F474927

General Info

Members Datasets Scaffolds Average Seq Length
682 296 1364 138

Family's Representative Sequence

Representative Sequence 3300044712|Ga0453684_2327938|Ga0453684_2327938_30_449
Length 139
Sequence MPTAFLTRRELFNAAHRLCQPGLSDEENFELYGKCSNPNWHGHNYTLWVTVKGEIDPQIGYVANLKEISRIIRDEVTEKVDHKNLNLEVDFMKGIIPSTENLAIAIWKQLEPHIKGLGIELHCVKIEETENNTAEFYGF

Samples

Sample ID Description Type Environment
1 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
69 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
96 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
97 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
110 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
111 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
113 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
178 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
179 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
180 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
181 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
182 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
183 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
184 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
185 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
186 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
187 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
188 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
189 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
190 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
191 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
192 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
193 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
194 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
195 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
196 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
197 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
198 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
199 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
200 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
201 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
202 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
203 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
204 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
205 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
206 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
207 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
208 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
209 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
210 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
211 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
212 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
213 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
214 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
215 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
216 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
217 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
218 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
219 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
220 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
221 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
222 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
223 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
224 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
225 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
226 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
227 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
228 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
229 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
230 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
231 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
232 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
233 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
234 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
235 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
236 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
237 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
238 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
239 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
240 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
241 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
242 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
243 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
244 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
245 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
246 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
247 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
248 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
249 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
250 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
251 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
252 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
253 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
254 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
255 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
256 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
257 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
258 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
259 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
260 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
261 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
262 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
263 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
264 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
265 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
266 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
267 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
268 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
269 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
270 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
271 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
272 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
273 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
274 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
276 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
277 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
279 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
280 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
281 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
282 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
283 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
285 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
286 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
287 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
288 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
289 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
290 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
291 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
292 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
