104153902 | 210 |
| 264 | 3300013306 | Ga0163162_10892817 | Ga0163162_108928171 | 210 |
| 265 | 3300013306 | Ga0163162_10944790 | Ga0163162_109447901 | 210 |
| 266 | 3300013308 | Ga0157375_10192027 | Ga0157375_101920272 | 210 |
| 267 | 3300014325 | Ga0163163_10002652 | Ga0163163_100026522 | 210 |
| 268 | 3300014325 | Ga0163163_10032956 | Ga0163163_100329562 | 210 |
| 269 | 3300014325 | Ga0163163_10119855 | Ga0163163_101198552 | 210 |
| 270 | 3300014326 | Ga0157380_10018017 | Ga0157380_100180176 | 210 |
| 271 | 3300014326 | Ga0157380_10025210 | Ga0157380_100252102 | 210 |
| 272 | 3300014326 | Ga0157380_10590181 | Ga0157380_105901812 | 210 |
| 273 | 3300014326 | Ga0157380_10715548 | Ga0157380_107155482 | 210 |
| 274 | 3300014968 | Ga0157379_10001336 | Ga0157379_1000133619 | 210 |
| 275 | 3300014968 | Ga0157379_10260647 | Ga0157379_102606472 | 210 |
| 276 | 3300014968 | Ga0157379_11084641 | Ga0157379_110846411 | 210 |
| 277 | 3300014969 | Ga0157376_10003314 | Ga0157376_100033144 | 210 |
| 278 | 3300014969 | Ga0157376_10208027 | Ga0157376_102080272 | 210 |
| 279 | 3300017792 | Ga0163161_10008265 | Ga0163161_100082652 | 210 |
| 280 | 3300017792 | Ga0163161_10279279 | Ga0163161_102792792 | 210 |
| 281 | 3300020070 | Ga0206356_11734636 | Ga0206356_117346362 | 210 |
| 282 | 3300022467 | Ga0224712_10115045 | Ga0224712_101150452 | 210 |
| 283 | 3300025263 | Ga0209565_1002480 | Ga0209565_10024803 | 210 |
| 284 | 3300025291 | Ga0209675_1003829 | Ga0209675_10038291 | 210 |
| 285 | 3300025299 | Ga0209256_1002745 | Ga0209256_10027453 | 210 |
| 286 | 3300025315 | Ga0207697_10087319 | Ga0207697_100873192 | 210 |
| 287 | 3300025893 | Ga0207682_10014935 | Ga0207682_100149352 | 210 |
| 288 | 3300025900 | Ga0207710_10008230 | Ga0207710_100082306 | 210 |
| 289 | 3300025903 | Ga0207680_10184130 | Ga0207680_101841302 | 210 |
| 290 | 3300025903 | Ga0207680_10520816 | Ga0207680_105208161 | 210 |
| 291 | 3300025905 | Ga0207685_10260158 | Ga0207685_102601581 | 210 |
| 292 | 3300025905 | Ga0207685_10312612 | Ga0207685_103126121 | 210 |
| 293 | 3300025906 | Ga0207699_10087986 | Ga0207699_100879862 | 210 |
| 294 | 3300025906 | Ga0207699_10368439 | Ga0207699_103684392 | 210 |
| 295 | 3300025907 | Ga0207645_10045197 | Ga0207645_100451973 | 210 |
| 296 | 3300025907 | Ga0207645_10142144 | Ga0207645_101421442 | 210 |
| 297 | 3300025908 | Ga0207643_10005744 | Ga0207643_100057445 | 210 |
| 298 | 3300025908 | Ga0207643_10014893 | Ga0207643_100148933 | 210 |
| 299 | 3300025908 | Ga0207643_10034750 | Ga0207643_100347502 | 210 |
| 300 | 3300025908 | Ga0207643_10329513 | Ga0207643_103295131 | 210 |
| 301 | 3300025910 | Ga0207684_10005802 | Ga0207684_100058028 | 210 |
| 302 | 3300025910 | Ga0207684_10016063 | Ga0207684_100160632 | 210 |
| 303 | 3300025910 | Ga0207684_10016535 | Ga0207684_100165353 | 210 |
| 304 | 3300025910 | Ga0207684_10027507 | Ga0207684_100275072 | 210 |
| 305 | 3300025910 | Ga0207684_10073879 | Ga0207684_100738791 | 210 |
| 306 | 3300025910 | Ga0207684_10113194 | Ga0207684_101131941 | 210 |
| 307 | 3300025910 | Ga0207684_10160917 | Ga0207684_101609172 | 210 |
| 308 | 3300025910 | Ga0207684_10200085 | Ga0207684_102000852 | 210 |
| 309 | 3300025912 | Ga0207707_10000444 | Ga0207707_100004449 | 210 |
| 310 | 3300025913 | Ga0207695_10003323 | Ga0207695_1000332311 | 210 |
| 311 | 3300025914 | Ga0207671_10328235 | Ga0207671_103282351 | 210 |
| 312 | 3300025914 | Ga0207671_10547557 | Ga0207671_105475571 | 210 |
| 313 | 3300025915 | Ga0207693_10010601 | Ga0207693_100106016 | 210 |
| 314 | 3300025915 | Ga0207693_10014404 | Ga0207693_100144047 | 210 |
| 315 | 3300025915 | Ga0207693_10429199 | Ga0207693_104291991 | 210 |
| 316 | 3300025917 | Ga0207660_10012178 | Ga0207660_100121784 | 210 |
| 317 | 3300025917 | Ga0207660_10061905 | Ga0207660_100619052 | 210 |
| 318 | 3300025918 | Ga0207662_10090633 | Ga0207662_100906334 | 210 |
| 319 | 3300025921 | Ga0207652_10009506 | Ga0207652_100095064 | 210 |
| 320 | 3300025922 | Ga0207646_10035728 | Ga0207646_100357283 | 210 |
| 321 | 3300025922 | Ga0207646_10038200 | Ga0207646_100382002 | 210 |
