F474946

General Info

Members Datasets Scaffolds Average Seq Length
682 310 674 218

Family's Representative Sequence

Representative Sequence 3300050507|nmdc:mga05p37_115691_c1|nmdc:mga05p37_115691_c1_981_1763
Length 260
Sequence VNAARSAARAGRSRRRDFCGALRFAPSVPKGVQSLAPDSEEDIMALRIGDEAPNFTAETTEGKINFHEWIGDGWAILFSHPKDFTPVCTTELGYMAKLKPEFAKRNVKVLGLSIDPVDDHKRWAKDIEETQGAAPNYPIVGDADLNVAKMYDMIHPNAAGGKRTAADNATIRSVFVVGPDKKIKLTLTYPMSTGRNFDEVLRVIDSMQLTAKHKVATPVNWKQGEDVIIVPAVSDDEAKQKFPGGWKAPKPYLRIVPQPK

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
3 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
4 2738541284 Pedobacter sp. YR016 Isolate Unclassified
5 2738543023 Pedobacter sp. OK628 Isolate Unclassified
6 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
7 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
8 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
9 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
10 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
11 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
12 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
72 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
73 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
74 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
75 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
76 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
77 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
78 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
83 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
84 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
91 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
92 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
93 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
100 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
101 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
104 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
105 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
106 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
107 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
108 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
109 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
112 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
113 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
114 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
115 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
116 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
117 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
118 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
123 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
124 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
186 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
188 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
192 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
193 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
194 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
195 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
196 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
197 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
198 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
199 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
200 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
201 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
202 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
203 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
204 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
205 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
206 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
207 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
208 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
209 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
210 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
211 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
212 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
213 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
214 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
215 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
216 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
217 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
218 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
219 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
220 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
221 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
222 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
223 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
224 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
225 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
226 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
227 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
228 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
229 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
230 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
231 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
232 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
233 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
234 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
235 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
236 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
237 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
238 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
239 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
240 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
241 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
242 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
243 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
244 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
245 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
246 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
247 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
248 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
249 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
250 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
251 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
252 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
253 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
254 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
255 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
256 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
257 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
258 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
259 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
260 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
274 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
275 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
276 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
277 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
278 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
279 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
280 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
281 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
282 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
283 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
284 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
285 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
286 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
287 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
289 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
290 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
291 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
292 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
293 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
294 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
295 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
296 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
297 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
298 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
299 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
300 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
301 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
302 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
303 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
304 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
305 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
306 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
307 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
308 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
309 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
310 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.39
Metatranscriptomes 0.44
Isolates 1.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.2
Nodule 0
Rhizoplane 2.64
Rhizosphere 94.57
Stem 0
Stem Tuber 0
Unclassified 0.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_490068 2162886007 Bacteria 4944
2 JGI24744J21845_10015512 3300002077 Bacteria 1522
3 Ga0055537_1016852 3300003773 Bacteria 1221
4 Ga0065714_10002962 3300005288 Bacteria 12102
5 Ga0065714_10015604 3300005288 Bacteria 2689
6 Ga0065704_10070382 3300005289 Bacteria 27921
7 Ga0065704_10250521 3300005289 Bacteria 990
8 Ga0065704_10408407 3300005289 Bacteria 744
9 Ga0070676_10019655 3300005328 Bacteria 3762
10 Ga0070676_10107161 3300005328 Bacteria 1735
11 Ga0070690_100164642 3300005330 Bacteria 1522
12 Ga0070690_100273480 3300005330 Bacteria 1202
13 Ga0070670_100001819 3300005331 Bacteria 17374
14 Ga0070670_100009968 3300005331 Bacteria 8107
15 Ga0070677_10245983 3300005333 Unclassified 885
16 Ga0070677_10276002 3300005333 Bacteria 845
17 Ga0068869_100112140 3300005334 Bacteria 2076
18 Ga0068869_100221957 3300005334 Bacteria 1498
19 Ga0070666_10012713 3300005335 Bacteria 5320
20 Ga0070666_10023538 3300005335 Bacteria 4010
21 Ga0070666_10123910 3300005335 Bacteria 1793
22 Ga0070680_100000283 3300005336 Bacteria 33791
23 Ga0070680_100217127 3300005336 Bacteria 1614
24 Ga0068868_100357268 3300005338 Bacteria 1252
25 Ga0070689_100050953 3300005340 Bacteria 3198
26 Ga0070691_10144032 3300005341 Bacteria 1217
27 Ga0070687_100017499 3300005343 Bacteria 3297
28 Ga0070687_100051057 3300005343 Bacteria 2139
29 Ga0070668_100002408 3300005347 Bacteria 13768
30 Ga0070668_100028668 3300005347 Bacteria 4224
31 Ga0070668_100396520 3300005347 Unclassified 1177
32 Ga0070669_100022773 3300005353 Bacteria 4480
33 Ga0070669_100089021 3300005353 Bacteria 2311
34 Ga0070669_100115773 3300005353 Bacteria 2039
35 Ga0070669_100205485 3300005353 Bacteria 1551
36 Ga0070669_100288406 3300005353 Bacteria 1317
37 Ga0070675_100010686 3300005354 Bacteria 7179
38 Ga0070675_100203326 3300005354 Bacteria 1719
39 Ga0070675_100216508 3300005354 Bacteria 1666
40 Ga0070675_100235633 3300005354 Bacteria 1598
41 Ga0070675_100317945 3300005354 Bacteria 1375
42 Ga0070671_100106789 3300005355 Bacteria 2350
43 Ga0070671_100132914 3300005355 Bacteria 2096
44 Ga0070671_100845459 3300005355 Bacteria 798
45 Ga0070674_100083171 3300005356 Bacteria 2291
46 Ga0070673_100029652 3300005364 Bacteria 4082
47 Ga0070673_100045367 3300005364 Bacteria 3408
48 Ga0070673_100101569 3300005364 Bacteria 2370
49 Ga0070673_100182617 3300005364 Bacteria 1797
50 Ga0070673_100286821 3300005364 Bacteria 1445
51 Ga0070673_100569468 3300005364 Bacteria 1030
52 Ga0070688_100208176 3300005365 Bacteria 1372
53 Ga0070667_100001213 3300005367 Bacteria 23490
54 Ga0070667_100096108 3300005367 Unclassified 2555
55 Ga0070667_100244627 3300005367 Bacteria 1603
56 Ga0070703_10042781 3300005406 Bacteria 1418
57 Ga0070709_10161693 3300005434 Bacteria 1558
58 Ga0070709_10175533 3300005434 Bacteria 1501
59 Ga0070713_100189035 3300005436 Bacteria 1855
60 Ga0070705_100074896 3300005440 Bacteria 2059
61 Ga0070705_100307002 3300005440 Bacteria 1139
62 Ga0070700_100067109 3300005441 Bacteria 2278
63 Ga0070694_100279790 3300005444 Bacteria 1272
64 Ga0070708_100014071 3300005445 Bacteria 6575
65 Ga0070708_100020712 3300005445 Bacteria 5552
66 Ga0070708_100024505 3300005445 Bacteria 5150
67 Ga0070708_100037390 3300005445 Bacteria 4234
68 Ga0070708_100217129 3300005445 Bacteria 1793
69 Ga0070708_100764229 3300005445 Bacteria 909
70 Ga0070678_100016719 3300005456 Bacteria 4701
71 Ga0070678_101002772 3300005456 Bacteria 768
72 Ga0070662_100020338 3300005457 Bacteria 4520
73 Ga0070681_10064166 3300005458 Bacteria 3644
74 Ga0068867_100002403 3300005459 Bacteria 13169
75 Ga0068867_100081084 3300005459 Bacteria 2445
76 Ga0068867_100108153 3300005459 Bacteria 2132
77 Ga0068867_100132955 3300005459 Bacteria 1936
78 Ga0070706_100001637 3300005467 Bacteria 23327
79 Ga0070706_100018923 3300005467 Bacteria 6352
80 Ga0070706_100032060 3300005467 Bacteria 4846
81 Ga0070706_100057312 3300005467 Bacteria 3595
82 Ga0070706_100074118 3300005467 Bacteria 3151
83 Ga0070706_100119084 3300005467 Bacteria 2461
84 Ga0070706_100125586 3300005467 Bacteria 2392
85 Ga0070706_100190155 3300005467 Bacteria 1918
86 Ga0070706_100340799 3300005467 Bacteria 1398
87 Ga0070707_100027344 3300005468 Bacteria 5427
88 Ga0070707_100048385 3300005468 Bacteria 4073
89 Ga0070698_100030522 3300005471 Bacteria 5587
90 Ga0070698_100049404 3300005471 Bacteria 4293
91 Ga0070698_100157695 3300005471 Bacteria 2215
92 Ga0070698_100159123 3300005471 Bacteria 2203
93 Ga0070698_100161258 3300005471 Bacteria 2186
94 Ga0070698_100653532 3300005471 Bacteria 993
95 Ga0070699_100004353 3300005518 Bacteria 12517
96 Ga0070699_100018538 3300005518 Bacteria 5978
97 Ga0070699_100109027 3300005518 Bacteria 2430
98 Ga0070699_100524806 3300005518 Bacteria 1077
99 Ga0070679_100031849 3300005530 Bacteria 5213