293 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
294 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
295 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
296 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.85
Metatranscriptomes 0.15
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.76
Rhizosphere 97.51
Stem 0
Stem Tuber 0
Unclassified 6.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0453684_2327938 3300044712 Unclassified 532
2 Ga0065704_10722632 3300005289 Bacteria 552
3 Ga0065712_10122204 3300005290 Bacteria 1654
4 Ga0065712_10756732 3300005290 Bacteria 525
5 Ga0065715_10843599 3300005293 Bacteria 592
6 Ga0070658_10084560 3300005327 Bacteria 2609
7 Ga0070658_10748248 3300005327 Bacteria 849
8 Ga0070676_10143543 3300005328 Bacteria 1522
9 Ga0070683_100002579 3300005329 Bacteria 14488
10 Ga0070683_100007126 3300005329 Bacteria 9425
11 Ga0070683_100014821 3300005329 Bacteria 6833
12 Ga0070683_100025087 3300005329 Bacteria 5349
13 Ga0070683_100227133 3300005329 Bacteria 1774
14 Ga0070683_100231849 3300005329 Bacteria 1755
15 Ga0070683_100237127 3300005329 Bacteria 1735
16 Ga0070683_100986243 3300005329 Bacteria 809
17 Ga0070683_101023750 3300005329 Bacteria 793
18 Ga0070690_100159903 3300005330 Bacteria 1543
19 Ga0070690_100640214 3300005330 Bacteria 811
20 Ga0070690_101773388 3300005330 Bacteria 503
21 Ga0070670_100004220 3300005331 Bacteria 12023
22 Ga0070670_100116937 3300005331 Unclassified 2299
23 Ga0070670_100678403 3300005331 Unclassified 926
24 Ga0070670_100700000 3300005331 Unclassified 911
25 Ga0068869_100007736 3300005334 Bacteria 6890
26 Ga0068869_100487286 3300005334 Bacteria 1027
27 Ga0068869_100675782 3300005334 Bacteria 879
28 Ga0070666_10136637 3300005335 Bacteria 1706
29 Ga0070666_10140093 3300005335 Bacteria 1685
30 Ga0070680_100001330 3300005336 Bacteria 17912
31 Ga0070680_100003409 3300005336 Bacteria 11863
32 Ga0070680_100016629 3300005336 Bacteria 5791
33 Ga0070680_100039210 3300005336 Bacteria 3834
34 Ga0070680_100092716 3300005336 Bacteria 2501
35 Ga0070680_101490479 3300005336 Bacteria 586
36 Ga0070682_100002340 3300005337 Bacteria 10490
37 Ga0070682_100190019 3300005337 Bacteria 1441
38 Ga0068868_100034526 3300005338 Bacteria 3905
39 Ga0068868_100321829 3300005338 Bacteria 1318
40 Ga0070660_100013657 3300005339 Bacteria 5836
41 Ga0070689_100023697 3300005340 Bacteria 4599
42 Ga0070689_100157111 3300005340 Bacteria 1836
43 Ga0070689_100397348 3300005340 Bacteria 1164
44 Ga0070687_100051967 3300005343 Bacteria 2125
45 Ga0070687_100265455 3300005343 Bacteria 1073
46 Ga0070687_100469544 3300005343 Bacteria 841
47 Ga0070661_100002591 3300005344 Bacteria 12397
48 Ga0070661_100002596 3300005344 Bacteria 12386
49 Ga0070661_100241719 3300005344 Unclassified 1391
50 Ga0070661_100443747 3300005344 Bacteria 1032
51 Ga0070692_10009163 3300005345 Bacteria 4450
52 Ga0070668_100004250 3300005347 Bacteria 10630
53 Ga0070669_100581621 3300005353 Bacteria 936
54 Ga0070675_100000614 3300005354 Bacteria 24609
55 Ga0070675_100001151 3300005354 Bacteria 19090
56 Ga0070675_100012803 3300005354 Bacteria 6582
57 Ga0070675_100078140 3300005354 Bacteria 2755
58 Ga0070675_100336785 3300005354 Bacteria 1336
59 Ga0070671_100045305 3300005355 Bacteria 3656
60 Ga0070671_101683913 3300005355 Bacteria 563
61 Ga0070673_100018860 3300005364 Unclassified 4943
62 Ga0070673_100096896 3300005364 Bacteria 2421
63 Ga0070673_100766317 3300005364 Bacteria 889
64 Ga0070688_100106583 3300005365 Bacteria 1856
65 Ga0070667_100078499 3300005367 Bacteria 2820
66 Ga0070667_100115830 3300005367 Bacteria 2328
67 Ga0070667_100982125 3300005367 Bacteria 787
68 Ga0070709_10021656 3300005434 Bacteria 3746
69 Ga0070709_10330973 3300005434 Bacteria 1120
70 Ga0070709_10383201 3300005434 Bacteria 1046
71 Ga0070714_100056051 3300005435 Bacteria 3370
72 Ga0070714_100298233 3300005435 Bacteria 1502
73 Ga0070714_101168609 3300005435 Bacteria 750
74 Ga0070713_100000638 3300005436 Bacteria 22375
75 Ga0070713_100013386 3300005436 Bacteria 6056
76 Ga0070713_100168974 3300005436 Bacteria 1958
77 Ga0070713_101190559 3300005436 Bacteria 737
78 Ga0070710_10581799 3300005437 Bacteria 777
79 Ga0070710_10641462 3300005437 Unclassified 743
80 Ga0070710_10663287 3300005437 Bacteria 732
81 Ga0070701_10792334 3300005438 Bacteria 646
82 Ga0070711_100035827 3300005439 Bacteria 3320
83 Ga0070711_100151999 3300005439 Bacteria 1746
84 Ga0070705_100091682 3300005440 Bacteria 1895
85 Ga0070700_100025189 3300005441 Unclassified 3501
86 Ga0070694_100022034 3300005444 Unclassified 4080
87 Ga0070694_100609750 3300005444 Bacteria 880
88 Ga0070663_100087251 3300005455 Bacteria 2306
89 Ga0070663_100203014 3300005455 Bacteria 1548
90 Ga0070663_100415232 3300005455 Bacteria 1103
91 Ga0070678_102263786 3300005456 Bacteria 516
92 Ga0070662_100004182 3300005457 Bacteria 9094
93 Ga0070662_100010940 3300005457 Bacteria 5980
94 Ga0070662_100262469 3300005457 Bacteria 1392
95 Ga0070662_100900771 3300005457 Bacteria 755
96 Ga0070681_10001324 3300005458 Bacteria 21613
97 Ga0070681_10001615 3300005458 Bacteria 20067
98 Ga0070681_10033749 3300005458 Bacteria 5137
99 Ga0070681_10108274 3300005458 Bacteria 2719
100 Ga0068867_100131034 3300005459 Bacteria 1948
101 Ga0068867_100132346 3300005459 Bacteria 1940
102 Ga0068867_100509428 3300005459 Bacteria 1036
103 Ga0068867_101613174 3300005459 Bacteria 606
104 Ga0070685_10048293 3300005466 Bacteria 2451
105 Ga0070685_10131623 3300005466 Bacteria 1565
106 Ga0070706_100329629 3300005467 Bacteria 1423
107 Ga0070698_100488561 3300005471 Bacteria 1168
108 Ga0070699_100073972 3300005518 Bacteria 2964
109 Ga0070679_100000787 3300005530 Bacteria 27616
110 Ga0070679_100004367 3300005530 Bacteria 13066
111 Ga0070679_100031976 3300005530 Bacteria 5204
112 Ga0070679_100035033 3300005530 Bacteria 4978
113 Ga0070679_100248917 3300005530 Unclassified 1734
114 Ga0070679_101572567 3300005530 Bacteria 605
115 Ga0070684_100009266 3300005535 Bacteria 7749
116 Ga0070684_100016464 3300005535 Bacteria 6045
117 Ga0070684_100039400 3300005535 Bacteria 4064
118 Ga0070684_100042386 3300005535 Bacteria 3929
119 Ga0070684_100043168 3300005535 Bacteria 3893
120 Ga0070684_100107499 3300005535 Bacteria 2499
121 Ga0070684_100285912 3300005535 Bacteria 1511
122 Ga0070684_100445262 3300005535 Bacteria 1197
123 Ga0070684_101118033 3300005535 Bacteria 740
124 Ga0070697_100352331 3300005536 Bacteria 1271
125 Ga0070697_101013052 3300005536 Bacteria 738
126 Ga0068853_100011960 3300005539 Bacteria 7058
127 Ga0068853_100452563 3300005539 Bacteria 1208
128 Ga0070672_100021857 3300005543 Unclassified 4687
129 Ga0070672_100143876 3300005543 Bacteria 1969
130 Ga0070672_100362896 3300005543 Bacteria 1236
131 Ga0070672_100676404 3300005543 Bacteria 903
132 Ga0070672_100969631 3300005543 Bacteria 753
133 Ga0070672_101540810 3300005543 Bacteria 596
134 Ga0070686_100022305 3300005544 Bacteria 3770
135 Ga0070686_100163398 3300005544 Bacteria 1570
136 Ga0070686_100173752 3300005544 Bacteria 1526
137 Ga0070686_100392142 3300005544 Bacteria 1054
138 Ga0070686_100527106 3300005544 Bacteria 921
139 Ga0070686_100889634 3300005544 Unclassified 724
140 Ga0070695_100018239 3300005545 Bacteria 4260
141 Ga0070695_100280519 3300005545 Bacteria 1224
142 Ga0070695_100347573 3300005545 Bacteria 1110