| 322 | 3300025922 | Ga0207646_10044568 | Ga0207646_100445682 | 210 |
| 323 | 3300025922 | Ga0207646_10481291 | Ga0207646_104812912 | 210 |
| 324 | 3300025923 | Ga0207681_10023410 | Ga0207681_100234101 | 210 |
| 325 | 3300025923 | Ga0207681_10108116 | Ga0207681_101081162 | 210 |
| 326 | 3300025923 | Ga0207681_10248427 | Ga0207681_102484271 | 210 |
| 327 | 3300025924 | Ga0207694_10009800 | Ga0207694_100098005 | 210 |
| 328 | 3300025925 | Ga0207650_10003440 | Ga0207650_1000344012 | 210 |
| 329 | 3300025925 | Ga0207650_10008000 | Ga0207650_100080005 | 210 |
| 330 | 3300025925 | Ga0207650_10032114 | Ga0207650_100321142 | 210 |
| 331 | 3300025925 | Ga0207650_10451302 | Ga0207650_104513021 | 210 |
| 332 | 3300025926 | Ga0207659_10363272 | Ga0207659_103632722 | 210 |
| 333 | 3300025928 | Ga0207700_10465573 | Ga0207700_104655731 | 210 |
| 334 | 3300025931 | Ga0207644_10133545 | Ga0207644_101335452 | 210 |
| 335 | 3300025931 | Ga0207644_10207880 | Ga0207644_102078802 | 210 |
| 336 | 3300025931 | Ga0207644_10456361 | Ga0207644_104563612 | 210 |
| 337 | 3300025933 | Ga0207706_10022081 | Ga0207706_100220815 | 210 |
| 338 | 3300025934 | Ga0207686_10134567 | Ga0207686_101345671 | 210 |
| 339 | 3300025936 | Ga0207670_10095529 | Ga0207670_100955293 | 210 |
| 340 | 3300025936 | Ga0207670_10133878 | Ga0207670_101338781 | 210 |
| 341 | 3300025936 | Ga0207670_10219107 | Ga0207670_102191072 | 210 |
| 342 | 3300025936 | Ga0207670_10341654 | Ga0207670_103416542 | 210 |
| 343 | 3300025938 | Ga0207704_10079633 | Ga0207704_100796332 | 210 |
| 344 | 3300025939 | Ga0207665_10001767 | Ga0207665_100017674 | 210 |
| 345 | 3300025940 | Ga0207691_10033344 | Ga0207691_100333443 | 210 |
| 346 | 3300025940 | Ga0207691_10045925 | Ga0207691_100459252 | 210 |
| 347 | 3300025940 | Ga0207691_10067959 | Ga0207691_100679593 | 210 |
| 348 | 3300025940 | Ga0207691_10330840 | Ga0207691_103308402 | 210 |
| 349 | 3300025940 | Ga0207691_10615799 | Ga0207691_106157991 | 210 |
| 350 | 3300025941 | Ga0207711_10039367 | Ga0207711_100393674 | 210 |
| 351 | 3300025941 | Ga0207711_10053868 | Ga0207711_100538682 | 210 |
| 352 | 3300025941 | Ga0207711_10209920 | Ga0207711_102099202 | 210 |
| 353 | 3300025941 | Ga0207711_10328868 | Ga0207711_103288681 | 210 |
| 354 | 3300025942 | Ga0207689_10001308 | Ga0207689_1000130814 | 210 |
| 355 | 3300025942 | Ga0207689_10089213 | Ga0207689_100892133 | 210 |
| 356 | 3300025942 | Ga0207689_10184746 | Ga0207689_101847462 | 210 |
| 357 | 3300025949 | Ga0207667_10004473 | Ga0207667_100044733 | 210 |
| 358 | 3300025949 | Ga0207667_10726903 | Ga0207667_107269032 | 210 |
| 359 | 3300025960 | Ga0207651_10003683 | Ga0207651_100036834 | 210 |
| 360 | 3300025960 | Ga0207651_10041582 | Ga0207651_100415823 | 210 |
| 361 | 3300025960 | Ga0207651_10140188 | Ga0207651_101401883 | 210 |
| 362 | 3300025961 | Ga0207712_10073277 | Ga0207712_100732772 | 210 |
| 363 | 3300025961 | Ga0207712_10225928 | Ga0207712_102259282 | 210 |
| 364 | 3300025961 | Ga0207712_10271732 | Ga0207712_102717322 | 210 |
| 365 | 3300025972 | Ga0207668_10062041 | Ga0207668_100620412 | 210 |
| 366 | 3300025986 | Ga0207658_10084191 | Ga0207658_100841912 | 210 |
| 367 | 3300025986 | Ga0207658_10286669 | Ga0207658_102866691 | 210 |
| 368 | 3300025986 | Ga0207658_10459261 | Ga0207658_104592612 | 210 |
| 369 | 3300026035 | Ga0207703_10000470 | Ga0207703_1000047033 | 210 |
| 370 | 3300026035 | Ga0207703_10832661 | Ga0207703_108326611 | 210 |
| 371 | 3300026075 | Ga0207708_10039049 | Ga0207708_100390493 | 210 |
| 372 | 3300026075 | Ga0207708_10266152 | Ga0207708_102661521 | 210 |
| 373 | 3300026088 | Ga0207641_10006512 | Ga0207641_100065128 | 210 |
| 374 | 3300026088 | Ga0207641_10008144 | Ga0207641_100081442 | 210 |
| 375 | 3300026088 | Ga0207641_10024153 | Ga0207641_100241535 | 210 |
| 376 | 3300026088 | Ga0207641_10467967 | Ga0207641_104679671 | 210 |
| 377 | 3300026088 | Ga0207641_10725536 | Ga0207641_107255361 | 210 |
| 378 | 3300026089 | Ga0207648_10004247 | Ga0207648_100042476 | 210 |
| 379 | 3300026089 | Ga0207648_10196293 | Ga0207648_101962932 | 210 |
| 380 | 3300026089 | Ga0207648_10778166 | Ga0207648_107781661 | 210 |