100 Ga0070697_100013647 3300005536 Bacteria 6373
101 Ga0070697_100030719 3300005536 Bacteria 4316
102 Ga0070697_100175584 3300005536 Bacteria 1815
103 Ga0070697_100242098 3300005536 Bacteria 1541
104 Ga0070697_100250470 3300005536 Bacteria 1514
105 Ga0070697_100413280 3300005536 Bacteria 1172
106 Ga0070697_100443581 3300005536 Bacteria 1130
107 Ga0068853_100712376 3300005539 Bacteria 958
108 Ga0070672_100000358 3300005543 Bacteria 26306
109 Ga0070672_100322934 3300005543 Bacteria 1312
110 Ga0070672_100419835 3300005543 Bacteria 1149
111 Ga0070672_100424364 3300005543 Unclassified 1142
112 Ga0070686_100362255 3300005544 Bacteria 1092
113 Ga0070695_100001672 3300005545 Bacteria 12488
114 Ga0070695_100299265 3300005545 Bacteria 1188
115 Ga0070695_100361909 3300005545 Bacteria 1090
116 Ga0070696_100037797 3300005546 Bacteria 3330
117 Ga0070696_100116227 3300005546 Bacteria 1931
118 Ga0070696_100311418 3300005546 Bacteria 1209
119 Ga0070693_100235768 3300005547 Bacteria 1206
120 Ga0070665_100087247 3300005548 Bacteria 3125
121 Ga0070665_100249135 3300005548 Bacteria 1777
122 Ga0070665_100365831 3300005548 Bacteria 1449
123 Ga0070665_100718737 3300005548 Bacteria 1012
124 Ga0070704_100024905 3300005549 Bacteria 3932
125 Ga0070704_100287041 3300005549 Bacteria 1366
126 Ga0068855_100014781 3300005563 Bacteria 9401
127 Ga0070664_100060259 3300005564 Bacteria 3231
128 Ga0070664_100378095 3300005564 Bacteria 1292
129 Ga0068857_100002053 3300005577 Bacteria 16357
130 Ga0068856_100155007 3300005614 Bacteria 2300
131 Ga0068859_100004248 3300005617 Bacteria 14627
132 Ga0068859_100098657 3300005617 Bacteria 2975
133 Ga0068859_100336199 3300005617 Bacteria 1604
134 Ga0068859_100640172 3300005617 Bacteria 1155
135 Ga0068859_100764527 3300005617 Bacteria 1055
136 Ga0068864_100000864 3300005618 Bacteria 25502
137 Ga0068864_100002192 3300005618 Bacteria 16114
138 Ga0068864_100046442 3300005618 Bacteria 3726
139 Ga0068864_100228502 3300005618 Bacteria 1720
140 Ga0068864_100230522 3300005618 Bacteria 1713
141 Ga0068864_100286243 3300005618 Bacteria 1539
142 Ga0068864_100909561 3300005618 Bacteria 869
143 Ga0068866_10234940 3300005718 Unclassified 1114
144 Ga0068861_100001505 3300005719 Bacteria 14788
145 Ga0068861_100054706 3300005719 Bacteria 3041
146 Ga0068861_100338774 3300005719 Unclassified 1315
147 Ga0068870_10019068 3300005840 Bacteria 3322
148 Ga0068870_10035750 3300005840 Bacteria 2551
149 Ga0068870_10110510 3300005840 Bacteria 1568
150 Ga0068870_10178857 3300005840 Bacteria 1272
151 Ga0068863_100007858 3300005841 Bacteria 10429
152 Ga0068863_100018650 3300005841 Bacteria 6638
153 Ga0068863_100025648 3300005841 Bacteria 5621
154 Ga0068863_100182004 3300005841 Bacteria 2017
155 Ga0068863_100273367 3300005841 Bacteria 1636
156 Ga0068863_100450198 3300005841 Bacteria 1263
157 Ga0068863_100668751 3300005841 Bacteria 1031
158 Ga0068858_100003730 3300005842 Bacteria 15077
159 Ga0068858_100836970 3300005842 Bacteria 898
160 Ga0068858_101245948 3300005842 Unclassified 731
161 Ga0068860_100003546 3300005843 Bacteria 16047
162 Ga0068860_100072868 3300005843 Unclassified 3264
163 Ga0068860_100079628 3300005843 Bacteria 3115
164 Ga0068860_100440198 3300005843 Bacteria 1295
165 Ga0068862_100011184 3300005844 Bacteria 7411
166 Ga0068862_100060778 3300005844 Bacteria 3247
167 Ga0068862_100160392 3300005844 Bacteria 2007
168 Ga0081455_10114844 3300005937 Bacteria 2132
169 Ga0081538_10013885 3300005981 Bacteria 6346
170 Ga0081538_10051883 3300005981 Bacteria 2457
171 Ga0081539_10035957 3300005985 Bacteria 2969
172 Ga0070717_10337512 3300006028 Bacteria 1345
173 Ga0070715_10268150 3300006163 Bacteria 900
174 Ga0070715_10355242 3300006163 Bacteria 802
175 Ga0070716_100003300 3300006173 Bacteria 7582
176 Ga0070716_100311847 3300006173 Bacteria 1099
177 Ga0070712_100006093 3300006175 Bacteria 7466
178 Ga0070712_100013372 3300006175 Bacteria 5244
179 Ga0070712_100297080 3300006175 Bacteria 1306
180 Ga0075367_10012918 3300006178 Bacteria 4474
181 Ga0075367_10238631 3300006178 Bacteria 1139
182 Ga0097621_100043127 3300006237 Bacteria 3636
183 Ga0097621_100064774 3300006237 Bacteria 3006
184 Ga0068871_100033269 3300006358 Bacteria 4082
185 Ga0068871_100096764 3300006358 Bacteria 2467
186 Ga0068871_100125108 3300006358 Unclassified 2175
187 Ga0068871_100311150 3300006358 Bacteria 1385
188 Ga0075428_100005739 3300006844 Bacteria 13790
189 Ga0075428_100008340 3300006844 Bacteria 11489
190 Ga0075428_100025808 3300006844 Bacteria 6507
191 Ga0075428_100060939 3300006844 Bacteria 4132
192 Ga0075428_100095625 3300006844 Bacteria 3238
193 Ga0075428_100138309 3300006844 Bacteria 2648
194 Ga0075428_100557520 3300006844 Bacteria 1225
195 Ga0075428_100672139 3300006844 Bacteria 1104
196 Ga0075428_101207724 3300006844 Bacteria 797
197 Ga0075430_100018379 3300006846 Bacteria 5949
198 Ga0075430_100086442 3300006846 Bacteria 2624
199 Ga0075431_100036382 3300006847 Bacteria 5071
200 Ga0075431_100069065 3300006847 Bacteria 3646
201 Ga0075431_100135129 3300006847 Bacteria 2542
202 Ga0075431_100306138 3300006847 Bacteria 1605
203 Ga0075433_10007413 3300006852 Bacteria 8710
204 Ga0075433_10015885 3300006852 Bacteria 6190
205 Ga0075433_10026125 3300006852 Bacteria 4940
206 Ga0075433_10054540 3300006852 Bacteria 3487
207 Ga0075433_10138956 3300006852 Bacteria 2159
208 Ga0075433_10383538 3300006852 Bacteria 1241
209 Ga0075433_10522671 3300006852 Bacteria 1044
210 Ga0075433_10709229 3300006852 Bacteria 881
211 Ga0075434_100002383 3300006871 Bacteria 16506
212 Ga0075434_100037267 3300006871 Bacteria 4814
213 Ga0075434_100068506 3300006871 Bacteria 3535
214 Ga0075434_100209541 3300006871 Bacteria 1969
215 Ga0075434_100475678 3300006871 Bacteria 1270
216 Ga0075434_100992713 3300006871 Bacteria 854
217 Ga0075434_101339703 3300006871 Bacteria 726
218 Ga0075434_101432527 3300006871 Bacteria 701
219 Ga0075429_100000438 3300006880 Bacteria 30989
220 Ga0075429_100020642 3300006880 Bacteria 5718
221 Ga0075429_100480429 3300006880 Bacteria 1089
222 Ga0068865_100036155 3300006881 Bacteria 3327
223 Ga0068865_100088799 3300006881 Bacteria 2237
224 Ga0068865_100132904 3300006881 Unclassified 1866
225 Ga0068865_100264030 3300006881 Bacteria 1364
226 Ga0075436_100005505 3300006914 Bacteria 8709
227 Ga0097620_100004248 3300006931 Bacteria 14627
228 Ga0097620_100098658 3300006931 Bacteria 2975
229 Ga0097620_100336204 3300006931 Bacteria 1604
230 Ga0097620_100640176 3300006931 Bacteria 1155
231 Ga0097620_100764480 3300006931 Bacteria 1055
232 Ga0075435_100008699 3300007076 Bacteria 7302
233 Ga0075435_100034312 3300007076 Bacteria 4020
234 Ga0075435_100047941 3300007076 Bacteria 3430
235 Ga0075435_100158037 3300007076 Bacteria 1908
236 Ga0075435_100417383 3300007076 Bacteria 1155
237 Ga0099794_10002165 3300007265 Bacteria 7153
238 Ga0099794_10006118 3300007265 Bacteria 4863
239 Ga0099794_10010440 3300007265 Bacteria 3943
240 Ga0099794_10016223 3300007265 Bacteria 3300
241 Ga0099794_10098468 3300007265 Bacteria 1458
242 Ga0099794_10195594 3300007265 Bacteria 1035
243 Ga0105240_10004543 3300009093 Bacteria 21070
244 Ga0111539_10029130 3300009094 Bacteria 6730
245 Ga0111539_10103699 3300009094 Bacteria 3338
246 Ga0111539_10112374 3300009094 Bacteria 3196
247 Ga0111539_11071655 3300009094 Bacteria 937
248 Ga0105245_10000117 3300009098 Bacteria 76863
249 Ga0105245_10251659 3300009098 Unclassified 1717
250 Ga0105245_10254647 3300009098 Bacteria 1707
251 Ga0114129_10015362 3300009147 Bacteria 10894
252 Ga0114129_10015953 3300009147 Bacteria 10682
253 Ga0114129_10060511 3300009147 Bacteria 5295
254 Ga0114129_10063329 3300009147 Bacteria 5164
255 Ga0114129_10076087 3300009147 Bacteria 4673
256 Ga0114129_10171714 3300009147 Bacteria 2955
257 Ga0114129_10175972 3300009147 Bacteria 2915
258 Ga0114129_10279726 3300009147 Bacteria 2230
259 Ga0105241_10148828 3300009174 Bacteria 1913
260 Ga0105242_10008888 3300009176 Bacteria 7708
261 Ga0105248_10000037 3300009177 Bacteria 180751
262 Ga0105248_10020739 3300009177 Bacteria 7281
263 Ga0105248_10029407 3300009177 Bacteria 6129
264 Ga0105248_10068457 3300009177 Bacteria 3985
265 Ga0105248_10092714 3300009177 Bacteria 3402
266 Ga0105237_10021633 3300009545 Bacteria 6610
267 Ga0105237_10407815 3300009545 Bacteria 1364
268 Ga0105238_10007625 3300009551 Bacteria 10843
269 Ga0105238_10213888 3300009551 Bacteria 1904
270 Ga0105238_10918041 3300009551 Bacteria 894
271 Ga0105249_10028766 3300009553 Bacteria 5016
272 Ga0105249_10976181 3300009553 Bacteria 915
273 Ga0105239_10632768 3300010375 Bacteria 1221
274 Ga0105246_10012210 3300011119 Bacteria 5352
275 Ga0105246_10153582 3300011119 Bacteria 1745
276 Ga0157371_10004223 3300013102 Bacteria 12636
277 Ga0157371_10036458 3300013102 Bacteria 3522
278 Ga0157370_10001068 3300013104 Bacteria 34289
279 Ga0157370_10038247 3300013104 Bacteria 4642
280 Ga0157370_10154713 3300013104 Bacteria 2133
281 Ga0157370_10340358 3300013104 Bacteria 1383
282 Ga0157369_10000051 3300013105 Bacteria 165672
283 Ga0157369_10006381 3300013105 Bacteria 13679
284 Ga0157369_10008944 3300013105 Bacteria 11470
285 Ga0157374_10116406 3300013296 Bacteria 2575
286 Ga0157374_10127184 3300013296 Unclassified 2463
287 Ga0157374_10890462 3300013296 Bacteria 907
288 Ga0157378_10067430 3300013297 Bacteria 3207
289 Ga0157378_10106520 3300013297 Bacteria 2565
290 Ga0157378_10210232 3300013297 Bacteria 1845
291 Ga0157378_10427688 3300013297 Bacteria 1310
292 Ga0163162_10055856 3300013306 Bacteria 3976
293 Ga0163162_10149599 3300013306 Bacteria 2452
294 Ga0163162_10415390 3300013306 Bacteria 1478
295 Ga0163162_10892817 3300013306 Bacteria 1002
296 Ga0163162_10944790 3300013306 Bacteria 973
297 Ga0157375_10192027 3300013308 Bacteria 2197
298 Ga0157375_10267260 3300013308 Bacteria 1872
299 Ga0163163_10002652 3300014325 Bacteria 15137
300 Ga0163163_10032956 3300014325 Bacteria 5007
301 Ga0163163_10119855 3300014325 Bacteria 2664
302 Ga0157380_10018017 3300014326 Bacteria 5238
303 Ga0157380_10025210 3300014326 Bacteria 4508
304 Ga0157380_10590181 3300014326 Bacteria 1097
305 Ga0157380_10715548 3300014326 Bacteria 1008
306 Ga0182008_10000009 3300014497 Bacteria 331416
307 Ga0157377_10043926 3300014745 Bacteria 2490
308 Ga0157379_10001336 3300014968 Bacteria 20129
309 Ga0157379_10260647 3300014968 Bacteria 1575
310 Ga0157379_10558739 3300014968 Bacteria 1065
311 Ga0157379_11084641 3300014968 Bacteria 766
312 Ga0157376_10003314 3300014969 Bacteria 11084
313 Ga0157376_10208027 3300014969 Bacteria 1805
314 Ga0163161_10008265 3300017792 Bacteria 7200
315 Ga0163161_10279279 3300017792 Bacteria 1309
316 Ga0163161_10294203 3300017792 Unclassified 1277
317 Ga0197907_11086676 3300020069 Bacteria 841
318 Ga0206356_11734636 3300020070 Bacteria 818
319 Ga0224712_10115045 3300022467 Bacteria 1158
320 Ga0209565_1002480 3300025263 Bacteria 6601
321 Ga0209675_1003829 3300025291 Bacteria 6938
322 Ga0209256_1002745 3300025299 Bacteria 13607
323 Ga0207697_10016406 3300025315 Bacteria 3051
324 Ga0207697_10087319 3300025315 Bacteria 1319
325 Ga0207682_10014935 3300025893 Bacteria 3024
326 Ga0207682_10255583 3300025893 Bacteria 816
327 Ga0207642_10236255 3300025899 Bacteria 1029
328 Ga0207710_10008230 3300025900 Bacteria 4401
329 Ga0207680_10184130 3300025903 Bacteria 1414
330 Ga0207680_10305532 3300025903 Unclassified 1109
331 Ga0207680_10520816 3300025903 Bacteria 848
332 Ga0207685_10260158 3300025905 Bacteria 843
333 Ga0207685_10312612 3300025905 Bacteria 781
334 Ga0207699_10087986 3300025906 Bacteria 1943
335 Ga0207699_10368439 3300025906 Bacteria 1017
336 Ga0207645_10000693 3300025907 Bacteria 27991
337 Ga0207645_10045197 3300025907 Bacteria 2815
338 Ga0207645_10142144 3300025907 Bacteria 1564
339 Ga0207643_10005744 3300025908 Bacteria 6633
340 Ga0207643_10014893 3300025908 Bacteria 4230
341 Ga0207643_10015522 3300025908 Bacteria 4147
342 Ga0207643_10034750 3300025908 Bacteria 2825
343 Ga0207643_10329513 3300025908 Bacteria 955
344 Ga0207684_10005802 3300025910 Bacteria 11319
345 Ga0207684_10016063 3300025910 Bacteria 6429
346 Ga0207684_10016535 3300025910 Bacteria 6333
347 Ga0207684_10027507 3300025910 Bacteria 4844
348 Ga0207684_10073879 3300025910 Bacteria 2896
349 Ga0207684_10113194 3300025910 Bacteria 2323
350 Ga0207684_10160917 3300025910 Bacteria 1933
351 Ga0207684_10200085 3300025910 Bacteria 1723
352 Ga0207654_10044003 3300025911 Bacteria 2533
353 Ga0207707_10000444 3300025912 Bacteria 42985
354 Ga0207695_10003323 3300025913 Bacteria 22796
355 Ga0207671_10328235 3300025914 Bacteria 1211
356 Ga0207671_10547557 3300025914 Bacteria 922
357 Ga0207693_10010601 3300025915 Bacteria 7479
358 Ga0207693_10014404 3300025915 Bacteria 6359
359 Ga0207693_10429199 3300025915 Bacteria 1033
360 Ga0207663_10123058 3300025916 Bacteria 1780
361 Ga0207660_10012178 3300025917 Bacteria 5621
362 Ga0207660_10061905 3300025917 Bacteria 2695
363 Ga0207662_10090633 3300025918 Bacteria 1880
364 Ga0207657_10016994 3300025919 Bacteria 6998
365 Ga0207652_10009506 3300025921 Bacteria 7818
366 Ga0207646_10035728 3300025922 Bacteria 4487
367 Ga0207646_10038200 3300025922 Bacteria 4326
368 Ga0207646_10044568 3300025922 Bacteria 3981
369 Ga0207646_10481291 3300025922 Bacteria 1119
370 Ga0207681_10023410 3300025923 Bacteria 3950
371 Ga0207681_10028678 3300025923 Bacteria 3608
372 Ga0207681_10108116 3300025923 Bacteria 2018
373 Ga0207681_10248427 3300025923 Bacteria 1388
374 Ga0207694_10009800 3300025924 Bacteria 7232
375 Ga0207650_10003440 3300025925 Bacteria 10880
376 Ga0207650_10008000 3300025925 Bacteria 7205
377 Ga0207650_10032114 3300025925 Bacteria 3797
378 Ga0207650_10451302 3300025925 Bacteria 1070
379 Ga0207659_10075488 3300025926 Bacteria 2474
380 Ga0207659_10363272 3300025926 Bacteria 1204
381 Ga0207687_10000070 3300025927 Bacteria 77432
382 Ga0207687_10601370 3300025927 Bacteria 927
383 Ga0207700_10465573 3300025928 Bacteria 1116
384 Ga0207644_10133545 3300025931 Bacteria 1903
385 Ga0207644_10207880 3300025931 Bacteria 1546
386 Ga0207644_10456361 3300025931 Bacteria 1050