143 Ga0070693_100002969 3300005547 Bacteria 7850
144 Ga0070693_100007400 3300005547 Bacteria 5365
145 Ga0070665_100340877 3300005548 Bacteria 1504
146 Ga0068855_100023136 3300005563 Bacteria 7445
147 Ga0068855_100041449 3300005563 Bacteria 5456
148 Ga0070664_100014208 3300005564 Bacteria 6494
149 Ga0070664_100074128 3300005564 Bacteria 2921
150 Ga0070664_100282363 3300005564 Bacteria 1497
151 Ga0070664_100755721 3300005564 Bacteria 908
152 Ga0070664_100861485 3300005564 Bacteria 849
153 Ga0070664_102141890 3300005564 Bacteria 531
154 Ga0068857_100003632 3300005577 Bacteria 12928
155 Ga0068857_100239745 3300005577 Unclassified 1660
156 Ga0068854_100938118 3300005578 Bacteria 763
157 Ga0068854_101080724 3300005578 Bacteria 714
158 Ga0068856_100050948 3300005614 Bacteria 4082
159 Ga0068856_100142417 3300005614 Bacteria 2405
160 Ga0068856_100382598 3300005614 Bacteria 1426
161 Ga0070702_100001484 3300005615 Bacteria 9636
162 Ga0070702_100101897 3300005615 Bacteria 1763
163 Ga0068852_100020759 3300005616 Bacteria 5226
164 Ga0068852_100035887 3300005616 Bacteria 4142
165 Ga0068852_100160715 3300005616 Bacteria 2097
166 Ga0068852_100796547 3300005616 Bacteria 959
167 Ga0068859_100254580 3300005617 Bacteria 1846
168 Ga0068859_101135235 3300005617 Bacteria 860
169 Ga0068864_100000958 3300005618 Bacteria 24199
170 Ga0068864_101010550 3300005618 Bacteria 825
171 Ga0068864_101551379 3300005618 Bacteria 666
172 Ga0068861_100010083 3300005719 Bacteria 6550
173 Ga0068863_100003601 3300005841 Bacteria 15293
174 Ga0068863_100419439 3300005841 Bacteria 1311
175 Ga0068863_100827857 3300005841 Bacteria 924
176 Ga0068863_100943590 3300005841 Bacteria 864
177 Ga0068858_100007492 3300005842 Bacteria 10549
178 Ga0068858_100288323 3300005842 Bacteria 1564
179 Ga0068858_100381604 3300005842 Bacteria 1352
180 Ga0068858_101261027 3300005842 Bacteria 727
181 Ga0068858_102288096 3300005842 Unclassified 534
182 Ga0068860_100033339 3300005843 Bacteria 4943
183 Ga0068860_100211902 3300005843 Bacteria 1879
184 Ga0068862_100006221 3300005844 Bacteria 9941
185 Ga0068862_100209583 3300005844 Bacteria 1761
186 Ga0081455_10220892 3300005937 Bacteria 1404
187 Ga0070717_10000619 3300006028 Bacteria 22822
188 Ga0070716_100175298 3300006173 Bacteria 1403
189 Ga0070716_100331654 3300006173 Bacteria 1070
190 Ga0070716_100405773 3300006173 Bacteria 981
191 Ga0070716_100783559 3300006173 Bacteria 737
192 Ga0070712_100002060 3300006175 Bacteria 12319
193 Ga0070712_100027283 3300006175 Bacteria 3812
194 Ga0070712_100186101 3300006175 Bacteria 1621
195 Ga0070712_101462961 3300006175 Bacteria 597
196 Ga0097621_100007580 3300006237 Bacteria 7778
197 Ga0097621_100556097 3300006237 Bacteria 1045
198 Ga0097621_100631068 3300006237 Bacteria 982
199 Ga0068871_100002756 3300006358 Bacteria 11999
200 Ga0068871_100417975 3300006358 Bacteria 1197
201 Ga0068871_101511102 3300006358 Bacteria 635
202 Ga0075428_100039578 3300006844 Bacteria 5189
203 Ga0075431_100126614 3300006847 Bacteria 2636
204 Ga0075433_10001166 3300006852 Bacteria 19101
205 Ga0075433_10487541 3300006852 Bacteria 1086
206 Ga0075434_100002182 3300006871 Bacteria 17072
207 Ga0075434_100006854 3300006871 Bacteria 10491
208 Ga0075434_100422148 3300006871 Bacteria 1355
209 Ga0075429_100053936 3300006880 Bacteria 3498
210 Ga0075429_101016726 3300006880 Unclassified 725
211 Ga0068865_100070922 3300006881 Bacteria 2470
212 Ga0068865_100205393 3300006881 Bacteria 1532
213 Ga0075436_100074466 3300006914 Unclassified 2351
214 Ga0097620_100254581 3300006931 Bacteria 1846
215 Ga0097620_101135588 3300006931 Bacteria 860
216 Ga0075435_100182870 3300007076 Bacteria 1772
217 Ga0075435_100279869 3300007076 Bacteria 1424
218 Ga0075435_100609643 3300007076 Bacteria 947
219 Ga0105240_10310156 3300009093 Bacteria 1802
220 Ga0111539_10367398 3300009094 Bacteria 1675
221 Ga0105245_10013650 3300009098 Bacteria 7077
222 Ga0105245_10092424 3300009098 Bacteria 2786
223 Ga0105245_10288425 3300009098 Bacteria 1607
224 Ga0105245_10634073 3300009098 Bacteria 1098
225 Ga0105245_10738954 3300009098 Bacteria 1019
226 Ga0114129_10011769 3300009147 Bacteria 12446
227 Ga0105243_11039684 3300009148 Bacteria 824
228 Ga0105243_11676809 3300009148 Bacteria 664
229 Ga0105242_10002909 3300009176 Bacteria 13390
230 Ga0105242_10092017 3300009176 Bacteria 2554
231 Ga0105242_10274127 3300009176 Bacteria 1529
232 Ga0105242_10630729 3300009176 Bacteria 1040
233 Ga0105242_11213441 3300009176 Bacteria 774
234 Ga0105242_12641610 3300009176 Bacteria 551
235 Ga0105242_13036493 3300009176 Bacteria 520
236 Ga0105248_10008052 3300009177 Bacteria 11570
237 Ga0105248_10009723 3300009177 Bacteria 10590
238 Ga0105248_10039903 3300009177 Bacteria 5263
239 Ga0105248_10120305 3300009177 Bacteria 2962
240 Ga0105248_10194639 3300009177 Bacteria 2284
241 Ga0105237_10197758 3300009545 Bacteria 2010
242 Ga0105238_10093063 3300009551 Bacteria 3002
243 Ga0105238_10321514 3300009551 Bacteria 1533
244 Ga0105249_10001625 3300009553 Bacteria 19687
245 Ga0105249_10028962 3300009553 Bacteria 5000
246 Ga0105249_10083563 3300009553 Bacteria 2972
247 Ga0105249_12361413 3300009553 Bacteria 604
248 Ga0105239_10004674 3300010375 Bacteria 16276
249 Ga0105239_10012403 3300010375 Bacteria 9488
250 Ga0105239_10807068 3300010375 Bacteria 1075
251 Ga0105246_10000636 3300011119 Bacteria 19588
252 Ga0105246_10880280 3300011119 Bacteria 801
253 Ga0157373_10524208 3300013100 Bacteria 857
254 Ga0157373_11095391 3300013100 Bacteria 597
255 Ga0157371_10007979 3300013102 Bacteria 8493
256 Ga0157371_10016443 3300013102 Bacteria 5521
257 Ga0157370_10005010 3300013104 Bacteria 14973
258 Ga0157370_10102918 3300013104 Bacteria 2673
259 Ga0157370_10932987 3300013104 Bacteria 787
260 Ga0157369_10057352 3300013105 Bacteria 4202
261 Ga0157369_10359699 3300013105 Bacteria 1511
262 Ga0157369_10425700 3300013105 Bacteria 1376
263 Ga0157369_10865451 3300013105 Bacteria 927
264 Ga0157374_11268075 3300013296 Bacteria 759
265 Ga0157378_10461509 3300013297 Bacteria 1262
266 Ga0157378_10653132 3300013297 Bacteria 1067
267 Ga0157378_11105739 3300013297 Bacteria 830
268 Ga0163162_10013676 3300013306 Bacteria 7930
269 Ga0163162_10113424 3300013306 Bacteria 2809
270 Ga0163162_10555523 3300013306 Bacteria 1276
271 Ga0163162_10566007 3300013306 Bacteria 1264
272 Ga0163162_12568954 3300013306 Bacteria 586
273 Ga0157372_10007301 3300013307 Bacteria 11766
274 Ga0157372_10011535 3300013307 Bacteria 9401
275 Ga0157372_10041964 3300013307 Bacteria 5059
276 Ga0157372_10200515 3300013307 Unclassified 2311
277 Ga0157372_10271709 3300013307 Bacteria 1970
278 Ga0157372_10302387 3300013307 Bacteria 1861
279 Ga0157372_10467709 3300013307 Bacteria 1470
280 Ga0157372_11207475 3300013307 Bacteria 874
281 Ga0157372_11268427 3300013307 Bacteria 851
282 Ga0157372_12325791 3300013307 Unclassified 615
283 Ga0157375_10006597 3300013308 Bacteria 10099
284 Ga0157375_10015896 3300013308 Bacteria 6746
285 Ga0157375_10023973 3300013308 Bacteria 5640
286 Ga0157375_10364044 3300013308 Bacteria 1612
287 Ga0157375_10595927 3300013308 Bacteria 1265
288 Ga0163163_10043209 3300014325 Bacteria 4418
289 Ga0163163_10052345 3300014325 Bacteria 4028
290 Ga0163163_10729676 3300014325 Bacteria 1054
291 Ga0157380_10931762 3300014326 Bacteria 897
292 Ga0157377_10003039 3300014745 Bacteria 7522