| 381 | 3300026095 | Ga0207676_10000609 | Ga0207676_1000060914 | 210 |
| 382 | 3300026095 | Ga0207676_10020005 | Ga0207676_100200052 | 210 |
| 383 | 3300026095 | Ga0207676_10023135 | Ga0207676_100231352 | 210 |
| 384 | 3300026095 | Ga0207676_10097755 | Ga0207676_100977552 | 210 |
| 385 | 3300026095 | Ga0207676_10281865 | Ga0207676_102818651 | 210 |
| 386 | 3300026116 | Ga0207674_10016097 | Ga0207674_100160972 | 210 |
| 387 | 3300026116 | Ga0207674_10054049 | Ga0207674_100540494 | 210 |
| 388 | 3300026116 | Ga0207674_11233114 | Ga0207674_112331141 | 210 |
| 389 | 3300026118 | Ga0207675_100004806 | Ga0207675_1000048063 | 210 |
| 390 | 3300026118 | Ga0207675_100188790 | Ga0207675_1001887902 | 210 |
| 391 | 3300026118 | Ga0207675_100262994 | Ga0207675_1002629942 | 210 |
| 392 | 3300026118 | Ga0207675_100662384 | Ga0207675_1006623841 | 210 |
| 393 | 3300026121 | Ga0207683_10024812 | Ga0207683_100248122 | 210 |
| 394 | 3300026121 | Ga0207683_10531298 | Ga0207683_105312982 | 210 |
| 395 | 3300027360 | Ga0209969_1003758 | Ga0209969_10037582 | 210 |
| 396 | 3300027395 | Ga0209996_1004862 | Ga0209996_10048621 | 210 |
| 397 | 3300027462 | Ga0210000_1007296 | Ga0210000_10072962 | 210 |
| 398 | 3300027671 | Ga0209588_1086658 | Ga0209588_10866581 | 210 |
| 399 | 3300027695 | Ga0209966_1003774 | Ga0209966_10037742 | 210 |
| 400 | 3300027866 | Ga0209813_10118384 | Ga0209813_101183841 | 210 |
| 401 | 3300027876 | Ga0209974_10009220 | Ga0209974_100092204 | 210 |
| 402 | 3300027907 | Ga0207428_10110103 | Ga0207428_101101032 | 210 |
| 403 | 3300027907 | Ga0207428_10207971 | Ga0207428_102079712 | 210 |
| 404 | 3300028379 | Ga0268266_10058741 | Ga0268266_100587412 | 210 |
| 405 | 3300028379 | Ga0268266_10094242 | Ga0268266_100942422 | 210 |
| 406 | 3300028379 | Ga0268266_10654619 | Ga0268266_106546191 | 210 |
| 407 | 3300028380 | Ga0268265_10045824 | Ga0268265_100458241 | 210 |
| 408 | 3300028380 | Ga0268265_10079704 | Ga0268265_100797042 | 210 |
| 409 | 3300028381 | Ga0268264_10001168 | Ga0268264_1000116816 | 210 |
| 410 | 3300028381 | Ga0268264_10021674 | Ga0268264_100216743 | 210 |
| 411 | 3300028381 | Ga0268264_10046403 | Ga0268264_100464032 | 210 |
| 412 | 3300031238 | Ga0265332_10001631 | Ga0265332_100016316 | 210 |
| 413 | 3300031239 | Ga0265328_10140402 | Ga0265328_101404022 | 210 |
| 414 | 3300031241 | Ga0265325_10019135 | Ga0265325_100191353 | 210 |
| 415 | 3300031242 | Ga0265329_10002664 | Ga0265329_100026642 | 210 |
| 416 | 3300031247 | Ga0265340_10190041 | Ga0265340_101900411 | 210 |
| 417 | 3300031249 | Ga0265339_10038117 | Ga0265339_100381172 | 210 |
| 418 | 3300031250 | Ga0265331_10000972 | Ga0265331_100009721 | 210 |
| 419 | 3300031251 | Ga0265327_10001720 | Ga0265327_100017202 | 210 |
| 420 | 3300031595 | Ga0265313_10000367 | Ga0265313_1000036719 | 210 |
| 421 | 3300031711 | Ga0265314_10002346 | Ga0265314_1000234620 | 210 |
| 422 | 3300031995 | Ga0307409_100942419 | Ga0307409_1009424192 | 210 |
| 423 | 3300032005 | Ga0307411_10142885 | Ga0307411_101428852 | 210 |
| 424 | 3300035115 | Ga0373941_0010854 | Ga0373941_0010854_1010_1663 | 210 |
| 425 | 3300035207 | Ga0373942_0034947 | Ga0373942_0034947_243_896 | 210 |
| 426 | 3300035691 | Ga0373931_0050743 | Ga0373931_0050743_727_1380 | 210 |
| 427 | 3300036401 | Ga0373937_0185814 | Ga0373937_0185814_1246_1902 | 210 |
| 428 | 3300036401 | Ga0373937_0190282 | Ga0373937_0190282_706_1365 | 210 |
| 429 | 3300037471 | Ga0395905_0985416 | Ga0395905_0985416_81_734 | 210 |
| 430 | 3300039450 | Ga0436363_0274523 | Ga0436363_0274523_151_810 | 210 |
| 431 | 3300041999 | Ga0439433_0011951 | Ga0439433_0011951_626_1282 | 210 |
| 432 | 3300042008 | Ga0439450_010825 | Ga0439450_010825_164_796 | 210 |
| 433 | 3300044656 | Ga0466969_0068440 | Ga0466969_0068440_335_988 | 210 |
| 434 | 3300044684 | Ga0466966_0081788 | Ga0466966_0081788_952_1605 | 210 |
| 435 | 3300044693 | Ga0466961_0085858 | Ga0466961_0085858_1299_1952 | 210 |
| 436 | 3300044706 | Ga0466964_0044895 | Ga0466964_0044895_168_821 | 210 |
| 437 | 3300044719 | Ga0466971_0038182 | Ga0466971_0038182_800_1453 | 210 |