387 Ga0207706_10022081 3300025933 Bacteria 5712
388 Ga0207686_10134567 3300025934 Bacteria 1700
389 Ga0207686_10630638 3300025934 Bacteria 846
390 Ga0207670_10095529 3300025936 Bacteria 2111
391 Ga0207670_10133878 3300025936 Bacteria 1820
392 Ga0207670_10219107 3300025936 Bacteria 1456
393 Ga0207670_10341654 3300025936 Bacteria 1183
394 Ga0207669_10062883 3300025937 Bacteria 2288
395 Ga0207704_10079633 3300025938 Bacteria 2112
396 Ga0207704_10233029 3300025938 Bacteria 1370
397 Ga0207665_10001767 3300025939 Bacteria 14524
398 Ga0207691_10033344 3300025940 Bacteria 4794
399 Ga0207691_10045925 3300025940 Bacteria 4015
400 Ga0207691_10067959 3300025940 Bacteria 3221
401 Ga0207691_10113381 3300025940 Bacteria 2409
402 Ga0207691_10330840 3300025940 Bacteria 1305
403 Ga0207691_10615799 3300025940 Bacteria 918
404 Ga0207711_10000011 3300025941 Bacteria 518817
405 Ga0207711_10039367 3300025941 Bacteria 4021
406 Ga0207711_10053868 3300025941 Bacteria 3451
407 Ga0207711_10209920 3300025941 Bacteria 1778
408 Ga0207711_10328868 3300025941 Bacteria 1413
409 Ga0207689_10001308 3300025942 Bacteria 24004
410 Ga0207689_10034064 3300025942 Bacteria 4229
411 Ga0207689_10089213 3300025942 Bacteria 2533
412 Ga0207689_10184746 3300025942 Bacteria 1720
413 Ga0207667_10004473 3300025949 Bacteria 17112
414 Ga0207667_10726903 3300025949 Bacteria 994
415 Ga0207651_10003683 3300025960 Bacteria 7574
416 Ga0207651_10041582 3300025960 Bacteria 3052
417 Ga0207651_10140188 3300025960 Bacteria 1866
418 Ga0207712_10073277 3300025961 Bacteria 2469
419 Ga0207712_10225928 3300025961 Bacteria 1500
420 Ga0207712_10271732 3300025961 Bacteria 1379
421 Ga0207668_10062041 3300025972 Bacteria 2631
422 Ga0207668_10215387 3300025972 Unclassified 1538
423 Ga0207658_10068022 3300025986 Bacteria 2686
424 Ga0207658_10084191 3300025986 Bacteria 2446
425 Ga0207658_10286669 3300025986 Bacteria 1414
426 Ga0207658_10459261 3300025986 Bacteria 1129
427 Ga0207677_10298583 3300026023 Unclassified 1330
428 Ga0207703_10000470 3300026035 Bacteria 42191
429 Ga0207703_10832661 3300026035 Bacteria 882
430 Ga0207708_10039049 3300026075 Bacteria 3616
431 Ga0207708_10266152 3300026075 Bacteria 1385
432 Ga0207708_10466459 3300026075 Unclassified 1054
433 Ga0207702_10058778 3300026078 Bacteria 3273
434 Ga0207641_10001041 3300026088 Bacteria 28118
435 Ga0207641_10006512 3300026088 Bacteria 9831
436 Ga0207641_10008144 3300026088 Bacteria 8678
437 Ga0207641_10024153 3300026088 Bacteria 5010
438 Ga0207641_10467967 3300026088 Bacteria 1220
439 Ga0207641_10554674 3300026088 Bacteria 1121
440 Ga0207641_10725536 3300026088 Bacteria 980
441 Ga0207648_10001098 3300026089 Bacteria 30333
442 Ga0207648_10004247 3300026089 Bacteria 14803
443 Ga0207648_10196293 3300026089 Bacteria 1790
444 Ga0207648_10778166 3300026089 Bacteria 890
445 Ga0207676_10000609 3300026095 Bacteria 29375
446 Ga0207676_10020005 3300026095 Bacteria 4891
447 Ga0207676_10023135 3300026095 Bacteria 4579
448 Ga0207676_10097755 3300026095 Bacteria 2426
449 Ga0207676_10182757 3300026095 Bacteria 1838
450 Ga0207676_10281865 3300026095 Bacteria 1509
451 Ga0207674_10016097 3300026116 Bacteria 8192
452 Ga0207674_10054049 3300026116 Bacteria 4090
453 Ga0207674_11233114 3300026116 Bacteria 717
454 Ga0207675_100004806 3300026118 Bacteria 13012
455 Ga0207675_100118736 3300026118 Unclassified 2501
456 Ga0207675_100188790 3300026118 Bacteria 1976
457 Ga0207675_100262994 3300026118 Bacteria 1673
458 Ga0207675_100551473 3300026118 Bacteria 1152
459 Ga0207675_100662384 3300026118 Bacteria 1051
460 Ga0207683_10000597 3300026121 Bacteria 33268
461 Ga0207683_10024812 3300026121 Bacteria 5165
462 Ga0207683_10531298 3300026121 Bacteria 1087
463 Ga0207698_10000015 3300026142 Bacteria 207368
464 Ga0209969_1003758 3300027360 Bacteria 2104
465 Ga0209981_1026487 3300027378 Bacteria 842
466 Ga0209996_1004862 3300027395 Bacteria 1716
467 Ga0210000_1007296 3300027462 Bacteria 1617
468 Ga0209968_1026750 3300027526 Bacteria 954
469 Ga0209982_1006376 3300027552 Bacteria 1715
470 Ga0209588_1086658 3300027671 Bacteria 1010
471 Ga0209966_1003774 3300027695 Bacteria 2557
472 Ga0209813_10118384 3300027866 Bacteria 919
473 Ga0209974_10009220 3300027876 Bacteria 3349
474 Ga0207428_10110103 3300027907 Bacteria 2121
475 Ga0207428_10207971 3300027907 Bacteria 1471
476 Ga0268266_10058741 3300028379 Bacteria 3312
477 Ga0268266_10060714 3300028379 Bacteria 3259
478 Ga0268266_10094242 3300028379 Bacteria 2628
479 Ga0268266_10423475 3300028379 Bacteria 1262
480 Ga0268266_10654619 3300028379 Bacteria 1011
481 Ga0268265_10045824 3300028380 Bacteria 3266
482 Ga0268265_10079704 3300028380 Bacteria 2580
483 Ga0268265_11245790 3300028380 Bacteria 743
484 Ga0268264_10001168 3300028381 Bacteria 25525
485 Ga0268264_10021674 3300028381 Bacteria 5246
486 Ga0268264_10046403 3300028381 Bacteria 3608
487 Ga0268264_10358856 3300028381 Unclassified 1389
488 Ga0265332_10001631 3300031238 Bacteria 12270
489 Ga0265328_10140402 3300031239 Bacteria 906
490 Ga0265320_10205784 3300031240 Bacteria 878
491 Ga0265325_10019135 3300031241 Bacteria 3790
492 Ga0265329_10002664 3300031242 Bacteria 8040
493 Ga0265340_10190041 3300031247 Bacteria 926
494 Ga0265339_10038117 3300031249 Bacteria 2683
495 Ga0265339_10054872 3300031249 Bacteria 2163
496 Ga0265331_10000972 3300031250 Bacteria 22763
497 Ga0265327_10001720 3300031251 Bacteria 25945
498 Ga0265313_10000367 3300031595 Bacteria 48929
499 Ga0265314_10002346 3300031711 Bacteria 19541
500 Ga0307406_10546335 3300031901 Bacteria 947
501 Ga0307412_10000084 3300031911 Bacteria 90908
502 Ga0307409_100942419 3300031995 Bacteria 879
503 Ga0307414_10007545 3300032004 Bacteria 6114
504 Ga0307414_10013020 3300032004 Bacteria 4941
505 Ga0307414_10371062 3300032004 Bacteria 1234
506 Ga0307414_10878888 3300032004 Bacteria 821
507 Ga0307411_10142885 3300032005 Bacteria 1767
508 Ga0373941_0010854 3300035115 Bacteria 2340
509 Ga0373957_0134314 3300035120 Bacteria 1009
510 Ga0373942_0034947 3300035207 Bacteria 1347
511 Ga0373931_0050743 3300035691 Bacteria 2208
512 Ga0373937_0185814 3300036401 Bacteria 1952
513 Ga0373937_0190282 3300036401 Bacteria 1928
514 Ga0395900_0001825 3300037418 Bacteria 24311
515 Ga0395905_0985416 3300037471 Bacteria 746
516 Ga0436363_0274523 3300039450 Bacteria 915
517 Ga0436362_0660881 3300039453 Bacteria 2735
518 Ga0439433_0011951 3300041999 Bacteria 1902
519 Ga0439445_0049919 3300042004 Bacteria 1127
520 Ga0439450_010825 3300042008 Bacteria 1770
521 Ga0466969_0068440 3300044656 Bacteria 1710
522 Ga0466966_0081788 3300044684 Bacteria 2010
523 Ga0466961_0085858 3300044693 Bacteria 1989
524 Ga0466964_0044895 3300044706 Bacteria 1797
525 Ga0466971_0038182 3300044719 Bacteria 2154
526 Ga0466968_0099621 3300044735 Bacteria 1296
527 Ga0466957_0031538 3300044842 Bacteria 3168
528 Ga0466959_0045596 3300045049 Bacteria 3228
529 Ga0451576_0039530 3300045051 Bacteria 4992
530 Ga0495592_0000007 3300046454 Bacteria 180892
531 Ga0495603_0102801 3300046455 Bacteria 1668
532 Ga0495651_0316105 3300046462 Bacteria 1042
533 Ga0495662_0007164 3300046476 Bacteria 5524
534 Ga0495584_0356729 3300046491 Bacteria 743
535 Ga0495594_0302623 3300046499 Bacteria 911
536 Ga0495583_0082127 3300046506 Bacteria 1399
537 Ga0495618_0053006 3300046514 Bacteria 2565
538 Ga0495628_0032027 3300046516 Bacteria 4249
539 Ga0495630_0002686 3300046517 Bacteria 12345
540 Ga0495630_0154664 3300046517 Bacteria 1746
541 Ga0495666_0038496 3300046526 Bacteria 2325
542 Ga0495652_0184762 3300046529 Bacteria 1596
543 Ga0495640_0105875 3300046533 Bacteria 1842
544 Ga0495586_0001436 3300046535 Bacteria 13162
545 Ga0495656_0018601 3300046615 Bacteria 2671
546 Ga0495599_0001504 3300046678 Bacteria 13418
547 Ga0495623_0230849 3300046679 Bacteria 1050
548 Ga0495669_0038812 3300046684 Bacteria 2109
549 Ga0495624_0084818 3300046690 Bacteria 1957
550 Ga0495670_0255915 3300046691 Bacteria 934
551 Ga0495604_0132875 3300047317 Bacteria 1787
552 Ga0495636_0009050 3300047318 Bacteria 3915
553 Ga0496103_0258096 3300048906 Bacteria 1121
554 Ga0496103_0329590 3300048906 Bacteria 982
555 Ga0496104_0013290 3300048907 Bacteria 7422
556 Ga0496104_0634176 3300048907 Bacteria 978
557 Ga0496105_0010192 3300048908 Bacteria 7386
558 Ga0496105_0552482 3300048908 Bacteria 898
559 Ga0496107_0281914 3300048910 Bacteria 1237
560 Ga0496108_0000005 3300048911 Bacteria 535059
561 Ga0496108_0169425 3300048911 Bacteria 1889
562 Ga0496108_0396466 3300048911 Bacteria 1205
563 Ga0496109_0000002 3300048912 Bacteria 443393
564 Ga0496109_0014019 3300048912 Bacteria 6968
565 Ga0496110_0623424 3300048913 Bacteria 977
566 Ga0496110_0674231 3300048913 Bacteria 934
567 Ga0496111_0097265 3300048914 Bacteria 2161
568 Ga0496112_0208667 3300048915 Bacteria 1911
569 Ga0496112_0683917 3300048915 Bacteria 954
570 Ga0496114_0261223 3300048917 Bacteria 1525
571 Ga0501031_0002036 3300049568 Bacteria 12729
572 Ga0501032_0012383 3300049569 Bacteria 6097
573 Ga0501033_0004584 3300049570 Bacteria 11071
574 Ga0501033_0250732 3300049570 Bacteria 1255
575 Ga0501034_0005792 3300049571 Bacteria 13441
576 Ga0501034_0041105 3300049571 Bacteria 4678
577 Ga0501036_0005255 3300049572 Bacteria 10475
578 Ga0501036_0007868 3300049572 Bacteria 8718
579 Ga0501036_0172621 3300049572 Bacteria 1821
580 Ga0501037_0023566 3300049573 Bacteria 4551
581 Ga0501037_0148346 3300049573 Bacteria 1677
582 Ga0501038_0003383 3300049574 Bacteria 14871
583 Ga0501039_0059077 3300049575 Bacteria 2970
584 Ga0501040_0058576 3300049576 Bacteria 2645
585 Ga0501041_0007372 3300049577 Bacteria 6458
586 Ga0501042_0036907 3300049578 Bacteria 3467
587 Ga0501042_0401170 3300049578 Bacteria 993
588 Ga0501043_0083284 3300049579 Bacteria 2515
589 Ga0501043_0171499 3300049579 Bacteria 1692
590 Ga0501047_0004800 3300049581 Bacteria 12722
591 Ga0501048_0159320 3300049582 Bacteria 1597
592 Ga0501067_0073097 3300049583 Bacteria 1900
593 Ga0501068_0021587 3300049584 Bacteria 3760
594 Ga0501068_0246236 3300049584 Bacteria 1138
595 Ga0501070_0004048 3300049586 Bacteria 12595
596 Ga0501071_0006328 3300049587 Bacteria 7680
597 Ga0501072_0073852 3300049588 Bacteria 2696
598 Ga0501072_0076507 3300049588 Bacteria 2648
599 Ga0501074_0619555 3300049590 Bacteria 765
600 Ga0501075_0566242 3300049591 Bacteria 867
601 Ga0501076_0031457 3300049592 Bacteria 4139
602 Ga0501076_0042445 3300049592 Bacteria 3580
603 Ga0501076_0204919 3300049592 Bacteria 1611
604 Ga0501077_0017812 3300049593 Bacteria 4488
605 Ga0501079_0006518 3300049741 Bacteria 8770
606 Ga0501079_0758004 3300049741 Bacteria 764
607 Ga0501081_0125829 3300049743 Bacteria 1828
608 Ga0501081_0246573 3300049743 Bacteria 1303
609 Ga0501083_0323197 3300049744 Bacteria 1003
610 Ga0501083_0402568 3300049744 Bacteria 890
611 Ga0501241_005494 3300049758 Bacteria 2361
612 Ga0501035_0007782 3300049822 Bacteria 10012
613 Ga0501045_0053512 3300049824 Bacteria 2950
614 nmdc:mga00v17_249462_c1 3300050491 Bacteria 1151
615 nmdc:mga0k408_280071_c1 3300050493 Bacteria 995
616 nmdc:mga06z11_12011_c1 3300050494 Bacteria 3754
617 nmdc:mga06z11_34465_c1 3300050494 Bacteria 1150
618 nmdc:mga04h51_112268_c1 3300050495 Bacteria 1006
619 nmdc:mga05p37_101521_c1 3300050507 Bacteria 3542
620 nmdc:mga05p37_115691_c1 3300050507 Bacteria 3296
621 nmdc:mga05p37_1566_c1 3300050507 Bacteria 26569
622 nmdc:mga05p37_189483_c2 3300050507 Bacteria 1909
623 nmdc:mga05p37_216758_c1 3300050507 Bacteria 2311
624 nmdc:mga05p37_314381_c1 3300050507 Bacteria 1856
625 nmdc:mga05p37_352777_c1 3300050507 Bacteria 1732
626 nmdc:mga05p37_512767_c1 3300050507 Bacteria 1373
627 nmdc:mga05p37_555612_c1 3300050507 Bacteria 1306
628 nmdc:mga05p37_566662_c1 3300050507 Bacteria 1289
629 nmdc:mga05p37_87419_c1 3300050507 Bacteria 3841
630 nmdc:mga09592_297430_c1 3300050508 Bacteria 1399
631 nmdc:mga09592_465_c1 3300050508 Bacteria 30281
632 nmdc:mga0qj67_212152_c1 3300050509 Bacteria 1572
633 nmdc:mga0qj67_311310_c1 3300050509 Bacteria 1275
634 nmdc:mga0qj67_31516_c1 3300050509 Bacteria 4130
635 nmdc:mga0qj67_448806_c1 3300050509 Bacteria 1039
636 nmdc:mga06r32_140111_c1 3300050510 Bacteria 2394
637 nmdc:mga06r32_209097_c1 3300050510 Bacteria 1939
638 nmdc:mga06r32_231220_c1 3300050510 Bacteria 1837
639 nmdc:mga06r32_232604_c1 3300050510 Bacteria 1831
640 nmdc:mga06r32_437652_c1 3300050510 Bacteria 1288
641 nmdc:mga08y16_104222_c1 3300050511 Bacteria 2953
642 nmdc:mga08y16_130619_c1 3300050511 Bacteria 2612
643 nmdc:mga08y16_220229_c1 3300050511 Bacteria 1965
644 nmdc:mga08y16_316607_c1 3300050511 Bacteria 1607
645 nmdc:mga0n895_108063_c1 3300050512 Bacteria 2796
646 nmdc:mga0n895_1172732_c1 3300050512 Bacteria 743
647 nmdc:mga0n895_174164_c1 3300050512 Bacteria 2183
648 nmdc:mga0n895_32780_c1 3300050512 Bacteria 4988
649 nmdc:mga0n895_34597_c1 3300050512 Bacteria 4865
650 nmdc:mga0n895_47148_c1 3300050512 Bacteria 4213
651 nmdc:mga0n895_47472_c1 3300050512 Bacteria 4198
652 nmdc:mga0n895_497453_c1 3300050512 Bacteria 1228
653 nmdc:mga0n895_74139_c1 3300050512 Bacteria 3380
654 nmdc:mga0n895_802989_c1 3300050512 Bacteria 931
655 nmdc:mga0n895_88855_c1 3300050512 Bacteria 3090
656 nmdc:mga0rr50_27949_c1 3300050513 Bacteria 3958
657 nmdc:mga0rr50_351017_c1 3300050513 Bacteria 1241
658 nmdc:mga0rr50_6374_c1 3300050513 Bacteria 7174
659 nmdc:mga08x19_15022_c1 3300050514 Bacteria 4702
660 nmdc:mga08x19_280436_c1 3300050514 Bacteria 1155
661 nmdc:mga0a205_12985_c1 3300050515 Bacteria 7732
662 nmdc:mga0a205_29970_c1 3300050515 Bacteria 5208
663 nmdc:mga0a205_352697_c1 3300050515 Bacteria 1338
664 nmdc:mga0a205_3800_c1 3300050515 Bacteria 12405
665 nmdc:mga0a205_607146_c1 3300050515 Bacteria 947
666 Ga0500651_0007451 3300053093 Bacteria 6392
667 Ga0500611_056231 3300053727 Bacteria 918
668 Ga0500645_026192 3300053730 Bacteria 1774
669 Ga0501084_0057087 3300054114 Bacteria 3267
670 Ga0590071_017845 3300059421 Bacteria 1668
671 Ga0590077_005668 3300059426 Bacteria 2553
672 Ga0501082_0727405 3300060353 Bacteria 869
673 Ga0466962_0017548 3300061719 Bacteria 3445
674 Ga0530510_0007826 3300061734 Bacteria 7452