293 Ga0157379_10004564 3300014968 Bacteria 11879
294 Ga0157379_10236224 3300014968 Unclassified 1657
295 Ga0157379_12234015 3300014968 Bacteria 544
296 Ga0157376_10090989 3300014969 Bacteria 2642
297 Ga0157376_10184103 3300014969 Bacteria 1911
298 Ga0182007_10206378 3300015262 Unclassified 689
299 Ga0163161_10036934 3300017792 Bacteria 3500
300 Ga0206356_10121704 3300020070 Unclassified 905
301 Ga0213876_10054931 3300021384 Bacteria 2102
302 Ga0207697_10008958 3300025315 Bacteria 4345
303 Ga0207697_10026387 3300025315 Bacteria 2375
304 Ga0207656_10070754 3300025321 Bacteria 1550
305 Ga0207692_10255709 3300025898 Bacteria 1051
306 Ga0207692_10411288 3300025898 Bacteria 845
307 Ga0207680_10068643 3300025903 Bacteria 2187
308 Ga0207680_10306289 3300025903 Bacteria 1108
309 Ga0207647_10038248 3300025904 Bacteria 3035
310 Ga0207699_10003311 3300025906 Bacteria 7681
311 Ga0207699_10316585 3300025906 Bacteria 1093
312 Ga0207645_10079849 3300025907 Bacteria 2097
313 Ga0207645_10123571 3300025907 Bacteria 1681
314 Ga0207705_10163224 3300025909 Bacteria 1674
315 Ga0207684_10075761 3300025910 Bacteria 2859
316 Ga0207684_11500758 3300025910 Bacteria 549
317 Ga0207707_10007918 3300025912 Bacteria 9244
318 Ga0207707_10018128 3300025912 Bacteria 6135
319 Ga0207707_10023854 3300025912 Bacteria 5350
320 Ga0207707_11326361 3300025912 Bacteria 577
321 Ga0207695_10002723 3300025913 Bacteria 25807
322 Ga0207695_10998213 3300025913 Bacteria 717
323 Ga0207671_10237802 3300025914 Unclassified 1430
324 Ga0207671_10281384 3300025914 Bacteria 1312
325 Ga0207693_10013473 3300025915 Bacteria 6593
326 Ga0207693_10023744 3300025915 Bacteria 4866
327 Ga0207693_10491992 3300025915 Bacteria 958
328 Ga0207663_10006140 3300025916 Bacteria 6119
329 Ga0207660_10002644 3300025917 Bacteria 11752
330 Ga0207660_10007938 3300025917 Bacteria 6866
331 Ga0207660_10015916 3300025917 Bacteria 4972
332 Ga0207660_10016174 3300025917 Bacteria 4935
333 Ga0207660_10046663 3300025917 Bacteria 3058
334 Ga0207660_10279036 3300025917 Unclassified 1326
335 Ga0207660_10433206 3300025917 Bacteria 1062
336 Ga0207662_10065689 3300025918 Bacteria 2185
337 Ga0207657_10044198 3300025919 Bacteria 3917
338 Ga0207657_10070695 3300025919 Bacteria 2957
339 Ga0207649_10001950 3300025920 Bacteria 11760
340 Ga0207649_10003020 3300025920 Bacteria 9265
341 Ga0207649_10189769 3300025920 Unclassified 1444
342 Ga0207649_10321677 3300025920 Bacteria 1137
343 Ga0207649_10414202 3300025920 Bacteria 1011
344 Ga0207652_10002042 3300025921 Bacteria 17365
345 Ga0207652_10026092 3300025921 Bacteria 4863
346 Ga0207652_10120243 3300025921 Bacteria 2336
347 Ga0207652_11236289 3300025921 Unclassified 649
348 Ga0207681_10302406 3300025923 Bacteria 1266
349 Ga0207694_10055410 3300025924 Bacteria 3078
350 Ga0207694_10629132 3300025924 Bacteria 903
351 Ga0207650_10080388 3300025925 Bacteria 2471
352 Ga0207650_10198859 3300025925 Bacteria 1604
353 Ga0207659_10002523 3300025926 Bacteria 10892
354 Ga0207659_10032453 3300025926 Unclassified 3585
355 Ga0207659_10091085 3300025926 Bacteria 2277
356 Ga0207659_10270958 3300025926 Bacteria 1385
357 Ga0207687_10001792 3300025927 Bacteria 14791
358 Ga0207687_10343176 3300025927 Bacteria 1215
359 Ga0207687_11048199 3300025927 Bacteria 700
360 Ga0207700_10000761 3300025928 Bacteria 18589
361 Ga0207700_10280223 3300025928 Bacteria 1434
362 Ga0207664_10148671 3300025929 Bacteria 1988
363 Ga0207644_10083659 3300025931 Bacteria 2364
364 Ga0207644_10737853 3300025931 Bacteria 822
365 Ga0207644_10814138 3300025931 Unclassified 781
366 Ga0207644_11164142 3300025931 Bacteria 648
367 Ga0207690_10017520 3300025932 Bacteria 4375
368 Ga0207690_10109177 3300025932 Bacteria 1990
369 Ga0207706_10000275 3300025933 Bacteria 55897
370 Ga0207706_10084989 3300025933 Bacteria 2782
371 Ga0207706_10708427 3300025933 Bacteria 860
372 Ga0207706_10766906 3300025933 Bacteria 821
373 Ga0207686_10033374 3300025934 Bacteria 3072
374 Ga0207686_10140185 3300025934 Bacteria 1670
375 Ga0207686_10761562 3300025934 Bacteria 774
376 Ga0207670_10015303 3300025936 Bacteria 4581
377 Ga0207670_10481478 3300025936 Bacteria 1005
378 Ga0207704_10159187 3300025938 Bacteria 1604
379 Ga0207665_10400058 3300025939 Bacteria 1046
380 Ga0207665_10493692 3300025939 Bacteria 945
381 Ga0207691_10000584 3300025940 Bacteria 36372
382 Ga0207691_10293582 3300025940 Bacteria 1398
383 Ga0207691_10337475 3300025940 Unclassified 1290
384 Ga0207691_10560819 3300025940 Bacteria 968
385 Ga0207711_10015035 3300025941 Bacteria 6428
386 Ga0207711_10104288 3300025941 Bacteria 2512
387 Ga0207689_10001654 3300025942 Bacteria 21134
388 Ga0207689_10022885 3300025942 Bacteria 5249
389 Ga0207689_10043902 3300025942 Bacteria 3695
390 Ga0207661_10000971 3300025944 Bacteria 18876
391 Ga0207661_10003483 3300025944 Bacteria 10931
392 Ga0207661_10003991 3300025944 Bacteria 10313
393 Ga0207661_10006939 3300025944 Bacteria 8033
394 Ga0207661_10048084 3300025944 Unclassified 3388
395 Ga0207661_10147392 3300025944 Bacteria 2032
396 Ga0207661_10259875 3300025944 Bacteria 1546
397 Ga0207661_10381830 3300025944 Bacteria 1275
398 Ga0207661_10622177 3300025944 Bacteria 992
399 Ga0207661_10824618 3300025944 Bacteria 854
400 Ga0207679_10000742 3300025945 Bacteria 21690
401 Ga0207679_10003250 3300025945 Bacteria 10039
402 Ga0207679_10034272 3300025945 Bacteria 3580
403 Ga0207679_10251133 3300025945 Bacteria 1504
404 Ga0207679_11001314 3300025945 Bacteria 766
405 Ga0207667_10049854 3300025949 Bacteria 4419
406 Ga0207651_11189960 3300025960 Bacteria 684
407 Ga0207651_11527283 3300025960 Bacteria 601
408 Ga0207712_10066835 3300025961 Bacteria 2571
409 Ga0207712_10251513 3300025961 Bacteria 1429
410 Ga0207712_11052719 3300025961 Bacteria 723
411 Ga0207712_11493534 3300025961 Bacteria 605
412 Ga0207668_10005372 3300025972 Bacteria 7537
413 Ga0207668_10099567 3300025972 Bacteria 2157
414 Ga0207668_11147364 3300025972 Bacteria 697
415 Ga0207640_10617756 3300025981 Bacteria 920
416 Ga0207640_11181961 3300025981 Bacteria 679
417 Ga0207658_10041222 3300025986 Bacteria 3342
418 Ga0207658_10340580 3300025986 Bacteria 1303
419 Ga0207658_10405434 3300025986 Bacteria 1199
420 Ga0207677_10013886 3300026023 Unclassified 4681
421 Ga0207677_10794847 3300026023 Bacteria 846
422 Ga0207703_11087096 3300026035 Bacteria 768
423 Ga0207703_11181738 3300026035 Bacteria 735
424 Ga0207703_11808522 3300026035 Unclassified 587
425 Ga0207639_10010377 3300026041 Bacteria 6450
426 Ga0207639_10540484 3300026041 Bacteria 1069
427 Ga0207639_11138371 3300026041 Bacteria 732
428 Ga0207678_10005576 3300026067 Bacteria 11249
429 Ga0207678_10204935 3300026067 Bacteria 1687
430 Ga0207708_10071794 3300026075 Bacteria 2652
431 Ga0207702_10091976 3300026078 Bacteria 2657
432 Ga0207702_10872631 3300026078 Bacteria 891
433 Ga0207641_10018563 3300026088 Bacteria 5702
434 Ga0207641_10032080 3300026088 Bacteria 4361
435 Ga0207641_10404074 3300026088 Bacteria 1312
436 Ga0207641_10930138 3300026088 Bacteria 864
437 Ga0207641_11446713 3300026088 Bacteria 689
438 Ga0207648_10060498 3300026089 Bacteria 3303
439 Ga0207648_10069598 3300026089 Bacteria 3066
440 Ga0207648_10105288 3300026089 Bacteria 2475
441 Ga0207648_10167784 3300026089 Bacteria 1940
442 Ga0207648_11073657 3300026089 Bacteria 755
443 Ga0207648_11227899 3300026089 Unclassified 704