| 438 | 3300044735 | Ga0466968_0099621 | Ga0466968_0099621_197_850 | 210 |
| 439 | 3300044842 | Ga0466957_0031538 | Ga0466957_0031538_2333_2986 | 210 |
| 440 | 3300045049 | Ga0466959_0045596 | Ga0466959_0045596_1624_2277 | 210 |
| 441 | 3300045051 | Ga0451576_0039530 | Ga0451576_0039530_2576_3229 | 210 |
| 442 | 3300046455 | Ga0495603_0102801 | Ga0495603_0102801_238_897 | 210 |
| 443 | 3300046462 | Ga0495651_0316105 | Ga0495651_0316105_263_922 | 210 |
| 444 | 3300046491 | Ga0495584_0356729 | Ga0495584_0356729_32_691 | 210 |
| 445 | 3300046499 | Ga0495594_0302623 | Ga0495594_0302623_34_693 | 210 |
| 446 | 3300046506 | Ga0495583_0082127 | Ga0495583_0082127_214_870 | 210 |
| 447 | 3300046517 | Ga0495630_0154664 | Ga0495630_0154664_1065_1724 | 210 |
| 448 | 3300046679 | Ga0495623_0230849 | Ga0495623_0230849_16_675 | 210 |
| 449 | 3300046684 | Ga0495669_0038812 | Ga0495669_0038812_650_1312 | 210 |
| 450 | 3300048906 | Ga0496103_0258096 | Ga0496103_0258096_313_969 | 210 |
| 451 | 3300048906 | Ga0496103_0329590 | Ga0496103_0329590_41_673 | 210 |
| 452 | 3300048907 | Ga0496104_0013290 | Ga0496104_0013290_98_730 | 210 |
| 453 | 3300048907 | Ga0496104_0634176 | Ga0496104_0634176_260_916 | 210 |
| 454 | 3300048908 | Ga0496105_0010192 | Ga0496105_0010192_5049_5681 | 210 |
| 455 | 3300048911 | Ga0496108_0169425 | Ga0496108_0169425_1125_1781 | 210 |
| 456 | 3300048911 | Ga0496108_0396466 | Ga0496108_0396466_247_879 | 210 |
| 457 | 3300048912 | Ga0496109_0014019 | Ga0496109_0014019_3955_4611 | 210 |
| 458 | 3300048913 | Ga0496110_0674231 | Ga0496110_0674231_206_838 | 210 |
| 459 | 3300048914 | Ga0496111_0097265 | Ga0496111_0097265_784_1416 | 210 |
| 460 | 3300048915 | Ga0496112_0208667 | Ga0496112_0208667_442_1188 | 210 |
| 461 | 3300048915 | Ga0496112_0683917 | Ga0496112_0683917_74_730 | 210 |
| 462 | 3300048917 | Ga0496114_0261223 | Ga0496114_0261223_621_1277 | 210 |
| 463 | 3300049568 | Ga0501031_0002036 | Ga0501031_0002036_5621_6280 | 210 |
| 464 | 3300049569 | Ga0501032_0012383 | Ga0501032_0012383_175_834 | 210 |
| 465 | 3300049570 | Ga0501033_0004584 | Ga0501033_0004584_6550_7209 | 210 |
| 466 | 3300049570 | Ga0501033_0250732 | Ga0501033_0250732_115_774 | 210 |
| 467 | 3300049571 | Ga0501034_0005792 | Ga0501034_0005792_4895_5530 | 210 |
| 468 | 3300049571 | Ga0501034_0041105 | Ga0501034_0041105_453_1112 | 210 |
| 469 | 3300049572 | Ga0501036_0005255 | Ga0501036_0005255_727_1383 | 210 |
| 470 | 3300049572 | Ga0501036_0007868 | Ga0501036_0007868_4402_5061 | 210 |
| 471 | 3300049572 | Ga0501036_0172621 | Ga0501036_0172621_397_1056 | 210 |
| 472 | 3300049573 | Ga0501037_0023566 | Ga0501037_0023566_585_1244 | 210 |
| 473 | 3300049573 | Ga0501037_0148346 | Ga0501037_0148346_700_1359 | 210 |
| 474 | 3300049574 | Ga0501038_0003383 | Ga0501038_0003383_10135_10794 | 210 |
| 475 | 3300049575 | Ga0501039_0059077 | Ga0501039_0059077_562_1221 | 210 |
| 476 | 3300049576 | Ga0501040_0058576 | Ga0501040_0058576_1120_1779 | 210 |
| 477 | 3300049577 | Ga0501041_0007372 | Ga0501041_0007372_1740_2396 | 210 |
| 478 | 3300049578 | Ga0501042_0036907 | Ga0501042_0036907_263_919 | 210 |
| 479 | 3300049578 | Ga0501042_0401170 | Ga0501042_0401170_95_748 | 210 |
| 480 | 3300049579 | Ga0501043_0083284 | Ga0501043_0083284_1823_2479 | 210 |
| 481 | 3300049579 | Ga0501043_0171499 | Ga0501043_0171499_243_902 | 210 |
| 482 | 3300049581 | Ga0501047_0004800 | Ga0501047_0004800_7303_7962 | 210 |
| 483 | 3300049583 | Ga0501067_0073097 | Ga0501067_0073097_1151_1810 | 210 |
| 484 | 3300049584 | Ga0501068_0246236 | Ga0501068_0246236_355_1011 | 210 |
| 485 | 3300049586 | Ga0501070_0004048 | Ga0501070_0004048_5493_6152 | 210 |
| 486 | 3300049587 | Ga0501071_0006328 | Ga0501071_0006328_1716_2372 | 210 |
| 487 | 3300049588 | Ga0501072_0076507 | Ga0501072_0076507_89_745 | 210 |
| 488 | 3300049590 | Ga0501074_0619555 | Ga0501074_0619555_43_696 | 210 |
| 489 | 3300049591 | Ga0501075_0566242 | Ga0501075_0566242_50_703 | 210 |
| 490 | 3300049592 | Ga0501076_0031457 | Ga0501076_0031457_3451_4104 | 210 |
| 491 | 3300049592 | Ga0501076_0042445 | Ga0501076_0042445_359_1018 | 210 |