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026088 Ga0207641_10001041 Ga0207641_1000104123 176
2 3300049741 Ga0501079_0758004 Ga0501079_0758004_187_750 178
3 3300047317 Ga0495604_0132875 Ga0495604_0132875_18_599 184
4 iso_pu_bacteria 2501025502 2501084461 206
5 iso_pu_bacteria 2510917013 2511088463 206
6 3300005467 Ga0070706_100119084 Ga0070706_1001190842 207
7 3300005536 Ga0070697_100413280 Ga0070697_1004132801 207
8 3300006028 Ga0070717_10337512 Ga0070717_103375121 207
9 iso_pu_bacteria 2738541284 2738762799 207
10 iso_pu_bacteria 2738543023 2739300479 207
11 iso_pu_bacteria 2775506987 2776614362 207
12 iso_pu_bacteria 2852627209 2852630259 207
13 iso_pu_bacteria 2919186247 2919190026 207
14 iso_pu_bacteria 2939664404 2939668307 207
15 3300005842 Ga0068858_100836970 Ga0068858_1008369701 208
16 3300005937 Ga0081455_10114844 Ga0081455_101148442 208
17 3300006844 Ga0075428_100138309 Ga0075428_1001383091 208
18 3300006847 Ga0075431_100036382 Ga0075431_1000363824 208
19 3300028380 Ga0268265_11245790 Ga0268265_112457901 208
20 3300005355 Ga0070671_100845459 Ga0070671_1008454591 209
21 3300005471 Ga0070698_100161258 Ga0070698_1001612582 209
22 3300006358 Ga0068871_100311150 Ga0068871_1003111502 209
23 3300006881 Ga0068865_100264030 Ga0068865_1002640302 209
24 3300013308 Ga0157375_10267260 Ga0157375_102672602 209
25 3300025916 Ga0207663_10123058 Ga0207663_101230583 209
26 3300025927 Ga0207687_10601370 Ga0207687_106013701 209
27 3300025938 Ga0207704_10233029 Ga0207704_102330292 209
28 3300026088 Ga0207641_10554674 Ga0207641_105546741 209
29 3300048908 Ga0496105_0552482 Ga0496105_0552482_121_750 209
30 3300048910 Ga0496107_0281914 Ga0496107_0281914_334_963 209
31 3300048913 Ga0496110_0623424 Ga0496110_0623424_144_773 209
32 3300049588 Ga0501072_0073852 Ga0501072_0073852_970_1626 209
33 3300050507 nmdc:mga05p37_512767_c1 nmdc:mga05p37_512767_c1_546_1193 209
34 3300050507 nmdc:mga05p37_566662_c1 nmdc:mga05p37_566662_c1_461_1090 209
35 3300050510 nmdc:mga06r32_437652_c1 nmdc:mga06r32_437652_c1_58_705 209
36 3300050511 nmdc:mga08y16_130619_c1 nmdc:mga08y16_130619_c1_26_673 209
37 3300050512 nmdc:mga0n895_74139_c1 nmdc:mga0n895_74139_c1_1805_2467 209
38 3300060353 Ga0501082_0727405 Ga0501082_0727405_189_845 209
39 3300003773 Ga0055537_1016852 Ga0055537_10168522 210
40 3300005289 Ga0065704_10408407 Ga0065704_104084071 210
41 3300005328 Ga0070676_10019655 Ga0070676_100196552 210
42 3300005328 Ga0070676_10107161 Ga0070676_101071612 210
43 3300005330 Ga0070690_100164642 Ga0070690_1001646422 210
44 3300005330 Ga0070690_100273480 Ga0070690_1002734801 210
45 3300005331 Ga0070670_100001819 Ga0070670_1000018194 210
46 3300005333 Ga0070677_10276002 Ga0070677_102760021 210
47 3300005334 Ga0068869_100221957 Ga0068869_1002219571 210
48 3300005335 Ga0070666_10023538 Ga0070666_100235382 210
49 3300005335 Ga0070666_10123910 Ga0070666_101239102 210
50 3300005336 Ga0070680_100000283 Ga0070680_10000028311 210
51 3300005340 Ga0070689_100050953 Ga0070689_1000509532 210
52 3300005341 Ga0070691_10144032 Ga0070691_101440322 210
53 3300005343 Ga0070687_100017499 Ga0070687_1000174992 210
54 3300005343 Ga0070687_100051057 Ga0070687_1000510572 210
55 3300005347 Ga0070668_100002408 Ga0070668_10000240812 210
56 3300005347 Ga0070668_100028668 Ga0070668_1000286682 210
57 3300005353 Ga0070669_100022773 Ga0070669_1000227731 210
58 3300005353 Ga0070669_100089021 Ga0070669_1000890212 210
59 3300005353 Ga0070669_100115773 Ga0070669_1001157732 210
60 3300005353 Ga0070669_100205485 Ga0070669_1002054852 210
61 3300005353 Ga0070669_100288406 Ga0070669_1002884062 210
62 3300005354 Ga0070675_100010686 Ga0070675_1000106861 210
63 3300005354 Ga0070675_100216508 Ga0070675_1002165082 210
64 3300005354 Ga0070675_100235633 Ga0070675_1002356331 210
65 3300005354 Ga0070675_100317945 Ga0070675_1003179452 210
66 3300005355 Ga0070671_100106789 Ga0070671_1001067892 210
67 3300005355 Ga0070671_100132914 Ga0070671_1001329142 210
68 3300005356 Ga0070674_100083171 Ga0070674_1000831712 210
69 3300005364 Ga0070673_100029652 Ga0070673_1000296523 210
70 3300005364 Ga0070673_100045367 Ga0070673_1000453672 210
71 3300005364 Ga0070673_100101569 Ga0070673_1001015692 210
72 3300005364 Ga0070673_100182617 Ga0070673_1001826171 210
73 3300005364 Ga0070673_100286821 Ga0070673_1002868212 210
74 3300005364 Ga0070673_100569468 Ga0070673_1005694682 210
75 3300005365 Ga0070688_100208176 Ga0070688_1002081762 210
76 3300005367 Ga0070667_100001213 Ga0070667_1000012135 210
77 3300005367 Ga0070667_100244627 Ga0070667_1002446272 210
78 3300005406 Ga0070703_10042781 Ga0070703_100427811 210
79 3300005434 Ga0070709_10161693 Ga0070709_101616932 210
80 3300005434 Ga0070709_10175533 Ga0070709_101755332 210
81 3300005436 Ga0070713_100189035 Ga0070713_1001890352 210
82 3300005440 Ga0070705_100074896 Ga0070705_1000748962 210
83 3300005440 Ga0070705_100307002 Ga0070705_1003070021 210
84 3300005441 Ga0070700_100067109 Ga0070700_1000671092 210
85 3300005444 Ga0070694_100279790 Ga0070694_1002797901 210
86 3300005445 Ga0070708_100014071 Ga0070708_1000140713 210
87 3300005445 Ga0070708_100020712 Ga0070708_10002071210 210
88 3300005445 Ga0070708_100024505 Ga0070708_1000245052 210
89 3300005445 Ga0070708_100037390 Ga0070708_1000373903 210
90 3300005445 Ga0070708_100217129 Ga0070708_1002171292 210
91 3300005445 Ga0070708_100764229 Ga0070708_1007642291 210
92 3300005456 Ga0070678_101002772 Ga0070678_1010027721 210
93 3300005457 Ga0070662_100020338 Ga0070662_1000203382 210
94 3300005458 Ga0070681_10064166 Ga0070681_100641662 210
95 3300005459 Ga0068867_100002403 Ga0068867_1000024032 210
96 3300005459 Ga0068867_100081084 Ga0068867_1000810842 210
97 3300005459 Ga0068867_100132955 Ga0068867_1001329551 210
98 3300005467 Ga0070706_100001637 Ga0070706_10000163720 210
99 3300005467 Ga0070706_100018923 Ga0070706_1000189238 210
100 3300005467 Ga0070706_100032060 Ga0070706_1000320603 210
101 3300005467 Ga0070706_100057312 Ga0070706_1000573122 210
102 3300005467 Ga0070706_100074118 Ga0070706_1000741184 210
103 3300005467 Ga0070706_100125586 Ga0070706_1001255862 210
104 3300005467 Ga0070706_100340799 Ga0070706_1003407993 210
105 3300005468 Ga0070707_100027344 Ga0070707_1000273442 210
106 3300005468 Ga0070707_100048385 Ga0070707_1000483852 210
107 3300005471 Ga0070698_100030522 Ga0070698_1000305223 210
108 3300005471 Ga0070698_100049404 Ga0070698_1000494043 210
109 3300005471 Ga0070698_100157695 Ga0070698_1001576952 210
110 3300005471 Ga0070698_100159123 Ga0070698_1001591231 210
111 3300005471 Ga0070698_100653532 Ga0070698_1006535322 210
112 3300005518 Ga0070699_100004353 Ga0070699_1000043532 210
113 3300005518 Ga0070699_100018538 Ga0070699_1000185384 210
114 3300005518 Ga0070699_100109027 Ga0070699_1001090272 210
115 3300005530 Ga0070679_100031849 Ga0070679_1000318492 210
116 3300005536 Ga0070697_100013647 Ga0070697_1000136472 210
117 3300005536 Ga0070697_100242098 Ga0070697_1002420982 210
118 3300005536 Ga0070697_100250470 Ga0070697_1002504702 210
119 3300005539 Ga0068853_100712376 Ga0068853_1007123761 210
120 3300005543 Ga0070672_100000358 Ga0070672_1000003584 210
121 3300005543 Ga0070672_100322934 Ga0070672_1003229342 210
122 3300005543 Ga0070672_100419835 Ga0070672_1004198352 210
123 3300005544 Ga0070686_100362255 Ga0070686_1003622551 210
124 3300005545 Ga0070695_100001672 Ga0070695_1000016722 210
125 3300005545 Ga0070695_100361909 Ga0070695_1003619092 210
126 3300005546 Ga0070696_100037797 Ga0070696_1000377973 210
127 3300005546 Ga0070696_100116227 Ga0070696_1001162271 210
128 3300005546 Ga0070696_100311418 Ga0070696_1003114182 210
129 3300005547 Ga0070693_100235768 Ga0070693_1002357681 210
130 3300005548 Ga0070665_100365831 Ga0070665_1003658312 210
131 3300005548 Ga0070665_100718737 Ga0070665_1007187371 210
132 3300005549 Ga0070704_100024905 Ga0070704_1000249053 210
133 3300005549 Ga0070704_100287041 Ga0070704_1002870412 210
134 3300005563 Ga0068855_100014781 Ga0068855_1000147815 210
135 3300005564 Ga0070664_100060259 Ga0070664_1000602593 210
136 3300005564 Ga0070664_100378095 Ga0070664_1003780952 210
137 3300005577 Ga0068857_100002053 Ga0068857_10000205310 210
138 3300005617 Ga0068859_100004248 Ga0068859_10000424814 210
139 3300005617 Ga0068859_100098657 Ga0068859_1000986572 210
140 3300005617 Ga0068859_100336199 Ga0068859_1003361992 210
141 3300005617 Ga0068859_100640172 Ga0068859_1006401722 210
142 3300005617 Ga0068859_100764527 Ga0068859_1007645272 210
143 3300005618 Ga0068864_100000864 Ga0068864_10000086416 210
144 3300005618 Ga0068864_100002192 Ga0068864_1000021922 210
145 3300005618 Ga0068864_100046442 Ga0068864_1000464422 210
146 3300005618 Ga0068864_100228502 Ga0068864_1002285021 210
147 3300005618 Ga0068864_100230522 Ga0068864_1002305222 210
148 3300005618 Ga0068864_100286243 Ga0068864_1002862432 210
149 3300005719 Ga0068861_100001505 Ga0068861_10000150513 210
150 3300005719 Ga0068861_100054706 Ga0068861_1000547064 210
151 3300005840 Ga0068870_10019068 Ga0068870_100190683 210
152 3300005840 Ga0068870_10110510 Ga0068870_101105101 210
153 3300005840 Ga0068870_10178857 Ga0068870_101788572 210
154 3300005841 Ga0068863_100007858 Ga0068863_1000078588 210
155 3300005841 Ga0068863_100018650 Ga0068863_1000186504 210
156 3300005841 Ga0068863_100025648 Ga0068863_1000256486 210
157 3300005841 Ga0068863_100182004 Ga0068863_1001820042 210
158 3300005841 Ga0068863_100273367 Ga0068863_1002733672 210
159 3300005841 Ga0068863_100450198 Ga0068863_1004501982 210
160 3300005841 Ga0068863_100668751 Ga0068863_1006687512 210
161 3300005842 Ga0068858_100003730 Ga0068858_10000373014 210
162 3300005842 Ga0068858_101245948 Ga0068858_1012459481 210
163 3300005843 Ga0068860_100003546 Ga0068860_1000035462 210
164 3300005843 Ga0068860_100079628 Ga0068860_1000796283 210
165 3300005843 Ga0068860_100440198 Ga0068860_1004401981 210
166 3300005844 Ga0068862_100011184 Ga0068862_1000111843 210
167 3300005844 Ga0068862_100060778 Ga0068862_1000607782 210
168 3300005844 Ga0068862_100160392 Ga0068862_1001603921 210
169 3300006163 Ga0070715_10268150 Ga0070715_102681501 210
170 3300006163 Ga0070715_10355242 Ga0070715_103552421 210
171 3300006173 Ga0070716_100003300 Ga0070716_1000033004 210
172 3300006173 Ga0070716_100311847 Ga0070716_1003118471 210
173 3300006175 Ga0070712_100006093 Ga0070712_1000060936 210
174 3300006175 Ga0070712_100013372 Ga0070712_1000133725 210
175 3300006175 Ga0070712_100297080 Ga0070712_1002970802 210