444 Ga0207676_10004300 3300026095 Bacteria 10069
445 Ga0207676_11638132 3300026095 Bacteria 641
446 Ga0207676_11966015 3300026095 Bacteria 583
447 Ga0207674_10001970 3300026116 Bacteria 25988
448 Ga0207674_10014277 3300026116 Bacteria 8777
449 Ga0207674_10352024 3300026116 Unclassified 1424
450 Ga0207674_10943111 3300026116 Bacteria 831
451 Ga0207675_100000024 3300026118 Bacteria 114684
452 Ga0207675_100238483 3300026118 Bacteria 1757
453 Ga0207683_10048097 3300026121 Bacteria 3735
454 Ga0207683_10990014 3300026121 Bacteria 780
455 Ga0207698_10060612 3300026142 Bacteria 2943
456 Ga0207698_10167444 3300026142 Bacteria 1930
457 Ga0209969_1035775 3300027360 Unclassified 765
458 Ga0209967_1003665 3300027364 Bacteria 2026
459 Ga0209995_1032701 3300027471 Bacteria 873
460 Ga0209999_1000389 3300027543 Bacteria 6718
461 Ga0268266_11038206 3300028379 Bacteria 793
462 Ga0268265_10091362 3300028380 Bacteria 2434
463 Ga0268264_10088705 3300028381 Bacteria 2662
464 Ga0265336_10034216 3300028666 Unclassified 1571
465 Ga0307408_100024320 3300031548 Bacteria 4135
466 Ga0307408_100032008 3300031548 Bacteria 3666
467 Ga0307405_10017289 3300031731 Bacteria 3953
468 Ga0307405_10021331 3300031731 Bacteria 3639
469 Ga0307405_10037795 3300031731 Bacteria 2904
470 Ga0307413_10003310 3300031824 Bacteria 6762
471 Ga0307413_10009176 3300031824 Bacteria 4720
472 Ga0307413_10442105 3300031824 Bacteria 1030
473 Ga0307410_10020877 3300031852 Bacteria 4017
474 Ga0307410_10035042 3300031852 Bacteria 3256
475 Ga0307410_10292137 3300031852 Bacteria 1283
476 Ga0307410_11269062 3300031852 Bacteria 643
477 Ga0307410_11529782 3300031852 Bacteria 588
478 Ga0307406_10027766 3300031901 Bacteria 3413
479 Ga0307406_10075688 3300031901 Bacteria 2221
480 Ga0307406_11017811 3300031901 Bacteria 711
481 Ga0307407_10002879 3300031903 Bacteria 6875
482 Ga0307407_10013134 3300031903 Bacteria 4007
483 Ga0307407_10433192 3300031903 Bacteria 950
484 Ga0307412_10069916 3300031911 Bacteria 2391
485 Ga0307412_10078272 3300031911 Bacteria 2277
486 Ga0307412_10234804 3300031911 Bacteria 1414
487 Ga0307412_10846036 3300031911 Bacteria 798
488 Ga0307409_100023000 3300031995 Bacteria 4308
489 Ga0307409_100109413 3300031995 Bacteria 2313
490 Ga0307409_100130422 3300031995 Bacteria 2147
491 Ga0307409_100295876 3300031995 Bacteria 1503
492 Ga0307416_100018530 3300032002 Bacteria 4906
493 Ga0307416_100053738 3300032002 Bacteria 3233
494 Ga0307416_100420613 3300032002 Bacteria 1380
495 Ga0307416_100867061 3300032002 Bacteria 1002
496 Ga0307416_101547341 3300032002 Unclassified 769
497 Ga0307414_10021918 3300032004 Bacteria 4020
498 Ga0307414_10633072 3300032004 Bacteria 963
499 Ga0307414_11621789 3300032004 Bacteria 603
500 Ga0307411_10002090 3300032005 Bacteria 8611
501 Ga0307411_10015013 3300032005 Bacteria 4331
502 Ga0307411_10091977 3300032005 Bacteria 2120
503 Ga0307411_10100397 3300032005 Bacteria 2045
504 Ga0307415_100046708 3300032126 Bacteria 2910
505 Ga0307415_100094523 3300032126 Bacteria 2173
506 Ga0307415_100865034 3300032126 Bacteria 830
507 Ga0373930_0031814 3300034816 Bacteria 1089
508 Ga0373958_0049946 3300034819 Bacteria 881
509 Ga0373958_0214646 3300034819 Unclassified 509
510 Ga0373934_0003218 3300035086 Bacteria 5974
511 Ga0373952_0098134 3300035092 Bacteria 769
512 Ga0373936_0022943 3300035113 Bacteria 2430
513 Ga0373945_0146305 3300035116 Bacteria 955
514 Ga0373953_0036302 3300035117 Bacteria 1941
515 Ga0373954_0032243 3300035118 Bacteria 2422
516 Ga0373956_0164703 3300035119 Bacteria 1045
517 Ga0373957_0025995 3300035120 Bacteria 2114
518 Ga0373943_0012490 3300035170 Bacteria 3826
519 Ga0373943_0018176 3300035170 Bacteria 3227
520 Ga0373946_0046664 3300035171 Bacteria 1796
521 Ga0373955_0046457 3300035172 Bacteria 2347
522 Ga0373955_0068152 3300035172 Bacteria 1982
523 Ga0373962_0255191 3300035242 Bacteria 610
524 Ga0373931_0007353 3300035691 Bacteria 5184
525 Ga0373935_0011029 3300035692 Bacteria 5429
526 Ga0373935_0043710 3300035692 Bacteria 2821
527 Ga0373927_0008287 3300035695 Bacteria 6996
528 Ga0373927_0100434 3300035695 Bacteria 1881
529 Ga0373927_0106571 3300035695 Bacteria 1825
530 Ga0373933_0074592 3300035724 Bacteria 2069
531 Ga0373947_0004386 3300035725 Bacteria 8275
532 Ga0373947_0024620 3300035725 Bacteria 3508
533 Ga0373947_0405459 3300035725 Bacteria 920
534 Ga0373937_0022720 3300036401 Bacteria 5642
535 Ga0373937_0143934 3300036401 Bacteria 2231
536 Ga0373937_0350410 3300036401 Bacteria 1398
537 Ga0373925_0002571 3300037068 Bacteria 14449
538 Ga0373925_0029271 3300037068 Bacteria 4040
539 Ga0373925_0240586 3300037068 Bacteria 1449
540 Ga0395900_1298749 3300037418 Bacteria 642
541 Ga0436365_0913762 3300039437 Bacteria 1083
542 Ga0436365_0926121 3300039437 Bacteria 1257
543 Ga0436365_1120076 3300039437 Bacteria 11362
544 Ga0436365_1259863 3300039437 Bacteria 3800
545 Ga0439436_0162208 3300041404 Unclassified 632
546 Ga0451789_0714539 3300041443 Bacteria 541
547 Ga0451807_1500192 3300041486 Bacteria 636
548 Ga0439432_064920 3300042006 Unclassified 1120
549 Ga0439434_0009215 3300042435 Bacteria 2902
550 Ga0466966_0273362 3300044684 Bacteria 1017
551 Ga0466963_0816004 3300044694 Bacteria 658
552 Ga0453684_0627433 3300044712 Bacteria 1175
553 Ga0466971_0657367 3300044719 Bacteria 525
554 Ga0466959_0128805 3300045049 Bacteria 1794
555 Ga0451576_0216472 3300045051 Bacteria 2000
556 Ga0451576_0524362 3300045051 Bacteria 1245
557 Ga0466958_0780291 3300045836 Bacteria 623
558 Ga0466967_0325908 3300045976 Bacteria 1482
559 Ga0466967_1467276 3300045976 Bacteria 679
560 Ga0466967_1908825 3300045976 Bacteria 591
561 Ga0495592_0334527 3300046454 Bacteria 975
562 Ga0495603_0175017 3300046455 Bacteria 1242
563 Ga0495629_0050367 3300046459 Bacteria 2917
564 Ga0495629_0085120 3300046459 Bacteria 2206
565 Ga0495629_0111095 3300046459 Unclassified 1911
566 Ga0495629_0150540 3300046459 Bacteria 1617
567 Ga0495651_0033027 3300046462 Bacteria 4037
568 Ga0495651_0045053 3300046462 Bacteria 3418
569 Ga0495651_0826745 3300046462 Bacteria 570
570 Ga0495653_0049858 3300046463 Bacteria 3222
571 Ga0495580_0015585 3300046472 Bacteria 5729
572 Ga0495580_0051511 3300046472 Bacteria 2910
573 Ga0495580_0538440 3300046472 Bacteria 776
574 Ga0495582_0013845 3300046473 Bacteria 4442
575 Ga0495582_0054033 3300046473 Bacteria 2215
576 Ga0495582_0090315 3300046473 Bacteria 1708
577 Ga0495582_0115854 3300046473 Bacteria 1507
578 Ga0495639_0021813 3300046475 Bacteria 2805
579 Ga0495639_0035020 3300046475 Bacteria 2246
580 Ga0495639_0219009 3300046475 Bacteria 935
581 Ga0495639_0522982 3300046475 Bacteria 607
582 Ga0495662_0387188 3300046476 Bacteria 687
583 Ga0495664_0235135 3300046477 Bacteria 1108
584 Ga0495664_0313688 3300046477 Bacteria 946
585 Ga0495594_0019041 3300046499 Bacteria 3645
586 Ga0495594_0301791 3300046499 Bacteria 912
587 Ga0495608_0433228 3300046511 Bacteria 801
588 Ga0495618_0290666 3300046514 Bacteria 1017
589 Ga0495628_0048501 3300046516 Bacteria 3366
590 Ga0495628_0048929 3300046516 Bacteria 3349
591 Ga0495630_0026666 3300046517 Bacteria 4280
592 Ga0495630_0083658 3300046517 Bacteria 2409
593 Ga0495630_0165885 3300046517 Bacteria 1681
594 Ga0495631_0392248 3300046518 Bacteria 591
595 Ga0495663_0137203 3300046525 Unclassified 828
596 Ga0495666_0118576 3300046526 Bacteria 1240