| 492 | 3300049592 | Ga0501076_0204919 | Ga0501076_0204919_774_1427 | 210 |
| 493 | 3300049593 | Ga0501077_0017812 | Ga0501077_0017812_1611_2270 | 210 |
| 494 | 3300049741 | Ga0501079_0006518 | Ga0501079_0006518_3231_3890 | 210 |
| 495 | 3300049743 | Ga0501081_0125829 | Ga0501081_0125829_324_977 | 210 |
| 496 | 3300049743 | Ga0501081_0246573 | Ga0501081_0246573_586_1245 | 210 |
| 497 | 3300049744 | Ga0501083_0323197 | Ga0501083_0323197_31_687 | 210 |
| 498 | 3300049822 | Ga0501035_0007782 | Ga0501035_0007782_4140_4799 | 210 |
| 499 | 3300050491 | nmdc:mga00v17_249462_c1 | nmdc:mga00v17_249462_c1_44_697 | 210 |
| 500 | 3300050493 | nmdc:mga0k408_280071_c1 | nmdc:mga0k408_280071_c1_27_680 | 210 |
| 501 | 3300050494 | nmdc:mga06z11_12011_c1 | nmdc:mga06z11_12011_c1_1881_2534 | 210 |
| 502 | 3300050494 | nmdc:mga06z11_34465_c1 | nmdc:mga06z11_34465_c1_352_1005 | 210 |
| 503 | 3300050495 | nmdc:mga04h51_112268_c1 | nmdc:mga04h51_112268_c1_60_794 | 210 |
| 504 | 3300050507 | nmdc:mga05p37_101521_c1 | nmdc:mga05p37_101521_c1_2849_3508 | 210 |
| 505 | 3300050507 | nmdc:mga05p37_115691_c1 | nmdc:mga05p37_115691_c1_981_1763 | 210 |
| 506 | 3300050507 | nmdc:mga05p37_1566_c1 | nmdc:mga05p37_1566_c1_8967_9620 | 210 |
| 507 | 3300050507 | nmdc:mga05p37_189483_c2 | nmdc:mga05p37_189483_c2_804_1463 | 210 |
| 508 | 3300050507 | nmdc:mga05p37_216758_c1 | nmdc:mga05p37_216758_c1_863_1522 | 210 |
| 509 | 3300050507 | nmdc:mga05p37_314381_c1 | nmdc:mga05p37_314381_c1_121_780 | 210 |
| 510 | 3300050507 | nmdc:mga05p37_352777_c1 | nmdc:mga05p37_352777_c1_153_806 | 210 |
| 511 | 3300050507 | nmdc:mga05p37_87419_c1 | nmdc:mga05p37_87419_c1_596_1249 | 210 |
| 512 | 3300050508 | nmdc:mga09592_465_c1 | nmdc:mga09592_465_c1_22688_23341 | 210 |
| 513 | 3300050509 | nmdc:mga0qj67_212152_c1 | nmdc:mga0qj67_212152_c1_544_1218 | 210 |
| 514 | 3300050509 | nmdc:mga0qj67_311310_c1 | nmdc:mga0qj67_311310_c1_396_1049 | 210 |
| 515 | 3300050509 | nmdc:mga0qj67_31516_c1 | nmdc:mga0qj67_31516_c1_3014_3667 | 210 |
| 516 | 3300050509 | nmdc:mga0qj67_448806_c1 | nmdc:mga0qj67_448806_c1_394_1026 | 210 |
| 517 | 3300050510 | nmdc:mga06r32_209097_c1 | nmdc:mga06r32_209097_c1_390_1022 | 210 |
| 518 | 3300050510 | nmdc:mga06r32_231220_c1 | nmdc:mga06r32_231220_c1_416_1048 | 210 |
| 519 | 3300050511 | nmdc:mga08y16_104222_c1 | nmdc:mga08y16_104222_c1_804_1463 | 210 |
| 520 | 3300050511 | nmdc:mga08y16_220229_c1 | nmdc:mga08y16_220229_c1_813_1466 | 210 |
| 521 | 3300050511 | nmdc:mga08y16_316607_c1 | nmdc:mga08y16_316607_c1_583_1233 | 210 |
| 522 | 3300050512 | nmdc:mga0n895_108063_c1 | nmdc:mga0n895_108063_c1_354_1007 | 210 |
| 523 | 3300050512 | nmdc:mga0n895_174164_c1 | nmdc:mga0n895_174164_c1_1034_1687 | 210 |
| 524 | 3300050512 | nmdc:mga0n895_32780_c1 | nmdc:mga0n895_32780_c1_3492_4145 | 210 |
| 525 | 3300050512 | nmdc:mga0n895_34597_c1 | nmdc:mga0n895_34597_c1_1889_2548 | 210 |
| 526 | 3300050512 | nmdc:mga0n895_47472_c1 | nmdc:mga0n895_47472_c1_2024_2677 | 210 |
| 527 | 3300050512 | nmdc:mga0n895_497453_c1 | nmdc:mga0n895_497453_c1_41_673 | 210 |
| 528 | 3300050512 | nmdc:mga0n895_802989_c1 | nmdc:mga0n895_802989_c1_131_787 | 210 |
| 529 | 3300050512 | nmdc:mga0n895_88855_c1 | nmdc:mga0n895_88855_c1_476_1129 | 210 |
| 530 | 3300050513 | nmdc:mga0rr50_351017_c1 | nmdc:mga0rr50_351017_c1_133_792 | 210 |
| 531 | 3300050513 | nmdc:mga0rr50_6374_c1 | nmdc:mga0rr50_6374_c1_4930_5583 | 210 |
| 532 | 3300050514 | nmdc:mga08x19_15022_c1 | nmdc:mga08x19_15022_c1_749_1402 | 210 |
| 533 | 3300050514 | nmdc:mga08x19_280436_c1 | nmdc:mga08x19_280436_c1_456_1115 | 210 |
| 534 | 3300050515 | nmdc:mga0a205_12985_c1 | nmdc:mga0a205_12985_c1_3213_3872 | 210 |
| 535 | 3300050515 | nmdc:mga0a205_29970_c1 | nmdc:mga0a205_29970_c1_2750_3403 | 210 |
| 536 | 3300050515 | nmdc:mga0a205_352697_c1 | nmdc:mga0a205_352697_c1_85_738 | 210 |
| 537 | 3300050515 | nmdc:mga0a205_3800_c1 | nmdc:mga0a205_3800_c1_5792_6445 | 210 |
| 538 | 3300050515 | nmdc:mga0a205_607146_c1 | nmdc:mga0a205_607146_c1_175_831 | 210 |
| 539 | 3300053727 | Ga0500611_056231 | Ga0500611_056231_42_701 | 210 |