176 3300006178 Ga0075367_10012918 Ga0075367_100129183 210
177 3300006178 Ga0075367_10238631 Ga0075367_102386312 210
178 3300006237 Ga0097621_100064774 Ga0097621_1000647742 210
179 3300006358 Ga0068871_100033269 Ga0068871_1000332692 210
180 3300006358 Ga0068871_100096764 Ga0068871_1000967642 210
181 3300006844 Ga0075428_100005739 Ga0075428_1000057393 210
182 3300006844 Ga0075428_100008340 Ga0075428_10000834011 210
183 3300006844 Ga0075428_100025808 Ga0075428_1000258084 210
184 3300006844 Ga0075428_100060939 Ga0075428_1000609393 210
185 3300006844 Ga0075428_100095625 Ga0075428_1000956255 210
186 3300006844 Ga0075428_100557520 Ga0075428_1005575202 210
187 3300006844 Ga0075428_100672139 Ga0075428_1006721392 210
188 3300006844 Ga0075428_101207724 Ga0075428_1012077241 210
189 3300006846 Ga0075430_100018379 Ga0075430_1000183796 210
190 3300006846 Ga0075430_100086442 Ga0075430_1000864421 210
191 3300006847 Ga0075431_100069065 Ga0075431_1000690653 210
192 3300006847 Ga0075431_100135129 Ga0075431_1001351294 210
193 3300006847 Ga0075431_100306138 Ga0075431_1003061382 210
194 3300006852 Ga0075433_10007413 Ga0075433_100074134 210
195 3300006852 Ga0075433_10015885 Ga0075433_100158853 210
196 3300006852 Ga0075433_10026125 Ga0075433_100261252 210
197 3300006852 Ga0075433_10054540 Ga0075433_100545402 210
198 3300006852 Ga0075433_10383538 Ga0075433_103835382 210
199 3300006852 Ga0075433_10522671 Ga0075433_105226711 210
200 3300006852 Ga0075433_10709229 Ga0075433_107092291 210
201 3300006871 Ga0075434_100002383 Ga0075434_1000023833 210
202 3300006871 Ga0075434_100037267 Ga0075434_1000372672 210
203 3300006871 Ga0075434_100068506 Ga0075434_1000685062 210
204 3300006871 Ga0075434_100209541 Ga0075434_1002095414 210
205 3300006871 Ga0075434_100475678 Ga0075434_1004756781 210
206 3300006871 Ga0075434_100992713 Ga0075434_1009927131 210
207 3300006871 Ga0075434_101432527 Ga0075434_1014325271 210
208 3300006880 Ga0075429_100000438 Ga0075429_10000043814 210
209 3300006880 Ga0075429_100020642 Ga0075429_1000206425 210
210 3300006880 Ga0075429_100480429 Ga0075429_1004804292 210
211 3300006881 Ga0068865_100036155 Ga0068865_1000361554 210
212 3300006881 Ga0068865_100088799 Ga0068865_1000887992 210
213 3300006914 Ga0075436_100005505 Ga0075436_1000055056 210
214 3300006931 Ga0097620_100004248 Ga0097620_1000042482 210
215 3300006931 Ga0097620_100098658 Ga0097620_1000986582 210
216 3300006931 Ga0097620_100336204 Ga0097620_1003362042 210
217 3300006931 Ga0097620_100640176 Ga0097620_1006401762 210
218 3300006931 Ga0097620_100764480 Ga0097620_1007644801 210
219 3300007076 Ga0075435_100008699 Ga0075435_1000086993 210
220 3300007076 Ga0075435_100034312 Ga0075435_1000343124 210
221 3300007076 Ga0075435_100158037 Ga0075435_1001580374 210
222 3300007076 Ga0075435_100417383 Ga0075435_1004173832 210
223 3300007265 Ga0099794_10002165 Ga0099794_100021651 210
224 3300007265 Ga0099794_10006118 Ga0099794_100061185 210
225 3300007265 Ga0099794_10010440 Ga0099794_100104402 210
226 3300007265 Ga0099794_10016223 Ga0099794_100162233 210
227 3300007265 Ga0099794_10098468 Ga0099794_100984682 210
228 3300007265 Ga0099794_10195594 Ga0099794_101955942 210
229 3300009093 Ga0105240_10004543 Ga0105240_100045439 210
230 3300009094 Ga0111539_10029130 Ga0111539_100291304 210
231 3300009094 Ga0111539_10103699 Ga0111539_101036992 210
232 3300009094 Ga0111539_10112374 Ga0111539_101123742 210
233 3300009094 Ga0111539_11071655 Ga0111539_110716552 210
234 3300009098 Ga0105245_10251659 Ga0105245_102516591 210
235 3300009098 Ga0105245_10254647 Ga0105245_102546472 210
236 3300009147 Ga0114129_10015362 Ga0114129_1001536213 210
237 3300009147 Ga0114129_10015953 Ga0114129_1001595311 210
238 3300009147 Ga0114129_10060511 Ga0114129_100605112 210
239 3300009147 Ga0114129_10063329 Ga0114129_100633293 210
240 3300009147 Ga0114129_10076087 Ga0114129_100760872 210
241 3300009147 Ga0114129_10171714 Ga0114129_101717143 210
242 3300009147 Ga0114129_10175972 Ga0114129_101759721 210
243 3300009177 Ga0105248_10020739 Ga0105248_100207392 210
244 3300009177 Ga0105248_10029407 Ga0105248_100294072 210
245 3300009177 Ga0105248_10068457 Ga0105248_100684576 210
246 3300009177 Ga0105248_10092714 Ga0105248_100927142 210
247 3300009545 Ga0105237_10021633 Ga0105237_100216334 210
248 3300009545 Ga0105237_10407815 Ga0105237_104078152 210
249 3300009551 Ga0105238_10007625 Ga0105238_100076259 210
250 3300009551 Ga0105238_10918041 Ga0105238_109180411 210
251 3300009553 Ga0105249_10028766 Ga0105249_100287662 210
252 3300009553 Ga0105249_10976181 Ga0105249_109761811 210
253 3300010375 Ga0105239_10632768 Ga0105239_106327682 210
254 3300011119 Ga0105246_10153582 Ga0105246_101535822 210
255 3300013102 Ga0157371_10036458 Ga0157371_100364584 210
256 3300013104 Ga0157370_10001068 Ga0157370_100010689 210
257 3300013105 Ga0157369_10008944 Ga0157369_100089444 210
258 3300013297 Ga0157378_10067430 Ga0157378_100674302 210
259 3300013297 Ga0157378_10106520 Ga0157378_101065203 210
260 3300013297 Ga0157378_10427688 Ga0157378_104276881 210
261 3300013306 Ga0163162_10055856 Ga0163162_100558562 210
262 3300013306 Ga0163162_10149599 Ga0163162_101495992 210
263 3300013306 Ga0163162_10415390 Ga0163162_104153902 210
264 3300013306 Ga0163162_10892817 Ga0163162_108928171 210
265 3300013306 Ga0163162_10944790 Ga0163162_109447901 210
266 3300013308 Ga0157375_10192027 Ga0157375_101920272 210
267 3300014325 Ga0163163_10002652 Ga0163163_100026522 210
268 3300014325 Ga0163163_10032956 Ga0163163_100329562 210
269 3300014325 Ga0163163_10119855 Ga0163163_101198552 210
270 3300014326 Ga0157380_10018017 Ga0157380_100180176 210
271 3300014326 Ga0157380_10025210 Ga0157380_100252102 210
272 3300014326 Ga0157380_10590181 Ga0157380_105901812 210
273 3300014326 Ga0157380_10715548 Ga0157380_107155482 210
274 3300014968 Ga0157379_10001336 Ga0157379_1000133619 210
275 3300014968 Ga0157379_10260647 Ga0157379_102606472 210
276 3300014968 Ga0157379_11084641 Ga0157379_110846411 210
277 3300014969 Ga0157376_10003314 Ga0157376_100033144 210
278 3300014969 Ga0157376_10208027 Ga0157376_102080272 210
279 3300017792 Ga0163161_10008265 Ga0163161_100082652 210
280 3300017792 Ga0163161_10279279 Ga0163161_102792792 210
281 3300020070 Ga0206356_11734636 Ga0206356_117346362 210
282 3300022467 Ga0224712_10115045 Ga0224712_101150452 210
283 3300025263 Ga0209565_1002480 Ga0209565_10024803 210
284 3300025291 Ga0209675_1003829 Ga0209675_10038291 210
285 3300025299 Ga0209256_1002745 Ga0209256_10027453 210
286 3300025315 Ga0207697_10087319 Ga0207697_100873192 210
287 3300025893 Ga0207682_10014935 Ga0207682_100149352 210
288 3300025900 Ga0207710_10008230 Ga0207710_100082306 210
289 3300025903 Ga0207680_10184130 Ga0207680_101841302 210
290 3300025903 Ga0207680_10520816 Ga0207680_105208161 210
291 3300025905 Ga0207685_10260158 Ga0207685_102601581 210
292 3300025905 Ga0207685_10312612 Ga0207685_103126121 210
293 3300025906 Ga0207699_10087986 Ga0207699_100879862 210
294 3300025906 Ga0207699_10368439 Ga0207699_103684392 210
295 3300025907 Ga0207645_10045197 Ga0207645_100451973 210
296 3300025907 Ga0207645_10142144 Ga0207645_101421442 210
297 3300025908 Ga0207643_10005744 Ga0207643_100057445 210
298 3300025908 Ga0207643_10014893 Ga0207643_100148933 210
299 3300025908 Ga0207643_10034750 Ga0207643_100347502 210
300 3300025908 Ga0207643_10329513 Ga0207643_103295131 210
301 3300025910 Ga0207684_10005802 Ga0207684_100058028 210
302 3300025910 Ga0207684_10016063 Ga0207684_100160632 210
303 3300025910 Ga0207684_10016535 Ga0207684_100165353 210
304 3300025910 Ga0207684_10027507 Ga0207684_100275072 210
305 3300025910 Ga0207684_10073879 Ga0207684_100738791 210
306 3300025910 Ga0207684_10113194 Ga0207684_101131941 210
307 3300025910 Ga0207684_10160917 Ga0207684_101609172 210
308 3300025910 Ga0207684_10200085 Ga0207684_102000852 210
309 3300025912 Ga0207707_10000444 Ga0207707_100004449 210
310 3300025913 Ga0207695_10003323 Ga0207695_1000332311 210
311 3300025914 Ga0207671_10328235 Ga0207671_103282351 210
312 3300025914 Ga0207671_10547557 Ga0207671_105475571 210
313 3300025915 Ga0207693_10010601 Ga0207693_100106016 210
314 3300025915 Ga0207693_10014404 Ga0207693_100144047 210
315 3300025915 Ga0207693_10429199 Ga0207693_104291991 210
316 3300025917 Ga0207660_10012178 Ga0207660_100121784 210
317 3300025917 Ga0207660_10061905 Ga0207660_100619052 210
318 3300025918 Ga0207662_10090633 Ga0207662_100906334 210
319 3300025921 Ga0207652_10009506 Ga0207652_100095064 210
320 3300025922 Ga0207646_10035728 Ga0207646_100357283 210
321 3300025922 Ga0207646_10038200 Ga0207646_100382002 210
322 3300025922 Ga0207646_10044568 Ga0207646_100445682 210
323 3300025922 Ga0207646_10481291 Ga0207646_104812912 210
324 3300025923 Ga0207681_10023410 Ga0207681_100234101 210
325 3300025923 Ga0207681_10108116 Ga0207681_101081162 210
326 3300025923 Ga0207681_10248427 Ga0207681_102484271 210
327 3300025924 Ga0207694_10009800 Ga0207694_100098005 210
328 3300025925 Ga0207650_10003440 Ga0207650_1000344012 210
329 3300025925 Ga0207650_10008000 Ga0207650_100080005 210
330 3300025925 Ga0207650_10032114 Ga0207650_100321142 210
331 3300025925 Ga0207650_10451302 Ga0207650_104513021 210
332 3300025926 Ga0207659_10363272 Ga0207659_103632722 210
333 3300025928 Ga0207700_10465573 Ga0207700_104655731 210
334 3300025931 Ga0207644_10133545 Ga0207644_101335452 210
335 3300025931 Ga0207644_10207880 Ga0207644_102078802 210
336 3300025931 Ga0207644_10456361 Ga0207644_104563612 210
337 3300025933 Ga0207706_10022081 Ga0207706_100220815 210
338 3300025934 Ga0207686_10134567 Ga0207686_101345671 210
339 3300025936 Ga0207670_10095529 Ga0207670_100955293 210
340 3300025936 Ga0207670_10133878 Ga0207670_101338781 210
341 3300025936 Ga0207670_10219107 Ga0207670_102191072 210
342 3300025936 Ga0207670_10341654 Ga0207670_103416542 210
343 3300025938 Ga0207704_10079633 Ga0207704_100796332 210
344 3300025939 Ga0207665_10001767 Ga0207665_100017674 210
345 3300025940 Ga0207691_10033344 Ga0207691_100333443 210
346 3300025940 Ga0207691_10045925 Ga0207691_100459252 210
347 3300025940 Ga0207691_10067959 Ga0207691_100679593 210
348 3300025940 Ga0207691_10330840 Ga0207691_103308402 210
349 3300025940 Ga0207691_10615799 Ga0207691_106157991 210
350 3300025941 Ga0207711_10039367 Ga0207711_100393674 210
351 3300025941 Ga0207711_10053868 Ga0207711_100538682 210
352 3300025941 Ga0207711_10209920 Ga0207711_102099202 210