597 Ga0495666_0146763 3300046526 Bacteria 1098
598 Ga0495652_0041281 3300046529 Bacteria 3984
599 Ga0495665_0000002 3300046531 Bacteria 128983
600 Ga0495665_0011417 3300046531 Bacteria 4806
601 Ga0495665_0032921 3300046531 Bacteria 2773
602 Ga0495586_0007879 3300046535 Bacteria 5679
603 Ga0495586_0054782 3300046535 Bacteria 2162
604 Ga0495586_0604106 3300046535 Bacteria 634
605 Ga0495587_0019535 3300046536 Bacteria 4191
606 Ga0495587_0451651 3300046536 Bacteria 712
607 Ga0495645_0000434 3300046543 Bacteria 28778
608 Ga0495645_0013547 3300046543 Bacteria 5769
609 Ga0495645_0155242 3300046543 Bacteria 1586
610 Ga0495645_0892108 3300046543 Bacteria 528
611 Ga0495622_0174452 3300046557 Bacteria 966
612 Ga0495667_0005890 3300046559 Bacteria 8300
613 Ga0495667_0559884 3300046559 Bacteria 714
614 Ga0495635_0366769 3300046663 Bacteria 959
615 Ga0495588_0048448 3300046674 Bacteria 2183
616 Ga0495599_0003827 3300046678 Bacteria 8837
617 Ga0495599_0007900 3300046678 Bacteria 6452
618 Ga0495623_0003862 3300046679 Bacteria 9882
619 Ga0495623_0064790 3300046679 Bacteria 2286
620 Ga0495646_0086687 3300046680 Bacteria 1815
621 Ga0495658_0001154 3300046683 Bacteria 13945
622 Ga0495658_0027774 3300046683 Bacteria 3049
623 Ga0495658_0107100 3300046683 Bacteria 1676
624 Ga0495658_0599343 3300046683 Bacteria 706
625 Ga0495613_0091975 3300046689 Bacteria 2197
626 Ga0495613_0153980 3300046689 Bacteria 1638
627 Ga0495613_0267914 3300046689 Bacteria 1189
628 Ga0495600_0042501 3300046809 Bacteria 2963
629 Ga0495581_0010014 3300047315 Bacteria 5482
630 Ga0495581_0035806 3300047315 Bacteria 2871
631 Ga0495581_0222796 3300047315 Bacteria 1103
632 Ga0495604_0116688 3300047317 Bacteria 1937
633 Ga0495674_0025758 3300047319 Bacteria 5387
634 Ga0495674_0151124 3300047319 Bacteria 1947
635 Ga0495674_0318343 3300047319 Bacteria 1268
636 Ga0495680_0564429 3300047322 Bacteria 765
637 Ga0495675_0005416 3300047444 Bacteria 7779
638 Ga0495675_0071858 3300047444 Bacteria 2183
639 Ga0495684_0075212 3300047471 Bacteria 2566
640 Ga0495684_0179205 3300047471 Bacteria 1571
641 Ga0495593_0002824 3300047673 Bacteria 10453
642 Ga0495602_0039710 3300048088 Bacteria 4329
643 Ga0495602_0406036 3300048088 Bacteria 970
644 Ga0495614_0002950 3300048089 Bacteria 7581
645 Ga0496101_1363238 3300048904 Unclassified 554
646 Ga0496104_0082017 3300048907 Bacteria 3076
647 Ga0496104_0852375 3300048907 Bacteria 817
648 Ga0496106_0192016 3300048909 Bacteria 1624
649 Ga0496108_0066770 3300048911 Bacteria 3034
650 Ga0496108_1337475 3300048911 Bacteria 601
651 Ga0496110_0834328 3300048913 Bacteria 827
652 Ga0496112_0000455 3300048915 Bacteria 27321
653 Ga0496112_0424186 3300048915 Bacteria 1269
654 Ga0496113_0551632 3300048916 Bacteria 924
655 Ga0501032_0108290 3300049569 Bacteria 1840
656 Ga0501033_0154258 3300049570 Bacteria 1655
657 Ga0501036_0412101 3300049572 Bacteria 1127
658 Ga0501037_0370349 3300049573 Bacteria 986
659 Ga0501038_0029119 3300049574 Bacteria 4898
660 Ga0501039_0964762 3300049575 Bacteria 663
661 Ga0501221_203708 3300049704 Bacteria 551
662 Ga0501264_038565 3300049761 Bacteria 578
663 Ga0501268_085623 3300049765 Bacteria 657
664 Ga0501035_0015752 3300049822 Bacteria 6978
665 Ga0501044_0003693 3300049823 Bacteria 17206
666 nmdc:mga05p37_50995_c1 3300050507 Bacteria 5089
667 nmdc:mga09592_50502_c1 3300050508 Bacteria 3508
668 nmdc:mga06r32_14894_c1 3300050510 Bacteria 2692
669 nmdc:mga08y16_500807_c1 3300050511 Bacteria 1234
670 nmdc:mga08y16_543251_c1 3300050511 Bacteria 1177
671 nmdc:mga0n895_49256_c1 3300050512 Unclassified 4126
672 nmdc:mga0n895_5467_c1 3300050512 Bacteria 10628
673 nmdc:mga0rr50_170291_c1 3300050513 Bacteria 1774
674 nmdc:mga0rr50_278354_c1 3300050513 Bacteria 1396
675 nmdc:mga08x19_438262_c1 3300050514 Unclassified 919
676 nmdc:mga0a205_176878_c1 3300050515 Bacteria 1119
677 nmdc:mga0a205_483_c1 3300050515 Bacteria 31141
678 Ga0495601_0107467 3300053077 Bacteria 1805
679 Ga0495612_0083230 3300053078 Bacteria 1346
680 Ga0495595_0071813 3300053084 Bacteria 1637
681 Ga0495595_0299721 3300053084 Bacteria 808
682 Ga0495619_0145592 3300053085 Bacteria 1633
683 Ga0453684_2327938
684 Ga0065704_10722632
685 Ga0065712_10122204
686 Ga0065712_10756732
687 Ga0065715_10843599
688 Ga0070658_10084560
689 Ga0070658_10748248
690 Ga0070676_10143543
691 Ga0070683_100002579
692 Ga0070683_100007126
693 Ga0070683_100014821
694 Ga0070683_100025087
695 Ga0070683_100227133
696 Ga0070683_100231849
697 Ga0070683_100237127
698 Ga0070683_100986243
699 Ga0070683_101023750
700 Ga0070690_100159903
701 Ga0070690_100640214
702 Ga0070690_101773388
703 Ga0070670_100004220
704 Ga0070670_100116937
705 Ga0070670_100678403
706 Ga0070670_100700000
707 Ga0068869_100007736
708 Ga0068869_100487286
709 Ga0068869_100675782
710 Ga0070666_10136637
711 Ga0070666_10140093
712 Ga0070680_100001330
713 Ga0070680_100003409
714 Ga0070680_100016629
715 Ga0070680_100039210
716 Ga0070680_100092716
717 Ga0070680_101490479
718 Ga0070682_100002340
719 Ga0070682_100190019
720 Ga0068868_100034526
721 Ga0068868_100321829
722 Ga0070660_100013657
723 Ga0070689_100023697
724 Ga0070689_100157111
725 Ga0070689_100397348
726 Ga0070687_100051967
727 Ga0070687_100265455
728 Ga0070687_100469544
729 Ga0070661_100002591
730 Ga0070661_100002596
731 Ga0070661_100241719
732 Ga0070661_100443747
733 Ga0070692_10009163
734 Ga0070668_100004250
735 Ga0070669_100581621
736 Ga0070675_100000614
737 Ga0070675_100001151
738 Ga0070675_100012803
739 Ga0070675_100078140
740 Ga0070675_100336785
741 Ga0070671_100045305
742 Ga0070671_101683913
743 Ga0070673_100018860
744 Ga0070673_100096896
745 Ga0070673_100766317
746 Ga0070688_100106583
747 Ga0070667_100078499
748 Ga0070667_100115830
749 Ga0070667_100982125
750 Ga0070709_10021656
751 Ga0070709_10330973
752 Ga0070709_10383201
753 Ga0070714_100056051
754 Ga0070714_100298233
755 Ga0070714_101168609
756 Ga0070713_100000638
757 Ga0070713_100013386
758 Ga0070713_100168974
759 Ga0070713_101190559
760 Ga0070710_10581799
761 Ga0070710_10641462
762 Ga0070710_10663287
763 Ga0070701_10792334
764 Ga0070711_100035827
765 Ga0070711_100151999
766 Ga0070705_100091682
767 Ga0070700_100025189
768 Ga0070694_100022034
769 Ga0070694_100609750
770 Ga0070663_100087251
771 Ga0070663_100203014
772 Ga0070663_100415232
773 Ga0070678_102263786
774 Ga0070662_100004182
775 Ga0070662_100010940
776 Ga0070662_100262469
777 Ga0070662_100900771
778 Ga0070681_10001324
779 Ga0070681_10001615
780 Ga0070681_10033749
781 Ga0070681_10108274
782 Ga0068867_100131034
783 Ga0068867_100132346
784 Ga0068867_100509428
785 Ga0068867_101613174
786 Ga0070685_10048293
787 Ga0070685_10131623
788 Ga0070706_100329629
789 Ga0070698_100488561
790 Ga0070699_100073972
791 Ga0070679_100000787
792 Ga0070679_100004367
793 Ga0070679_100031976
794 Ga0070679_100035033
795 Ga0070679_100248917
796 Ga0070679_101572567
797 Ga0070684_100009266
798 Ga0070684_100016464
799 Ga0070684_100039400
800 Ga0070684_100042386
801 Ga0070684_100043168
802 Ga0070684_100107499
803 Ga0070684_100285912
804 Ga0070684_100445262
805 Ga0070684_101118033
806 Ga0070697_100352331
807 Ga0070697_101013052
808 Ga0068853_100011960
809 Ga0068853_100452563
810 Ga0070672_100021857
811 Ga0070672_100143876
812 Ga0070672_100362896
813 Ga0070672_100676404
814 Ga0070672_100969631
815 Ga0070672_101540810
816 Ga0070686_100022305