| 540 | 3300053730 | Ga0500645_026192 | Ga0500645_026192_537_1196 | 210 |
| 541 | 3300054114 | Ga0501084_0057087 | Ga0501084_0057087_1529_2188 | 210 |
| 542 | 3300059421 | Ga0590071_017845 | Ga0590071_017845_584_1240 | 210 |
| 543 | 3300059426 | Ga0590077_005668 | Ga0590077_005668_1840_2496 | 210 |
| 544 | 3300061719 | Ga0466962_0017548 | Ga0466962_0017548_1400_2053 | 210 |
| 545 | 3300061734 | Ga0530510_0007826 | Ga0530510_0007826_3231_3887 | 210 |
| 546 | 2162886007 | SwRhRL2b_contig_490068 | SwRhRL2b_0835.00003140 | 211 |
| 547 | 3300002077 | JGI24744J21845_10015512 | JGI24744J21845_100155122 | 211 |
| 548 | 3300005288 | Ga0065714_10002962 | Ga0065714_100029622 | 211 |
| 549 | 3300005288 | Ga0065714_10015604 | Ga0065714_100156042 | 211 |
| 550 | 3300005289 | Ga0065704_10070382 | Ga0065704_100703822 | 211 |
| 551 | 3300005289 | Ga0065704_10250521 | Ga0065704_102505211 | 211 |
| 552 | 3300005331 | Ga0070670_100009968 | Ga0070670_1000099686 | 211 |
| 553 | 3300005333 | Ga0070677_10245983 | Ga0070677_102459831 | 211 |
| 554 | 3300005334 | Ga0068869_100112140 | Ga0068869_1001121401 | 211 |
| 555 | 3300005335 | Ga0070666_10012713 | Ga0070666_100127133 | 211 |
| 556 | 3300005336 | Ga0070680_100217127 | Ga0070680_1002171272 | 211 |
| 557 | 3300005338 | Ga0068868_100357268 | Ga0068868_1003572682 | 211 |
| 558 | 3300005347 | Ga0070668_100396520 | Ga0070668_1003965202 | 211 |
| 559 | 3300005354 | Ga0070675_100203326 | Ga0070675_1002033261 | 211 |
| 560 | 3300005367 | Ga0070667_100096108 | Ga0070667_1000961081 | 211 |
| 561 | 3300005456 | Ga0070678_100016719 | Ga0070678_1000167191 | 211 |
| 562 | 3300005459 | Ga0068867_100108153 | Ga0068867_1001081533 | 211 |
| 563 | 3300005467 | Ga0070706_100190155 | Ga0070706_1001901552 | 211 |
| 564 | 3300005518 | Ga0070699_100524806 | Ga0070699_1005248062 | 211 |
| 565 | 3300005536 | Ga0070697_100030719 | Ga0070697_1000307191 | 211 |
| 566 | 3300005536 | Ga0070697_100175584 | Ga0070697_1001755841 | 211 |
| 567 | 3300005536 | Ga0070697_100443581 | Ga0070697_1004435811 | 211 |
| 568 | 3300005543 | Ga0070672_100424364 | Ga0070672_1004243642 | 211 |
| 569 | 3300005545 | Ga0070695_100299265 | Ga0070695_1002992652 | 211 |
| 570 | 3300005548 | Ga0070665_100087247 | Ga0070665_1000872472 | 211 |
| 571 | 3300005548 | Ga0070665_100249135 | Ga0070665_1002491352 | 211 |
| 572 | 3300005614 | Ga0068856_100155007 | Ga0068856_1001550072 | 211 |
| 573 | 3300005618 | Ga0068864_100909561 | Ga0068864_1009095611 | 211 |
| 574 | 3300005718 | Ga0068866_10234940 | Ga0068866_102349401 | 211 |
| 575 | 3300005719 | Ga0068861_100338774 | Ga0068861_1003387742 | 211 |
| 576 | 3300005840 | Ga0068870_10035750 | Ga0068870_100357502 | 211 |
| 577 | 3300005843 | Ga0068860_100072868 | Ga0068860_1000728681 | 211 |
| 578 | 3300005981 | Ga0081538_10013885 | Ga0081538_100138856 | 211 |
| 579 | 3300005981 | Ga0081538_10051883 | Ga0081538_100518832 | 211 |
| 580 | 3300005985 | Ga0081539_10035957 | Ga0081539_100359572 | 211 |
| 581 | 3300006237 | Ga0097621_100043127 | Ga0097621_1000431274 | 211 |
| 582 | 3300006358 | Ga0068871_100125108 | Ga0068871_1001251082 | 211 |
| 583 | 3300006852 | Ga0075433_10138956 | Ga0075433_101389561 | 211 |
| 584 | 3300006871 | Ga0075434_101339703 | Ga0075434_1013397031 | 211 |
| 585 | 3300006881 | Ga0068865_100132904 | Ga0068865_1001329042 | 211 |
| 586 | 3300007076 | Ga0075435_100047941 | Ga0075435_1000479411 | 211 |
| 587 | 3300009098 | Ga0105245_10000117 | Ga0105245_1000011729 | 211 |
| 588 | 3300009147 | Ga0114129_10279726 | Ga0114129_102797262 | 211 |
| 589 | 3300009174 | Ga0105241_10148828 | Ga0105241_101488284 | 211 |
| 590 | 3300009176 | Ga0105242_10008888 | Ga0105242_100088885 | 211 |
| 591 | 3300009177 | Ga0105248_10000037 | Ga0105248_10000037138 | 211 |
| 592 | 3300009551 | Ga0105238_10213888 | Ga0105238_102138883 | 211 |
| 593 | 3300011119 | Ga0105246_10012210 | Ga0105246_100122107 | 211 |
| 594 | 3300013102 | Ga0157371_10004223 | Ga0157371_100042238 | 211 |
| 595 | 3300013104 | Ga0157370_10038247 | Ga0157370_100382472 | 211 |