353 3300025941 Ga0207711_10328868 Ga0207711_103288681 210
354 3300025942 Ga0207689_10001308 Ga0207689_1000130814 210
355 3300025942 Ga0207689_10089213 Ga0207689_100892133 210
356 3300025942 Ga0207689_10184746 Ga0207689_101847462 210
357 3300025949 Ga0207667_10004473 Ga0207667_100044733 210
358 3300025949 Ga0207667_10726903 Ga0207667_107269032 210
359 3300025960 Ga0207651_10003683 Ga0207651_100036834 210
360 3300025960 Ga0207651_10041582 Ga0207651_100415823 210
361 3300025960 Ga0207651_10140188 Ga0207651_101401883 210
362 3300025961 Ga0207712_10073277 Ga0207712_100732772 210
363 3300025961 Ga0207712_10225928 Ga0207712_102259282 210
364 3300025961 Ga0207712_10271732 Ga0207712_102717322 210
365 3300025972 Ga0207668_10062041 Ga0207668_100620412 210
366 3300025986 Ga0207658_10084191 Ga0207658_100841912 210
367 3300025986 Ga0207658_10286669 Ga0207658_102866691 210
368 3300025986 Ga0207658_10459261 Ga0207658_104592612 210
369 3300026035 Ga0207703_10000470 Ga0207703_1000047033 210
370 3300026035 Ga0207703_10832661 Ga0207703_108326611 210
371 3300026075 Ga0207708_10039049 Ga0207708_100390493 210
372 3300026075 Ga0207708_10266152 Ga0207708_102661521 210
373 3300026088 Ga0207641_10006512 Ga0207641_100065128 210
374 3300026088 Ga0207641_10008144 Ga0207641_100081442 210
375 3300026088 Ga0207641_10024153 Ga0207641_100241535 210
376 3300026088 Ga0207641_10467967 Ga0207641_104679671 210
377 3300026088 Ga0207641_10725536 Ga0207641_107255361 210
378 3300026089 Ga0207648_10004247 Ga0207648_100042476 210
379 3300026089 Ga0207648_10196293 Ga0207648_101962932 210
380 3300026089 Ga0207648_10778166 Ga0207648_107781661 210
381 3300026095 Ga0207676_10000609 Ga0207676_1000060914 210
382 3300026095 Ga0207676_10020005 Ga0207676_100200052 210
383 3300026095 Ga0207676_10023135 Ga0207676_100231352 210
384 3300026095 Ga0207676_10097755 Ga0207676_100977552 210
385 3300026095 Ga0207676_10281865 Ga0207676_102818651 210
386 3300026116 Ga0207674_10016097 Ga0207674_100160972 210
387 3300026116 Ga0207674_10054049 Ga0207674_100540494 210
388 3300026116 Ga0207674_11233114 Ga0207674_112331141 210
389 3300026118 Ga0207675_100004806 Ga0207675_1000048063 210
390 3300026118 Ga0207675_100188790 Ga0207675_1001887902 210
391 3300026118 Ga0207675_100262994 Ga0207675_1002629942 210
392 3300026118 Ga0207675_100662384 Ga0207675_1006623841 210
393 3300026121 Ga0207683_10024812 Ga0207683_100248122 210
394 3300026121 Ga0207683_10531298 Ga0207683_105312982 210
395 3300027360 Ga0209969_1003758 Ga0209969_10037582 210
396 3300027395 Ga0209996_1004862 Ga0209996_10048621 210
397 3300027462 Ga0210000_1007296 Ga0210000_10072962 210
398 3300027671 Ga0209588_1086658 Ga0209588_10866581 210
399 3300027695 Ga0209966_1003774 Ga0209966_10037742 210
400 3300027866 Ga0209813_10118384 Ga0209813_101183841 210
401 3300027876 Ga0209974_10009220 Ga0209974_100092204 210
402 3300027907 Ga0207428_10110103 Ga0207428_101101032 210
403 3300027907 Ga0207428_10207971 Ga0207428_102079712 210
404 3300028379 Ga0268266_10058741 Ga0268266_100587412 210
405 3300028379 Ga0268266_10094242 Ga0268266_100942422 210
406 3300028379 Ga0268266_10654619 Ga0268266_106546191 210
407 3300028380 Ga0268265_10045824 Ga0268265_100458241 210
408 3300028380 Ga0268265_10079704 Ga0268265_100797042 210
409 3300028381 Ga0268264_10001168 Ga0268264_1000116816 210
410 3300028381 Ga0268264_10021674 Ga0268264_100216743 210
411 3300028381 Ga0268264_10046403 Ga0268264_100464032 210
412 3300031238 Ga0265332_10001631 Ga0265332_100016316 210
413 3300031239 Ga0265328_10140402 Ga0265328_101404022 210
414 3300031241 Ga0265325_10019135 Ga0265325_100191353 210
415 3300031242 Ga0265329_10002664 Ga0265329_100026642 210
416 3300031247 Ga0265340_10190041 Ga0265340_101900411 210
417 3300031249 Ga0265339_10038117 Ga0265339_100381172 210
418 3300031250 Ga0265331_10000972 Ga0265331_100009721 210
419 3300031251 Ga0265327_10001720 Ga0265327_100017202 210
420 3300031595 Ga0265313_10000367 Ga0265313_1000036719 210
421 3300031711 Ga0265314_10002346 Ga0265314_1000234620 210
422 3300031995 Ga0307409_100942419 Ga0307409_1009424192 210
423 3300032005 Ga0307411_10142885 Ga0307411_101428852 210
424 3300035115 Ga0373941_0010854 Ga0373941_0010854_1010_1663 210
425 3300035207 Ga0373942_0034947 Ga0373942_0034947_243_896 210
426 3300035691 Ga0373931_0050743 Ga0373931_0050743_727_1380 210
427 3300036401 Ga0373937_0185814 Ga0373937_0185814_1246_1902 210
428 3300036401 Ga0373937_0190282 Ga0373937_0190282_706_1365 210
429 3300037471 Ga0395905_0985416 Ga0395905_0985416_81_734 210
430 3300039450 Ga0436363_0274523 Ga0436363_0274523_151_810 210
431 3300041999 Ga0439433_0011951 Ga0439433_0011951_626_1282 210
432 3300042008 Ga0439450_010825 Ga0439450_010825_164_796 210
433 3300044656 Ga0466969_0068440 Ga0466969_0068440_335_988 210
434 3300044684 Ga0466966_0081788 Ga0466966_0081788_952_1605 210
435 3300044693 Ga0466961_0085858 Ga0466961_0085858_1299_1952 210
436 3300044706 Ga0466964_0044895 Ga0466964_0044895_168_821 210
437 3300044719 Ga0466971_0038182 Ga0466971_0038182_800_1453 210
438 3300044735 Ga0466968_0099621 Ga0466968_0099621_197_850 210
439 3300044842 Ga0466957_0031538 Ga0466957_0031538_2333_2986 210
440 3300045049 Ga0466959_0045596 Ga0466959_0045596_1624_2277 210
441 3300045051 Ga0451576_0039530 Ga0451576_0039530_2576_3229 210
442 3300046455 Ga0495603_0102801 Ga0495603_0102801_238_897 210
443 3300046462 Ga0495651_0316105 Ga0495651_0316105_263_922 210
444 3300046491 Ga0495584_0356729 Ga0495584_0356729_32_691 210
445 3300046499 Ga0495594_0302623 Ga0495594_0302623_34_693 210
446 3300046506 Ga0495583_0082127 Ga0495583_0082127_214_870 210
447 3300046517 Ga0495630_0154664 Ga0495630_0154664_1065_1724 210
448 3300046679 Ga0495623_0230849 Ga0495623_0230849_16_675 210
449 3300046684 Ga0495669_0038812 Ga0495669_0038812_650_1312 210
450 3300048906 Ga0496103_0258096 Ga0496103_0258096_313_969 210
451 3300048906 Ga0496103_0329590 Ga0496103_0329590_41_673 210
452 3300048907 Ga0496104_0013290 Ga0496104_0013290_98_730 210
453 3300048907 Ga0496104_0634176 Ga0496104_0634176_260_916 210
454 3300048908 Ga0496105_0010192 Ga0496105_0010192_5049_5681 210
455 3300048911 Ga0496108_0169425 Ga0496108_0169425_1125_1781 210
456 3300048911 Ga0496108_0396466 Ga0496108_0396466_247_879 210
457 3300048912 Ga0496109_0014019 Ga0496109_0014019_3955_4611 210
458 3300048913 Ga0496110_0674231 Ga0496110_0674231_206_838 210
459 3300048914 Ga0496111_0097265 Ga0496111_0097265_784_1416 210
460 3300048915 Ga0496112_0208667 Ga0496112_0208667_442_1188 210
461 3300048915 Ga0496112_0683917 Ga0496112_0683917_74_730 210
462 3300048917 Ga0496114_0261223 Ga0496114_0261223_621_1277 210
463 3300049568 Ga0501031_0002036 Ga0501031_0002036_5621_6280 210
464 3300049569 Ga0501032_0012383 Ga0501032_0012383_175_834 210
465 3300049570 Ga0501033_0004584 Ga0501033_0004584_6550_7209 210
466 3300049570 Ga0501033_0250732 Ga0501033_0250732_115_774 210
467 3300049571 Ga0501034_0005792 Ga0501034_0005792_4895_5530 210
468 3300049571 Ga0501034_0041105 Ga0501034_0041105_453_1112 210
469 3300049572 Ga0501036_0005255 Ga0501036_0005255_727_1383 210
470 3300049572 Ga0501036_0007868 Ga0501036_0007868_4402_5061 210
471 3300049572 Ga0501036_0172621 Ga0501036_0172621_397_1056 210
472 3300049573 Ga0501037_0023566 Ga0501037_0023566_585_1244 210
473 3300049573 Ga0501037_0148346 Ga0501037_0148346_700_1359 210
474 3300049574 Ga0501038_0003383 Ga0501038_0003383_10135_10794 210
475 3300049575 Ga0501039_0059077 Ga0501039_0059077_562_1221 210
476 3300049576 Ga0501040_0058576 Ga0501040_0058576_1120_1779 210
477 3300049577 Ga0501041_0007372 Ga0501041_0007372_1740_2396 210
478 3300049578 Ga0501042_0036907 Ga0501042_0036907_263_919 210
479 3300049578 Ga0501042_0401170 Ga0501042_0401170_95_748 210
480 3300049579 Ga0501043_0083284 Ga0501043_0083284_1823_2479 210
481 3300049579 Ga0501043_0171499 Ga0501043_0171499_243_902 210
482 3300049581 Ga0501047_0004800 Ga0501047_0004800_7303_7962 210
483 3300049583 Ga0501067_0073097 Ga0501067_0073097_1151_1810 210
484 3300049584 Ga0501068_0246236 Ga0501068_0246236_355_1011 210
485 3300049586 Ga0501070_0004048 Ga0501070_0004048_5493_6152 210
486 3300049587 Ga0501071_0006328 Ga0501071_0006328_1716_2372 210
487 3300049588 Ga0501072_0076507 Ga0501072_0076507_89_745 210
488 3300049590 Ga0501074_0619555 Ga0501074_0619555_43_696 210
489 3300049591 Ga0501075_0566242 Ga0501075_0566242_50_703 210
490 3300049592 Ga0501076_0031457 Ga0501076_0031457_3451_4104 210
491 3300049592 Ga0501076_0042445 Ga0501076_0042445_359_1018 210
492 3300049592 Ga0501076_0204919 Ga0501076_0204919_774_1427 210
493 3300049593 Ga0501077_0017812 Ga0501077_0017812_1611_2270 210
494 3300049741 Ga0501079_0006518 Ga0501079_0006518_3231_3890 210
495 3300049743 Ga0501081_0125829 Ga0501081_0125829_324_977 210
496 3300049743 Ga0501081_0246573 Ga0501081_0246573_586_1245 210
497 3300049744 Ga0501083_0323197 Ga0501083_0323197_31_687 210
498 3300049822 Ga0501035_0007782 Ga0501035_0007782_4140_4799 210
499 3300050491 nmdc:mga00v17_249462_c1 nmdc:mga00v17_249462_c1_44_697 210
500 3300050493 nmdc:mga0k408_280071_c1 nmdc:mga0k408_280071_c1_27_680 210
501 3300050494 nmdc:mga06z11_12011_c1 nmdc:mga06z11_12011_c1_1881_2534 210
502 3300050494 nmdc:mga06z11_34465_c1 nmdc:mga06z11_34465_c1_352_1005 210
503 3300050495 nmdc:mga04h51_112268_c1 nmdc:mga04h51_112268_c1_60_794 210
504 3300050507 nmdc:mga05p37_101521_c1 nmdc:mga05p37_101521_c1_2849_3508 210
505 3300050507 nmdc:mga05p37_115691_c1 nmdc:mga05p37_115691_c1_981_1763 210
506 3300050507 nmdc:mga05p37_1566_c1 nmdc:mga05p37_1566_c1_8967_9620 210
507 3300050507 nmdc:mga05p37_189483_c2 nmdc:mga05p37_189483_c2_804_1463 210
508 3300050507 nmdc:mga05p37_216758_c1 nmdc:mga05p37_216758_c1_863_1522 210
509 3300050507 nmdc:mga05p37_314381_c1 nmdc:mga05p37_314381_c1_121_780 210
510 3300050507 nmdc:mga05p37_352777_c1 nmdc:mga05p37_352777_c1_153_806 210
511 3300050507 nmdc:mga05p37_87419_c1 nmdc:mga05p37_87419_c1_596_1249 210
512 3300050508 nmdc:mga09592_465_c1 nmdc:mga09592_465_c1_22688_23341 210
513 3300050509 nmdc:mga0qj67_212152_c1 nmdc:mga0qj67_212152_c1_544_1218 210
514 3300050509 nmdc:mga0qj67_311310_c1 nmdc:mga0qj67_311310_c1_396_1049 210
515 3300050509 nmdc:mga0qj67_31516_c1 nmdc:mga0qj67_31516_c1_3014_3667 210
516 3300050509 nmdc:mga0qj67_448806_c1 nmdc:mga0qj67_448806_c1_394_1026 210
517 3300050510 nmdc:mga06r32_209097_c1 nmdc:mga06r32_209097_c1_390_1022 210