817 Ga0070686_100163398
818 Ga0070686_100173752
819 Ga0070686_100392142
820 Ga0070686_100527106
821 Ga0070686_100889634
822 Ga0070695_100018239
823 Ga0070695_100280519
824 Ga0070695_100347573
825 Ga0070693_100002969
826 Ga0070693_100007400
827 Ga0070665_100340877
828 Ga0068855_100023136
829 Ga0068855_100041449
830 Ga0070664_100014208
831 Ga0070664_100074128
832 Ga0070664_100282363
833 Ga0070664_100755721
834 Ga0070664_100861485
835 Ga0070664_102141890
836 Ga0068857_100003632
837 Ga0068857_100239745
838 Ga0068854_100938118
839 Ga0068854_101080724
840 Ga0068856_100050948
841 Ga0068856_100142417
842 Ga0068856_100382598
843 Ga0070702_100001484
844 Ga0070702_100101897
845 Ga0068852_100020759
846 Ga0068852_100035887
847 Ga0068852_100160715
848 Ga0068852_100796547
849 Ga0068859_100254580
850 Ga0068859_101135235
851 Ga0068864_100000958
852 Ga0068864_101010550
853 Ga0068864_101551379
854 Ga0068861_100010083
855 Ga0068863_100003601
856 Ga0068863_100419439
857 Ga0068863_100827857
858 Ga0068863_100943590
859 Ga0068858_100007492
860 Ga0068858_100288323
861 Ga0068858_100381604
862 Ga0068858_101261027
863 Ga0068858_102288096
864 Ga0068860_100033339
865 Ga0068860_100211902
866 Ga0068862_100006221
867 Ga0068862_100209583
868 Ga0081455_10220892
869 Ga0070717_10000619
870 Ga0070716_100175298
871 Ga0070716_100331654
872 Ga0070716_100405773
873 Ga0070716_100783559
874 Ga0070712_100002060
875 Ga0070712_100027283
876 Ga0070712_100186101
877 Ga0070712_101462961
878 Ga0097621_100007580
879 Ga0097621_100556097
880 Ga0097621_100631068
881 Ga0068871_100002756
882 Ga0068871_100417975
883 Ga0068871_101511102
884 Ga0075428_100039578
885 Ga0075431_100126614
886 Ga0075433_10001166
887 Ga0075433_10487541
888 Ga0075434_100002182
889 Ga0075434_100006854
890 Ga0075434_100422148
891 Ga0075429_100053936
892 Ga0075429_101016726
893 Ga0068865_100070922
894 Ga0068865_100205393
895 Ga0075436_100074466
896 Ga0097620_100254581
897 Ga0097620_101135588
898 Ga0075435_100182870
899 Ga0075435_100279869
900 Ga0075435_100609643
901 Ga0105240_10310156
902 Ga0111539_10367398
903 Ga0105245_10013650
904 Ga0105245_10092424
905 Ga0105245_10288425
906 Ga0105245_10634073
907 Ga0105245_10738954
908 Ga0114129_10011769
909 Ga0105243_11039684
910 Ga0105243_11676809
911 Ga0105242_10002909
912 Ga0105242_10092017
913 Ga0105242_10274127
914 Ga0105242_10630729
915 Ga0105242_11213441
916 Ga0105242_12641610
917 Ga0105242_13036493
918 Ga0105248_10008052
919 Ga0105248_10009723
920 Ga0105248_10039903
921 Ga0105248_10120305
922 Ga0105248_10194639
923 Ga0105237_10197758
924 Ga0105238_10093063
925 Ga0105238_10321514
926 Ga0105249_10001625
927 Ga0105249_10028962
928 Ga0105249_10083563
929 Ga0105249_12361413
930 Ga0105239_10004674
931 Ga0105239_10012403
932 Ga0105239_10807068
933 Ga0105246_10000636
934 Ga0105246_10880280
935 Ga0157373_10524208
936 Ga0157373_11095391
937 Ga0157371_10007979
938 Ga0157371_10016443
939 Ga0157370_10005010
940 Ga0157370_10102918
941 Ga0157370_10932987
942 Ga0157369_10057352
943 Ga0157369_10359699
944 Ga0157369_10425700
945 Ga0157369_10865451
946 Ga0157374_11268075
947 Ga0157378_10461509
948 Ga0157378_10653132
949 Ga0157378_11105739
950 Ga0163162_10013676
951 Ga0163162_10113424
952 Ga0163162_10555523
953 Ga0163162_10566007
954 Ga0163162_12568954
955 Ga0157372_10007301
956 Ga0157372_10011535
957 Ga0157372_10041964
958 Ga0157372_10200515
959 Ga0157372_10271709
960 Ga0157372_10302387
961 Ga0157372_10467709
962 Ga0157372_11207475
963 Ga0157372_11268427
964 Ga0157372_12325791
965 Ga0157375_10006597
966 Ga0157375_10015896
967 Ga0157375_10023973
968 Ga0157375_10364044
969 Ga0157375_10595927
970 Ga0163163_10043209
971 Ga0163163_10052345
972 Ga0163163_10729676
973 Ga0157380_10931762
974 Ga0157377_10003039
975 Ga0157379_10004564
976 Ga0157379_10236224
977 Ga0157379_12234015
978 Ga0157376_10090989
979 Ga0157376_10184103
980 Ga0182007_10206378
981 Ga0163161_10036934
982 Ga0206356_10121704
983 Ga0213876_10054931
984 Ga0207697_10008958
985 Ga0207697_10026387
986 Ga0207656_10070754
987 Ga0207692_10255709
988 Ga0207692_10411288
989 Ga0207680_10068643
990 Ga0207680_10306289
991 Ga0207647_10038248
992 Ga0207699_10003311
993 Ga0207699_10316585
994 Ga0207645_10079849
995 Ga0207645_10123571
996 Ga0207705_10163224
997 Ga0207684_10075761
998 Ga0207684_11500758
999 Ga0207707_10007918
1000 Ga0207707_10018128
1001 Ga0207707_10023854
1002 Ga0207707_11326361
1003 Ga0207695_10002723
1004 Ga0207695_10998213
1005 Ga0207671_10237802
1006 Ga0207671_10281384
1007 Ga0207693_10013473
1008 Ga0207693_10023744
1009 Ga0207693_10491992
1010 Ga0207663_10006140
1011 Ga0207660_10002644
1012 Ga0207660_10007938
1013 Ga0207660_10015916
1014 Ga0207660_10016174
1015 Ga0207660_10046663
1016 Ga0207660_10279036
1017 Ga0207660_10433206
1018 Ga0207662_10065689
1019 Ga0207657_10044198
1020 Ga0207657_10070695
1021 Ga0207649_10001950
1022 Ga0207649_10003020
1023 Ga0207649_10189769
1024 Ga0207649_10321677
1025 Ga0207649_10414202
1026 Ga0207652_10002042
1027 Ga0207652_10026092
1028 Ga0207652_10120243
1029 Ga0207652_11236289
1030 Ga0207681_10302406
1031 Ga0207694_10055410
1032 Ga0207694_10629132
1033 Ga0207650_10080388
1034 Ga0207650_10198859
1035 Ga0207659_10002523
1036 Ga0207659_10032453
1037 Ga0207659_10091085
1038 Ga0207659_10270958
1039 Ga0207687_10001792
1040 Ga0207687_10343176
1041 Ga0207687_11048199
1042 Ga0207700_10000761
1043 Ga0207700_10280223
1044 Ga0207664_10148671
1045 Ga0207644_10083659
1046 Ga0207644_10737853
1047 Ga0207644_10814138
1048 Ga0207644_11164142
1049 Ga0207690_10017520
1050 Ga0207690_10109177
1051 Ga0207706_10000275
1052 Ga0207706_10084989
1053 Ga0207706_10708427
1054 Ga0207706_10766906
1055 Ga0207686_10033374
1056 Ga0207686_10140185
1057 Ga0207686_10761562
1058 Ga0207670_10015303
1059 Ga0207670_10481478
1060 Ga0207704_10159187
1061 Ga0207665_10400058
1062 Ga0207665_10493692
1063 Ga0207691_10000584
1064 Ga0207691_10293582
1065 Ga0207691_10337475
1066 Ga0207691_10560819
1067 Ga0207711_10015035
1068 Ga0207711_10104288
1069 Ga0207689_10001654
1070 Ga0207689_10022885
1071 Ga0207689_10043902
1072 Ga0207661_10000971
1073 Ga0207661_10003483
1074 Ga0207661_10003991
1075 Ga0207661_10006939
1076 Ga0207661_10048084
1077 Ga0207661_10147392
1078 Ga0207661_10259875
1079 Ga0207661_10381830
1080 Ga0207661_10622177
1081 Ga0207661_10824618
1082 Ga0207679_10000742
1083 Ga0207679_10003250
1084 Ga0207679_10034272
1085 Ga0207679_10251133
1086 Ga0207679_11001314
1087 Ga0207667_10049854
1088 Ga0207651_11189960
1089 Ga0207651_11527283
1090 Ga0207712_10066835
1091 Ga0207712_10251513
1092 Ga0207712_11052719
1093 Ga0207712_11493534
1094 Ga0207668_10005372
1095 Ga0207668_10099567
1096 Ga0207668_11147364
1097 Ga0207640_10617756
1098 Ga0207640_11181961
1099 Ga0207658_10041222
1100 Ga0207658_10340580
1101 Ga0207658_10405434
1102 Ga0207677_10013886
1103 Ga0207677_10794847
1104 Ga0207703_11087096
1105 Ga0207703_11181738
1106 Ga0207703_11808522
1107 Ga0207639_10010377
1108 Ga0207639_10540484
1109 Ga0207639_11138371
1110 Ga0207678_10005576
1111 Ga0207678_10204935
1112 Ga0207708_10071794
1113 Ga0207702_10091976
1114 Ga0207702_10872631
1115 Ga0207641_10018563
1116 Ga0207641_10032080
1117 Ga0207641_10404074
1118 Ga0207641_10930138
1119 Ga0207641_11446713
1120 Ga0207648_10060498
1121 Ga0207648_10069598
1122 Ga0207648_10105288
1123 Ga0207648_10167784