| 596 | 3300013104 | Ga0157370_10154713 | Ga0157370_101547132 | 211 |
| 597 | 3300013104 | Ga0157370_10340358 | Ga0157370_103403582 | 211 |
| 598 | 3300013105 | Ga0157369_10000051 | Ga0157369_10000051149 | 211 |
| 599 | 3300013105 | Ga0157369_10006381 | Ga0157369_1000638113 | 211 |
| 600 | 3300013296 | Ga0157374_10116406 | Ga0157374_101164062 | 211 |
| 601 | 3300013296 | Ga0157374_10127184 | Ga0157374_101271843 | 211 |
| 602 | 3300013296 | Ga0157374_10890462 | Ga0157374_108904622 | 211 |
| 603 | 3300013297 | Ga0157378_10210232 | Ga0157378_102102323 | 211 |
| 604 | 3300014497 | Ga0182008_10000009 | Ga0182008_10000009159 | 211 |
| 605 | 3300014745 | Ga0157377_10043926 | Ga0157377_100439263 | 211 |
| 606 | 3300014968 | Ga0157379_10558739 | Ga0157379_105587391 | 211 |
| 607 | 3300017792 | Ga0163161_10294203 | Ga0163161_102942032 | 211 |
| 608 | 3300020069 | Ga0197907_11086676 | Ga0197907_110866762 | 211 |
| 609 | 3300025315 | Ga0207697_10016406 | Ga0207697_100164064 | 211 |
| 610 | 3300025893 | Ga0207682_10255583 | Ga0207682_102555831 | 211 |
| 611 | 3300025899 | Ga0207642_10236255 | Ga0207642_102362552 | 211 |
| 612 | 3300025903 | Ga0207680_10305532 | Ga0207680_103055321 | 211 |
| 613 | 3300025907 | Ga0207645_10000693 | Ga0207645_1000069312 | 211 |
| 614 | 3300025908 | Ga0207643_10015522 | Ga0207643_100155225 | 211 |
| 615 | 3300025911 | Ga0207654_10044003 | Ga0207654_100440031 | 211 |
| 616 | 3300025919 | Ga0207657_10016994 | Ga0207657_100169943 | 211 |
| 617 | 3300025923 | Ga0207681_10028678 | Ga0207681_100286784 | 211 |
| 618 | 3300025926 | Ga0207659_10075488 | Ga0207659_100754883 | 211 |
| 619 | 3300025927 | Ga0207687_10000070 | Ga0207687_1000007066 | 211 |
| 620 | 3300025934 | Ga0207686_10630638 | Ga0207686_106306381 | 211 |
| 621 | 3300025937 | Ga0207669_10062883 | Ga0207669_100628831 | 211 |
| 622 | 3300025940 | Ga0207691_10113381 | Ga0207691_101133812 | 211 |
| 623 | 3300025941 | Ga0207711_10000011 | Ga0207711_10000011405 | 211 |
| 624 | 3300025942 | Ga0207689_10034064 | Ga0207689_100340645 | 211 |
| 625 | 3300025972 | Ga0207668_10215387 | Ga0207668_102153872 | 211 |
| 626 | 3300025986 | Ga0207658_10068022 | Ga0207658_100680221 | 211 |
| 627 | 3300026023 | Ga0207677_10298583 | Ga0207677_102985831 | 211 |
| 628 | 3300026075 | Ga0207708_10466459 | Ga0207708_104664592 | 211 |
| 629 | 3300026078 | Ga0207702_10058778 | Ga0207702_100587783 | 211 |
| 630 | 3300026089 | Ga0207648_10001098 | Ga0207648_1000109830 | 211 |
| 631 | 3300026095 | Ga0207676_10182757 | Ga0207676_101827571 | 211 |
| 632 | 3300026118 | Ga0207675_100118736 | Ga0207675_1001187362 | 211 |
| 633 | 3300026118 | Ga0207675_100551473 | Ga0207675_1005514732 | 211 |
| 634 | 3300026121 | Ga0207683_10000597 | Ga0207683_1000059716 | 211 |
| 635 | 3300026142 | Ga0207698_10000015 | Ga0207698_1000001582 | 211 |
| 636 | 3300027378 | Ga0209981_1026487 | Ga0209981_10264871 | 211 |
| 637 | 3300027526 | Ga0209968_1026750 | Ga0209968_10267501 | 211 |
| 638 | 3300027552 | Ga0209982_1006376 | Ga0209982_10063762 | 211 |
| 639 | 3300028379 | Ga0268266_10060714 | Ga0268266_100607143 | 211 |
| 640 | 3300028379 | Ga0268266_10423475 | Ga0268266_104234751 | 211 |
| 641 | 3300028381 | Ga0268264_10358856 | Ga0268264_103588561 | 211 |
| 642 | 3300031240 | Ga0265320_10205784 | Ga0265320_102057842 | 211 |
| 643 | 3300031249 | Ga0265339_10054872 | Ga0265339_100548722 | 211 |
| 644 | 3300031901 | Ga0307406_10546335 | Ga0307406_105463351 | 211 |
| 645 | 3300031911 | Ga0307412_10000084 | Ga0307412_1000008427 | 211 |
| 646 | 3300032004 | Ga0307414_10007545 | Ga0307414_100075454 | 211 |
| 647 | 3300032004 | Ga0307414_10013020 | Ga0307414_100130202 | 211 |
| 648 | 3300032004 | Ga0307414_10371062 | Ga0307414_103710621 | 211 |
| 649 | 3300032004 | Ga0307414_10878888 | Ga0307414_108788881 | 211 |
| 650 | 3300035120 | Ga0373957_0134314 | Ga0373957_0134314_34_774 | 211 |
| 651 | 3300037418 | Ga0395900_0001825 | Ga0395900_0001825_21407_22090 | 211 |
| 652 | 3300039453 | Ga0436362_0660881 | Ga0436362_0660881_1830_2534 | 211 |
| 653 | 3300042004 | Ga0439445_0049919 | Ga0439445_0049919_409_1071 | 211 |