518 3300050510 nmdc:mga06r32_231220_c1 nmdc:mga06r32_231220_c1_416_1048 210
519 3300050511 nmdc:mga08y16_104222_c1 nmdc:mga08y16_104222_c1_804_1463 210
520 3300050511 nmdc:mga08y16_220229_c1 nmdc:mga08y16_220229_c1_813_1466 210
521 3300050511 nmdc:mga08y16_316607_c1 nmdc:mga08y16_316607_c1_583_1233 210
522 3300050512 nmdc:mga0n895_108063_c1 nmdc:mga0n895_108063_c1_354_1007 210
523 3300050512 nmdc:mga0n895_174164_c1 nmdc:mga0n895_174164_c1_1034_1687 210
524 3300050512 nmdc:mga0n895_32780_c1 nmdc:mga0n895_32780_c1_3492_4145 210
525 3300050512 nmdc:mga0n895_34597_c1 nmdc:mga0n895_34597_c1_1889_2548 210
526 3300050512 nmdc:mga0n895_47472_c1 nmdc:mga0n895_47472_c1_2024_2677 210
527 3300050512 nmdc:mga0n895_497453_c1 nmdc:mga0n895_497453_c1_41_673 210
528 3300050512 nmdc:mga0n895_802989_c1 nmdc:mga0n895_802989_c1_131_787 210
529 3300050512 nmdc:mga0n895_88855_c1 nmdc:mga0n895_88855_c1_476_1129 210
530 3300050513 nmdc:mga0rr50_351017_c1 nmdc:mga0rr50_351017_c1_133_792 210
531 3300050513 nmdc:mga0rr50_6374_c1 nmdc:mga0rr50_6374_c1_4930_5583 210
532 3300050514 nmdc:mga08x19_15022_c1 nmdc:mga08x19_15022_c1_749_1402 210
533 3300050514 nmdc:mga08x19_280436_c1 nmdc:mga08x19_280436_c1_456_1115 210
534 3300050515 nmdc:mga0a205_12985_c1 nmdc:mga0a205_12985_c1_3213_3872 210
535 3300050515 nmdc:mga0a205_29970_c1 nmdc:mga0a205_29970_c1_2750_3403 210
536 3300050515 nmdc:mga0a205_352697_c1 nmdc:mga0a205_352697_c1_85_738 210
537 3300050515 nmdc:mga0a205_3800_c1 nmdc:mga0a205_3800_c1_5792_6445 210
538 3300050515 nmdc:mga0a205_607146_c1 nmdc:mga0a205_607146_c1_175_831 210
539 3300053727 Ga0500611_056231 Ga0500611_056231_42_701 210
540 3300053730 Ga0500645_026192 Ga0500645_026192_537_1196 210
541 3300054114 Ga0501084_0057087 Ga0501084_0057087_1529_2188 210
542 3300059421 Ga0590071_017845 Ga0590071_017845_584_1240 210
543 3300059426 Ga0590077_005668 Ga0590077_005668_1840_2496 210
544 3300061719 Ga0466962_0017548 Ga0466962_0017548_1400_2053 210
545 3300061734 Ga0530510_0007826 Ga0530510_0007826_3231_3887 210
546 2162886007 SwRhRL2b_contig_490068 SwRhRL2b_0835.00003140 211
547 3300002077 JGI24744J21845_10015512 JGI24744J21845_100155122 211
548 3300005288 Ga0065714_10002962 Ga0065714_100029622 211
549 3300005288 Ga0065714_10015604 Ga0065714_100156042 211
550 3300005289 Ga0065704_10070382 Ga0065704_100703822 211
551 3300005289 Ga0065704_10250521 Ga0065704_102505211 211
552 3300005331 Ga0070670_100009968 Ga0070670_1000099686 211
553 3300005333 Ga0070677_10245983 Ga0070677_102459831 211
554 3300005334 Ga0068869_100112140 Ga0068869_1001121401 211
555 3300005335 Ga0070666_10012713 Ga0070666_100127133 211
556 3300005336 Ga0070680_100217127 Ga0070680_1002171272 211
557 3300005338 Ga0068868_100357268 Ga0068868_1003572682 211
558 3300005347 Ga0070668_100396520 Ga0070668_1003965202 211
559 3300005354 Ga0070675_100203326 Ga0070675_1002033261 211
560 3300005367 Ga0070667_100096108 Ga0070667_1000961081 211
561 3300005456 Ga0070678_100016719 Ga0070678_1000167191 211
562 3300005459 Ga0068867_100108153 Ga0068867_1001081533 211
563 3300005467 Ga0070706_100190155 Ga0070706_1001901552 211
564 3300005518 Ga0070699_100524806 Ga0070699_1005248062 211
565 3300005536 Ga0070697_100030719 Ga0070697_1000307191 211
566 3300005536 Ga0070697_100175584 Ga0070697_1001755841 211
567 3300005536 Ga0070697_100443581 Ga0070697_1004435811 211
568 3300005543 Ga0070672_100424364 Ga0070672_1004243642 211
569 3300005545 Ga0070695_100299265 Ga0070695_1002992652 211
570 3300005548 Ga0070665_100087247 Ga0070665_1000872472 211
571 3300005548 Ga0070665_100249135 Ga0070665_1002491352 211
572 3300005614 Ga0068856_100155007 Ga0068856_1001550072 211
573 3300005618 Ga0068864_100909561 Ga0068864_1009095611 211
574 3300005718 Ga0068866_10234940 Ga0068866_102349401 211
575 3300005719 Ga0068861_100338774 Ga0068861_1003387742 211
576 3300005840 Ga0068870_10035750 Ga0068870_100357502 211
577 3300005843 Ga0068860_100072868 Ga0068860_1000728681 211
578 3300005981 Ga0081538_10013885 Ga0081538_100138856 211
579 3300005981 Ga0081538_10051883 Ga0081538_100518832 211
580 3300005985 Ga0081539_10035957 Ga0081539_100359572 211
581 3300006237 Ga0097621_100043127 Ga0097621_1000431274 211
582 3300006358 Ga0068871_100125108 Ga0068871_1001251082 211
583 3300006852 Ga0075433_10138956 Ga0075433_101389561 211
584 3300006871 Ga0075434_101339703 Ga0075434_1013397031 211
585 3300006881 Ga0068865_100132904 Ga0068865_1001329042 211
586 3300007076 Ga0075435_100047941 Ga0075435_1000479411 211
587 3300009098 Ga0105245_10000117 Ga0105245_1000011729 211
588 3300009147 Ga0114129_10279726 Ga0114129_102797262 211
589 3300009174 Ga0105241_10148828 Ga0105241_101488284 211
590 3300009176 Ga0105242_10008888 Ga0105242_100088885 211
591 3300009177 Ga0105248_10000037 Ga0105248_10000037138 211
592 3300009551 Ga0105238_10213888 Ga0105238_102138883 211
593 3300011119 Ga0105246_10012210 Ga0105246_100122107 211
594 3300013102 Ga0157371_10004223 Ga0157371_100042238 211
595 3300013104 Ga0157370_10038247 Ga0157370_100382472 211
596 3300013104 Ga0157370_10154713 Ga0157370_101547132 211
597 3300013104 Ga0157370_10340358 Ga0157370_103403582 211
598 3300013105 Ga0157369_10000051 Ga0157369_10000051149 211
599 3300013105 Ga0157369_10006381 Ga0157369_1000638113 211
600 3300013296 Ga0157374_10116406 Ga0157374_101164062 211
601 3300013296 Ga0157374_10127184 Ga0157374_101271843 211
602 3300013296 Ga0157374_10890462 Ga0157374_108904622 211
603 3300013297 Ga0157378_10210232 Ga0157378_102102323 211
604 3300014497 Ga0182008_10000009 Ga0182008_10000009159 211
605 3300014745 Ga0157377_10043926 Ga0157377_100439263 211
606 3300014968 Ga0157379_10558739 Ga0157379_105587391 211
607 3300017792 Ga0163161_10294203 Ga0163161_102942032 211
608 3300020069 Ga0197907_11086676 Ga0197907_110866762 211
609 3300025315 Ga0207697_10016406 Ga0207697_100164064 211
610 3300025893 Ga0207682_10255583 Ga0207682_102555831 211
611 3300025899 Ga0207642_10236255 Ga0207642_102362552 211
612 3300025903 Ga0207680_10305532 Ga0207680_103055321 211
613 3300025907 Ga0207645_10000693 Ga0207645_1000069312 211
614 3300025908 Ga0207643_10015522 Ga0207643_100155225 211
615 3300025911 Ga0207654_10044003 Ga0207654_100440031 211
616 3300025919 Ga0207657_10016994 Ga0207657_100169943 211
617 3300025923 Ga0207681_10028678 Ga0207681_100286784 211
618 3300025926 Ga0207659_10075488 Ga0207659_100754883 211
619 3300025927 Ga0207687_10000070 Ga0207687_1000007066 211
620 3300025934 Ga0207686_10630638 Ga0207686_106306381 211
621 3300025937 Ga0207669_10062883 Ga0207669_100628831 211
622 3300025940 Ga0207691_10113381 Ga0207691_101133812 211
623 3300025941 Ga0207711_10000011 Ga0207711_10000011405 211
624 3300025942 Ga0207689_10034064 Ga0207689_100340645 211
625 3300025972 Ga0207668_10215387 Ga0207668_102153872 211
626 3300025986 Ga0207658_10068022 Ga0207658_100680221 211
627 3300026023 Ga0207677_10298583 Ga0207677_102985831 211
628 3300026075 Ga0207708_10466459 Ga0207708_104664592 211
629 3300026078 Ga0207702_10058778 Ga0207702_100587783 211
630 3300026089 Ga0207648_10001098 Ga0207648_1000109830 211
631 3300026095 Ga0207676_10182757 Ga0207676_101827571 211
632 3300026118 Ga0207675_100118736 Ga0207675_1001187362 211
633 3300026118 Ga0207675_100551473 Ga0207675_1005514732 211
634 3300026121 Ga0207683_10000597 Ga0207683_1000059716 211
635 3300026142 Ga0207698_10000015 Ga0207698_1000001582 211
636 3300027378 Ga0209981_1026487 Ga0209981_10264871 211
637 3300027526 Ga0209968_1026750 Ga0209968_10267501 211
638 3300027552 Ga0209982_1006376 Ga0209982_10063762 211
639 3300028379 Ga0268266_10060714 Ga0268266_100607143 211
640 3300028379 Ga0268266_10423475 Ga0268266_104234751 211
641 3300028381 Ga0268264_10358856 Ga0268264_103588561 211
642 3300031240 Ga0265320_10205784 Ga0265320_102057842 211
643 3300031249 Ga0265339_10054872 Ga0265339_100548722 211
644 3300031901 Ga0307406_10546335 Ga0307406_105463351 211
645 3300031911 Ga0307412_10000084 Ga0307412_1000008427 211
646 3300032004 Ga0307414_10007545 Ga0307414_100075454 211
647 3300032004 Ga0307414_10013020 Ga0307414_100130202 211
648 3300032004 Ga0307414_10371062 Ga0307414_103710621 211
649 3300032004 Ga0307414_10878888 Ga0307414_108788881 211
650 3300035120 Ga0373957_0134314 Ga0373957_0134314_34_774 211
651 3300037418 Ga0395900_0001825 Ga0395900_0001825_21407_22090 211
652 3300039453 Ga0436362_0660881 Ga0436362_0660881_1830_2534 211
653 3300042004 Ga0439445_0049919 Ga0439445_0049919_409_1071 211
654 3300046454 Ga0495592_0000007 Ga0495592_0000007_130439_131074 211
655 3300046476 Ga0495662_0007164 Ga0495662_0007164_331_966 211
656 3300046514 Ga0495618_0053006 Ga0495618_0053006_894_1529 211
657 3300046516 Ga0495628_0032027 Ga0495628_0032027_2385_3020 211
658 3300046517 Ga0495630_0002686 Ga0495630_0002686_10832_11467 211
659 3300046526 Ga0495666_0038496 Ga0495666_0038496_518_1153 211
660 3300046529 Ga0495652_0184762 Ga0495652_0184762_586_1221 211
661 3300046533 Ga0495640_0105875 Ga0495640_0105875_1014_1649 211
662 3300046535 Ga0495586_0001436 Ga0495586_0001436_12516_13151 211
663 3300046615 Ga0495656_0018601 Ga0495656_0018601_720_1382 211
664 3300046678 Ga0495599_0001504 Ga0495599_0001504_7157_7792 211
665 3300046690 Ga0495624_0084818 Ga0495624_0084818_1247_1882 211
666 3300046691 Ga0495670_0255915 Ga0495670_0255915_110_772 211
667 3300047318 Ga0495636_0009050 Ga0495636_0009050_2696_3358 211
668 3300048911 Ga0496108_0000005 Ga0496108_0000005_411911_412573 211
669 3300048912 Ga0496109_0000002 Ga0496109_0000002_122519_123181 211
670 3300049582 Ga0501048_0159320 Ga0501048_0159320_177_839 211
671 3300049584 Ga0501068_0021587 Ga0501068_0021587_3056_3712 211
672 3300049744 Ga0501083_0402568 Ga0501083_0402568_235_870 211
673 3300049758 Ga0501241_005494 Ga0501241_005494_396_1031 211
674 3300049824 Ga0501045_0053512 Ga0501045_0053512_1230_1892 211
675 3300050507 nmdc:mga05p37_555612_c1 nmdc:mga05p37_555612_c1_208_843 211
676 3300050508 nmdc:mga09592_297430_c1 nmdc:mga09592_297430_c1_588_1304 211
677 3300050510 nmdc:mga06r32_140111_c1 nmdc:mga06r32_140111_c1_179_841 211
678 3300050510 nmdc:mga06r32_232604_c1 nmdc:mga06r32_232604_c1_42_731 211
679 3300050512 nmdc:mga0n895_1172732_c1 nmdc:mga0n895_1172732_c1_17_652 211
680 3300050512 nmdc:mga0n895_47148_c1 nmdc:mga0n895_47148_c1_3329_3964 211
681 3300050513 nmdc:mga0rr50_27949_c1 nmdc:mga0rr50_27949_c1_132_767 211
682 3300053093 Ga0500651_0007451 Ga0500651_0007451_268_903 211

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

48

186

0.97

PF10417

1-cysPrx_C

C-terminal domain of 1-Cys peroxiredoxin

206

245

0.95

PF08534

Redoxin

Redoxin

47

204

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
7kuu-assembly1.cif.gz_B lsfa from p. aeruginosa, a 1-cys prx in sulfonic acid form 0.9662 3 210
7kuu-assembly1.cif.gz_B lsfa from p. aeruginosa, a 1-cys prx in sulfonic acid form 0.9615 3 210
6p0w-assembly1.cif.gz_A-2 lsfa from p. aeruginosa, a 1-cys prx in reduced form 0.9601 3 210
5b6n-assembly2.cif.gz_C crystal structures of human peroxiredoxin 6 in sulfinic acid state 0.9576 2 209
6p0w-assembly1.cif.gz_A-2 lsfa from p. aeruginosa, a 1-cys prx in reduced form 0.9508 3 210
ID Description Score Start End Superfamily
af_A0A0R0K508_6_109_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9717 5 106 3.40.30.10
af_I1KRJ7_151_218_3.30.1020.10 Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 0.9709 146 207 3.30.1020.10
af_Q54SE2_176_239_3.30.1020.10 Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 0.9704 146 209 3.30.1020.10
af_P34227_199_260_3.30.1020.10 Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 0.9619 146 207 3.30.1020.10
af_Q8IAM2_153_220_3.30.1020.10 Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 0.9569 146 207 3.30.1020.10

Feature Viewer

pLDDT pTM Quality
94.19 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map