1124 Ga0207648_11073657
1125 Ga0207648_11227899
1126 Ga0207676_10004300
1127 Ga0207676_11638132
1128 Ga0207676_11966015
1129 Ga0207674_10001970
1130 Ga0207674_10014277
1131 Ga0207674_10352024
1132 Ga0207674_10943111
1133 Ga0207675_100000024
1134 Ga0207675_100238483
1135 Ga0207683_10048097
1136 Ga0207683_10990014
1137 Ga0207698_10060612
1138 Ga0207698_10167444
1139 Ga0209969_1035775
1140 Ga0209967_1003665
1141 Ga0209995_1032701
1142 Ga0209999_1000389
1143 Ga0268266_11038206
1144 Ga0268265_10091362
1145 Ga0268264_10088705
1146 Ga0265336_10034216
1147 Ga0307408_100024320
1148 Ga0307408_100032008
1149 Ga0307405_10017289
1150 Ga0307405_10021331
1151 Ga0307405_10037795
1152 Ga0307413_10003310
1153 Ga0307413_10009176
1154 Ga0307413_10442105
1155 Ga0307410_10020877
1156 Ga0307410_10035042
1157 Ga0307410_10292137
1158 Ga0307410_11269062
1159 Ga0307410_11529782
1160 Ga0307406_10027766
1161 Ga0307406_10075688
1162 Ga0307406_11017811
1163 Ga0307407_10002879
1164 Ga0307407_10013134
1165 Ga0307407_10433192
1166 Ga0307412_10069916
1167 Ga0307412_10078272
1168 Ga0307412_10234804
1169 Ga0307412_10846036
1170 Ga0307409_100023000
1171 Ga0307409_100109413
1172 Ga0307409_100130422
1173 Ga0307409_100295876
1174 Ga0307416_100018530
1175 Ga0307416_100053738
1176 Ga0307416_100420613
1177 Ga0307416_100867061
1178 Ga0307416_101547341
1179 Ga0307414_10021918
1180 Ga0307414_10633072
1181 Ga0307414_11621789
1182 Ga0307411_10002090
1183 Ga0307411_10015013
1184 Ga0307411_10091977
1185 Ga0307411_10100397
1186 Ga0307415_100046708
1187 Ga0307415_100094523
1188 Ga0307415_100865034
1189 Ga0373930_0031814
1190 Ga0373958_0049946
1191 Ga0373958_0214646
1192 Ga0373934_0003218
1193 Ga0373952_0098134
1194 Ga0373936_0022943
1195 Ga0373945_0146305
1196 Ga0373953_0036302
1197 Ga0373954_0032243
1198 Ga0373956_0164703
1199 Ga0373957_0025995
1200 Ga0373943_0012490
1201 Ga0373943_0018176
1202 Ga0373946_0046664
1203 Ga0373955_0046457
1204 Ga0373955_0068152
1205 Ga0373962_0255191
1206 Ga0373931_0007353
1207 Ga0373935_0011029
1208 Ga0373935_0043710
1209 Ga0373927_0008287
1210 Ga0373927_0100434
1211 Ga0373927_0106571
1212 Ga0373933_0074592
1213 Ga0373947_0004386
1214 Ga0373947_0024620
1215 Ga0373947_0405459
1216 Ga0373937_0022720
1217 Ga0373937_0143934
1218 Ga0373937_0350410
1219 Ga0373925_0002571
1220 Ga0373925_0029271
1221 Ga0373925_0240586
1222 Ga0395900_1298749
1223 Ga0436365_0913762
1224 Ga0436365_0926121
1225 Ga0436365_1120076
1226 Ga0436365_1259863
1227 Ga0439436_0162208
1228 Ga0451789_0714539
1229 Ga0451807_1500192
1230 Ga0439432_064920
1231 Ga0439434_0009215
1232 Ga0466966_0273362
1233 Ga0466963_0816004
1234 Ga0453684_0627433
1235 Ga0466971_0657367
1236 Ga0466959_0128805
1237 Ga0451576_0216472
1238 Ga0451576_0524362
1239 Ga0466958_0780291
1240 Ga0466967_0325908
1241 Ga0466967_1467276
1242 Ga0466967_1908825
1243 Ga0495592_0334527
1244 Ga0495603_0175017
1245 Ga0495629_0050367
1246 Ga0495629_0085120
1247 Ga0495629_0111095
1248 Ga0495629_0150540
1249 Ga0495651_0033027
1250 Ga0495651_0045053
1251 Ga0495651_0826745
1252 Ga0495653_0049858
1253 Ga0495580_0015585
1254 Ga0495580_0051511
1255 Ga0495580_0538440
1256 Ga0495582_0013845
1257 Ga0495582_0054033
1258 Ga0495582_0090315
1259 Ga0495582_0115854
1260 Ga0495639_0021813
1261 Ga0495639_0035020
1262 Ga0495639_0219009
1263 Ga0495639_0522982
1264 Ga0495662_0387188
1265 Ga0495664_0235135
1266 Ga0495664_0313688
1267 Ga0495594_0019041
1268 Ga0495594_0301791
1269 Ga0495608_0433228
1270 Ga0495618_0290666
1271 Ga0495628_0048501
1272 Ga0495628_0048929
1273 Ga0495630_0026666
1274 Ga0495630_0083658
1275 Ga0495630_0165885
1276 Ga0495631_0392248
1277 Ga0495663_0137203
1278 Ga0495666_0118576
1279 Ga0495666_0146763
1280 Ga0495652_0041281
1281 Ga0495665_0000002
1282 Ga0495665_0011417
1283 Ga0495665_0032921
1284 Ga0495586_0007879
1285 Ga0495586_0054782
1286 Ga0495586_0604106
1287 Ga0495587_0019535
1288 Ga0495587_0451651
1289 Ga0495645_0000434
1290 Ga0495645_0013547
1291 Ga0495645_0155242
1292 Ga0495645_0892108
1293 Ga0495622_0174452
1294 Ga0495667_0005890
1295 Ga0495667_0559884
1296 Ga0495635_0366769
1297 Ga0495588_0048448
1298 Ga0495599_0003827
1299 Ga0495599_0007900
1300 Ga0495623_0003862
1301 Ga0495623_0064790
1302 Ga0495646_0086687
1303 Ga0495658_0001154
1304 Ga0495658_0027774
1305 Ga0495658_0107100
1306 Ga0495658_0599343
1307 Ga0495613_0091975
1308 Ga0495613_0153980
1309 Ga0495613_0267914
1310 Ga0495600_0042501
1311 Ga0495581_0010014
1312 Ga0495581_0035806
1313 Ga0495581_0222796
1314 Ga0495604_0116688
1315 Ga0495674_0025758
1316 Ga0495674_0151124
1317 Ga0495674_0318343
1318 Ga0495680_0564429
1319 Ga0495675_0005416
1320 Ga0495675_0071858
1321 Ga0495684_0075212
1322 Ga0495684_0179205
1323 Ga0495593_0002824
1324 Ga0495602_0039710
1325 Ga0495602_0406036
1326 Ga0495614_0002950
1327 Ga0496101_1363238
1328 Ga0496104_0082017
1329 Ga0496104_0852375
1330 Ga0496106_0192016
1331 Ga0496108_0066770
1332 Ga0496108_1337475
1333 Ga0496110_0834328
1334 Ga0496112_0000455
1335 Ga0496112_0424186
1336 Ga0496113_0551632
1337 Ga0501032_0108290
1338 Ga0501033_0154258
1339 Ga0501036_0412101
1340 Ga0501037_0370349
1341 Ga0501038_0029119
1342 Ga0501039_0964762
1343 Ga0501221_203708
1344 Ga0501264_038565
1345 Ga0501268_085623
1346 Ga0501035_0015752
1347 Ga0501044_0003693
1348 nmdc:mga05p37_50995_c1
1349 nmdc:mga09592_50502_c1
1350 nmdc:mga06r32_14894_c1
1351 nmdc:mga08y16_500807_c1
1352 nmdc:mga08y16_543251_c1
1353 nmdc:mga0n895_49256_c1
1354 nmdc:mga0n895_5467_c1
1355 nmdc:mga0rr50_170291_c1
1356 nmdc:mga0rr50_278354_c1
1357 nmdc:mga08x19_438262_c1
1358 nmdc:mga0a205_176878_c1
1359 nmdc:mga0a205_483_c1
1360 Ga0495601_0107467
1361 Ga0495612_0083230
1362 Ga0495595_0071813
1363 Ga0495595_0299721
1364 Ga0495619_0145592

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01242

PTPS

6-pyruvoyl tetrahydropterin synthase

5

138

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1b66-assembly1.cif.gz_A 6-pyruvoyl tetrahydropterin synthase 0.9599 2 137
3i2b-assembly3.cif.gz_I the crystal structure of human 6 pyruvoyl tetrahydrobiopterin synthase 0.9593 2 137
1b66-assembly1.cif.gz_A 6-pyruvoyl tetrahydropterin synthase 0.9463 2 137
3i2b-assembly3.cif.gz_I the crystal structure of human 6 pyruvoyl tetrahydrobiopterin synthase 0.9458 2 137
2oba-assembly1.cif.gz_D pseudomonas aeruginosa 6-pyruvoyl tetrahydrobiopterin synthase 0.9405 2 137
ID Description Score Start End Superfamily
af_Q1ZXI0_1_135_3.30.479.10 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.9573 2 137 3.30.479.10
4ntmA00 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.9422 4 136 3.30.479.10
2g64A00 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.9374 1 137 3.30.479.10
af_Q1ZXI0_1_135_3.30.479.10 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.9369 2 137 3.30.479.10
2g64A00 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.9309 1 137 3.30.479.10
ID Description Score Start End GO Terms
AF-A0A2G4FSK3-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) 0.9961 1 137 GO:0046872
GO:0070497
AF-A0A6N6PEI1-F1-model_v4 deleted 0.9915 2 137
AF-A0A519TRD3-F1-model_v4 deleted 0.9905 4 110
AF-A0A7Y3P1M6-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) 0.9898 4 113 GO:0016829
GO:0046872
AF-A0A7Y5BAF7-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.-.-.-) 0.9897 4 136 GO:0008616
GO:0016829
GO:0046872

Map