| 654 | 3300046454 | Ga0495592_0000007 | Ga0495592_0000007_130439_131074 | 211 |
| 655 | 3300046476 | Ga0495662_0007164 | Ga0495662_0007164_331_966 | 211 |
| 656 | 3300046514 | Ga0495618_0053006 | Ga0495618_0053006_894_1529 | 211 |
| 657 | 3300046516 | Ga0495628_0032027 | Ga0495628_0032027_2385_3020 | 211 |
| 658 | 3300046517 | Ga0495630_0002686 | Ga0495630_0002686_10832_11467 | 211 |
| 659 | 3300046526 | Ga0495666_0038496 | Ga0495666_0038496_518_1153 | 211 |
| 660 | 3300046529 | Ga0495652_0184762 | Ga0495652_0184762_586_1221 | 211 |
| 661 | 3300046533 | Ga0495640_0105875 | Ga0495640_0105875_1014_1649 | 211 |
| 662 | 3300046535 | Ga0495586_0001436 | Ga0495586_0001436_12516_13151 | 211 |
| 663 | 3300046615 | Ga0495656_0018601 | Ga0495656_0018601_720_1382 | 211 |
| 664 | 3300046678 | Ga0495599_0001504 | Ga0495599_0001504_7157_7792 | 211 |
| 665 | 3300046690 | Ga0495624_0084818 | Ga0495624_0084818_1247_1882 | 211 |
| 666 | 3300046691 | Ga0495670_0255915 | Ga0495670_0255915_110_772 | 211 |
| 667 | 3300047318 | Ga0495636_0009050 | Ga0495636_0009050_2696_3358 | 211 |
| 668 | 3300048911 | Ga0496108_0000005 | Ga0496108_0000005_411911_412573 | 211 |
| 669 | 3300048912 | Ga0496109_0000002 | Ga0496109_0000002_122519_123181 | 211 |
| 670 | 3300049582 | Ga0501048_0159320 | Ga0501048_0159320_177_839 | 211 |
| 671 | 3300049584 | Ga0501068_0021587 | Ga0501068_0021587_3056_3712 | 211 |
| 672 | 3300049744 | Ga0501083_0402568 | Ga0501083_0402568_235_870 | 211 |
| 673 | 3300049758 | Ga0501241_005494 | Ga0501241_005494_396_1031 | 211 |
| 674 | 3300049824 | Ga0501045_0053512 | Ga0501045_0053512_1230_1892 | 211 |
| 675 | 3300050507 | nmdc:mga05p37_555612_c1 | nmdc:mga05p37_555612_c1_208_843 | 211 |
| 676 | 3300050508 | nmdc:mga09592_297430_c1 | nmdc:mga09592_297430_c1_588_1304 | 211 |
| 677 | 3300050510 | nmdc:mga06r32_140111_c1 | nmdc:mga06r32_140111_c1_179_841 | 211 |
| 678 | 3300050510 | nmdc:mga06r32_232604_c1 | nmdc:mga06r32_232604_c1_42_731 | 211 |
| 679 | 3300050512 | nmdc:mga0n895_1172732_c1 | nmdc:mga0n895_1172732_c1_17_652 | 211 |
| 680 | 3300050512 | nmdc:mga0n895_47148_c1 | nmdc:mga0n895_47148_c1_3329_3964 | 211 |
| 681 | 3300050513 | nmdc:mga0rr50_27949_c1 | nmdc:mga0rr50_27949_c1_132_767 | 211 |
| 682 | 3300053093 | Ga0500651_0007451 | Ga0500651_0007451_268_903 | 211 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7kuu-assembly1.cif.gz_B | lsfa from p. aeruginosa, a 1-cys prx in sulfonic acid form | 0.9662 | 3 | 210 |
| 7kuu-assembly1.cif.gz_B | lsfa from p. aeruginosa, a 1-cys prx in sulfonic acid form | 0.9615 | 3 | 210 |
| 6p0w-assembly1.cif.gz_A-2 | lsfa from p. aeruginosa, a 1-cys prx in reduced form | 0.9601 | 3 | 210 |
| 5b6n-assembly2.cif.gz_C | crystal structures of human peroxiredoxin 6 in sulfinic acid state | 0.9576 | 2 | 209 |
| 6p0w-assembly1.cif.gz_A-2 | lsfa from p. aeruginosa, a 1-cys prx in reduced form | 0.9508 | 3 | 210 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0R0K508_6_109_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9717 | 5 | 106 | 3.40.30.10 |
| af_I1KRJ7_151_218_3.30.1020.10 | Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 | 0.9709 | 146 | 207 | 3.30.1020.10 |
| af_Q54SE2_176_239_3.30.1020.10 | Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 | 0.9704 | 146 | 209 | 3.30.1020.10 |
| af_P34227_199_260_3.30.1020.10 | Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 | 0.9619 | 146 | 207 | 3.30.1020.10 |
| af_Q8IAM2_153_220_3.30.1020.10 | Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 | 0.9569 | 146 | 207 | 3.30.1020.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V5ZNJ6-F1-model_v4 | Peroxidase | 0.991 | 3 | 94 |
GO:0005829
GO:0006979 GO:0008379 GO:0033554 GO:0042744 GO:0045454 |
| AF-A0A3D2S068-F1-model_v4 | Peroxidase | 0.99 | 1 | 106 |
GO:0005829
GO:0006979 GO:0008379 GO:0033554 GO:0042744 GO:0045454 |
| AF-A0A659YRX5-F1-model_v4 | deleted | 0.9835 | 1 | 104 |
|
| AF-A0A523Q014-F1-model_v4 | Peroxiredoxin | 0.9833 | 1 | 211 |
GO:0005829
GO:0045454 GO:0051920 |
| AF-A0A7K0JSX1-F1-model_v4 | deleted | 0.9808 | 1 | 211 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar