F474875

General Info

Members Datasets Scaffolds Average Seq Length
681 536 319 345

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2643221595|2643986455
Length 397
Sequence VANVRKEFDRFPALHDVSLDIKSGELIALLGPSGSGKTTLLRLIAGLERPTRGNIFFGDEDASHKSIQDRNVGFVFQHYALFRHMTVADNIGFGLKVRHGPSRPPAQEIRRRASELLDLVQLSGLEKRYPAQLSGGQRQRVALARAMAIEPKVLLLDEPFGALDAQVRRELRRWLREIHDATGHTTVFVTHDQEEALELADRVVVMSQGRIEQVGTADDIYDTPNSPFVYGFIGESSSLSVKVENGEIWLADRPIGLAAPNEPAGDATLYFRPHHVELLDGCSGCIAGTVAASRRVAGTRRVELEIGGERQRVEIELPVDHPAAQKSRVAFRPGRWKLFPAXAPAGRNRTAGRPPRGPEKPGGVPPRTLEAVSGVVDCNPESHVCACELQETGFGKA

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
3 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
4 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
5 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
6 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
7 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
8 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
9 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
10 2512875024 Mesorhizobium loti R88b Isolate Nodule
11 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
12 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
13 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
14 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
15 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
16 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
17 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
18 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
19 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
20 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
21 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
22 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
23 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
24 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
25 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
26 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
27 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
28 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
29 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
30 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
31 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
32 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
33 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
34 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
35 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
36 2643221558 Rhizobium sp. Root149 Isolate Unclassified
37 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
38 2643221568 Rhizobium sp. Root564 Isolate Unclassified
39 2643221580 Devosia sp. Root635 Isolate Unclassified
40 2643221582 Rhizobium sp. Root651 Isolate Unclassified
41 2643221591 Devosia sp. Root685 Isolate Unclassified
42 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
43 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
44 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
45 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
46 2643221674 Devosia sp. Root436 Isolate Unclassified
47 2643221693 Rhizobium sp. Root491 Isolate Unclassified
48 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
49 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
50 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
51 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
52 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
53 2738541293 Rhizobium sp. GV031 Isolate Unclassified
54 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
55 2738543024 Aminobacter sp. AP02 Isolate Unclassified
56 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
57 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
58 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
59 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
60 2791355265 Rhizobium sp. H4 Isolate Nodule
61 2802429633 Rhizobium anhuiense J3 Isolate Nodule
62 2802429634 Rhizobium anhuiense S10 Isolate Nodule
63 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
64 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
65 2802429637 Rhizobium anhuiense C15 Isolate Nodule
66 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
67 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
68 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
69 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
70 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
71 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
72 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
73 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
74 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
75 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
76 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
77 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
78 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
79 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
80 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
81 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
82 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
83 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
84 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
85 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
86 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
87 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
88 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
89 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
90 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
91 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
92 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
93 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
94 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
95 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
96 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
97 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
98 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
99 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
100 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
101 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
102 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
103 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
104 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
105 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
106 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
107 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
108 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
109 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
110 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
111 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
112 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
113 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
114 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
115 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
116 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
117 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
118 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
119 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
120 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
121 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
122 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
123 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
124 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
125 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
126 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
127 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
128 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
129 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
130 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
131 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
132 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
133 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
134 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
135 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
136 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
137 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
138 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
139 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
140 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
141 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
142 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
143 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
144 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
145 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
146 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
147 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
148 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
149 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
150 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
151 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
152 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
153 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
154 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
155 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
156 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
157 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
158 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
159 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
160 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
161 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
162 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
163 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
164 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
165 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
166 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
167 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
168 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
169 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
170 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
171 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
172 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
173 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
174 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
175 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
176 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
177 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
178 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
179 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
180 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
181 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
182 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
183 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
184 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
185 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
186 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
187 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
188 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
189 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
190 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
191 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
192 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
193 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
194 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
195 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
196 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
197 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
198 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
199 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
200 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
201 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
202 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
203 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
204 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
205 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
206 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
207 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
208 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
209 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
210 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
211 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
212 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
213 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
214 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
215 2932401849 Devosia sp. 2618 Isolate Rhizosphere
216 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
217 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
218 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
219 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
220 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
221 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
222 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
223 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
224 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
225 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
226 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
227 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
228 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
229 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
230 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
231 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
232 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
233 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
234 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
235 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
236 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
237 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
238 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
239 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
240 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
241 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
242 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
243 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
244 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
245 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
246 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
247 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
248 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
249 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
250 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
251 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
252 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
253 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
254 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
255 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
256 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
257 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
258 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
259 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
260 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
261 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
262 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
263 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
264 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
265 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
266 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
267 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
268 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
269 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
270 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
271 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
272 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
273 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
274 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
275 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
276 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
277 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
278 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
279 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
280 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
281 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
282 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
283 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
284 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
285 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
286 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
287 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
288 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
289 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
290 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
291 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
292 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
293 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
294 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
295 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
296 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
297 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
298 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
299 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
300 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
301 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
302 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
303 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
304 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
305 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
306 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
307 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
308 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
309 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
310 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
311 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
312 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
313 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
314 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
315 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
316 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
317 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
318 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
319 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
320 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
321 3004167301 Mesorhizobium loti 582 Isolate Unclassified
322 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
323 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
324 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
325 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
326 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
327 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
328 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
329 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
330 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
331 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
332 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
333 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
334 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
335 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
336 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
337 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
338 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
339 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
340 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
341 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
342 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
343 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
344 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
345 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
346 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
347 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
348 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
349 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
350 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
351 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
352 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
353 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
354 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
355 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
356 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
357 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
358 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
359 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
360 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
361 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
362 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
363 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
364 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
365 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
366 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
367 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
368 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
369 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
370 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
371 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
372 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
373 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
374 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
375 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
376 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
377 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
378 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
379 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
380 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
381 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
382 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
383 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
384 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
385 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
386 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
387 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
388 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
389 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
390 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
391 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
392 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
393 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
394 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
395 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
396 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
397 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
398 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
399 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
400 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
401 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
402 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
403 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
404 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
405 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
406 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
407 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
408 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
409 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
410 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
411 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
412 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
413 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
414 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
415 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
416 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
417 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
418 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
419 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
420 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
421 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
422 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
423 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
424 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
425 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
426 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
427 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
428 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
429 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
430 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
431 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
432 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
433 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
434 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
435 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
436 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
437 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
438 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
439 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
440 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
441 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
442 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
443 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
444 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
445 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
446 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
447 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
448 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
449 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
450 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
451 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
452 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
453 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
454 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
455 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
456 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
457 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
458 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
459 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
460 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
461 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
462 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
463 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
464 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
465 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
466 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
467 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
468 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
469 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
470 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
471 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
472 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
473 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
474 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
475 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
476 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
477 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
478 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
479 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
480 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
481 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
482 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
483 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
484 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
485 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
486 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
487 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
488 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
489 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
490 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
491 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
492 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
493 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
494 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
495 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
496 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
497 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
498 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
499 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
500 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
501 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
502 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
503 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
504 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
505 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
506 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
507 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
508 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
509 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
510 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
511 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
512 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
513 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
514 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
515 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
516 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
517 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
518 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
519 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
520 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
521 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
522 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
523 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
524 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
525 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
526 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
527 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
528 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
529 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
530 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
531 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
532 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
533 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
534 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
535 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified
536 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 46.84
Metatranscriptomes 0
Isolates 53.16

Biome Distribution

Category Percentage (%)
Aerial Root 0.73
Bulb 0
Endosphere 12.33
Nodule 38.47
Rhizoplane 1.62
Rhizosphere 27.17
Stem 0
Stem Tuber 0
Unclassified 19.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10015586 3300001989 Bacteria 2761
2 JGI25156J39149_1002906 3300002705 Bacteria 5853
3 JGI25157J39369_1001345 3300002741 Bacteria 9708
4 JGI25152J39213_1000107 3300002773 Bacteria 58133
5 JGI25151J46595_10000023 3300003187 Bacteria 221548
6 JGI25151J46595_10005137 3300003187 Bacteria 6790
7 JGI25165J46597_1000015 3300003214 Bacteria 380891
8 JGI25153J46596_10002930 3300003215 Bacteria 9661
9 JGI25153J46596_10003277 3300003215 Bacteria 9095
10 JGI25160J50197_1004162 3300003354 Bacteria 6296
11 Ga0055526_1005720 3300003771 Bacteria 7032
12 Ga0055526_1013475 3300003771 Bacteria 3454
13 Ga0055524_1020717 3300003775 Bacteria 2204
14 Ga0055536_1003545 3300003781 Bacteria 8352
15 Ga0055528_1000514 3300003790 Bacteria 30392
16 Ga0055540_1002759 3300003792 Bacteria 9013
17 Ga0055531_10006663 3300003794 Bacteria 6481
18 Ga0058692_1027145 3300003856 Bacteria 1118
19 Ga0055543_1001872 3300004625 Bacteria 7654
20 Ga0070682_100217697 3300005337 Bacteria 1357
21 Ga0070660_100225548 3300005339 Bacteria 1524
22 Ga0070661_100002605 3300005344 Bacteria 12373
23 Ga0070668_100258276 3300005347 Bacteria 1448
24 Ga0070672_100259190 3300005543 Bacteria 1466
25 Ga0070665_100012214 3300005548 Bacteria 8658
26 Ga0070665_100048847 3300005548 Bacteria 4247
27 Ga0068855_100028171 3300005563 Bacteria 6720
28 Ga0068857_100055754 3300005577 Bacteria 3507
29 Ga0068854_100007457 3300005578 Bacteria 6992
30 Ga0068856_100078650 3300005614 Bacteria 3270
31 Ga0068852_100002797 3300005616 Bacteria 12085
32 Ga0068852_100169080 3300005616 Bacteria 2047
33 Ga0068851_10002485 3300005834 Bacteria 8101
34 Ga0068860_100348622 3300005843 Bacteria 1457
35 Ga0081540_1088515 3300005983 Bacteria 1369
36 Ga0081539_10001815 3300005985 Bacteria 33742
37 Ga0075365_10009120 3300006038 Bacteria 5681
38 Ga0075365_10038867 3300006038 Bacteria 3095
39 Ga0075365_10132616 3300006038 Bacteria 1725
40 Ga0075363_100047888 3300006048 Bacteria 2271
41 Ga0075364_10000374 3300006051 Bacteria 22020
42 Ga0075364_10021680 3300006051 Bacteria 4050
43 Ga0075364_10079814 3300006051 Bacteria 2162
44 Ga0075367_10005310 3300006178 Bacteria 6378
45 Ga0075369_10003698 3300006186 Bacteria 5590
46 Ga0075366_10005534 3300006195 Bacteria 6843
47 Ga0075370_10003108 3300006353 Bacteria 7837
48 Ga0075370_10028633 3300006353 Bacteria 3097
49 Ga0079104_1000010 3300006946 Bacteria 366021
50 Ga0099826_10000070 3300006948 Bacteria 53527
51 Ga0099826_10004568 3300006948 Bacteria 9732
52 Ga0105240_10252007 3300009093 Bacteria 2041
53 Ga0105241_10051143 3300009174 Bacteria 3150
54 Ga0105237_10021807 3300009545 Bacteria 6579
55 Ga0105238_10008714 3300009551 Bacteria 10147
56 Ga0105239_10162575 3300010375 Bacteria 2495
57 Ga0105239_10235907 3300010375 Bacteria 2053
58 Ga0157373_10008462 3300013100 Bacteria 7639
59 Ga0157371_10000200 3300013102 Bacteria 87804
60 Ga0157371_10048186 3300013102 Bacteria 3029
61 Ga0157370_10000090 3300013104 Bacteria 103336
62 Ga0157369_10104463 3300013105 Bacteria 3016
63 Ga0157369_10136660 3300013105 Bacteria 2595
64 Ga0157369_10368524 3300013105 Bacteria 1491
65 Ga0207425_1000038 3300025245 Bacteria 221600
66 Ga0209026_1000025 3300025250 Bacteria 352548
67 Ga0209148_1000181 3300025254 Bacteria 124691
68 Ga0209129_1000036 3300025258 Bacteria 328331
69 Ga0209233_1000010 3300025261 Bacteria 1194329
70 Ga0209233_1020899 3300025261 Bacteria 1706
71 Ga0209455_1000127 3300025272 Bacteria 162518
72 Ga0209673_1000023 3300025273 Bacteria 411385
73 Ga0209673_1000132 3300025273 Bacteria 162349
74 Ga0209673_1003829 3300025273 Bacteria 8509
75 Ga0209676_1009947 3300025292 Bacteria 4029
76 Ga0209025_1000108 3300025294 Bacteria 221600
77 Ga0209025_1001057 3300025294 Bacteria 40170
78 Ga0209025_1001927 3300025294 Bacteria 24051
79 Ga0209564_1000100 3300025295 Bacteria 224016
80 Ga0209564_1024682 3300025295 Bacteria 2048
81 Ga0209758_1000104 3300025297 Bacteria 221600
82 Ga0209758_1000303 3300025297 Bacteria 96294
83 Ga0209758_1008060 3300025297 Bacteria 6950
84 Ga0209256_1000458 3300025299 Bacteria 61611
85 Ga0209256_1000818 3300025299 Bacteria 39749
86 Ga0209256_1002923 3300025299 Bacteria 12843
87 Ga0209051_1001670 3300025303 Bacteria 17921
88 Ga0207656_10018732 3300025321 Bacteria 2729
89 Ga0207647_10004726 3300025904 Bacteria 10086
90 Ga0207647_10039896 3300025904 Bacteria 2960
91 Ga0207705_10288636 3300025909 Bacteria 1257
92 Ga0207654_10039277 3300025911 Bacteria 2661
93 Ga0207657_10079377 3300025919 Bacteria 2761
94 Ga0207649_10001800 3300025920 Bacteria 12266
95 Ga0207694_10013751 3300025924 Bacteria 6101
96 Ga0207694_10239555 3300025924 Bacteria 1482
97 Ga0207667_10400376 3300025949 Bacteria 1398
98 Ga0207640_10279022 3300025981 Bacteria 1311
99 Ga0207639_10026652 3300026041 Bacteria 4200
100 Ga0207639_10302416 3300026041 Bacteria 1414
101 Ga0207702_10096643 3300026078 Bacteria 2598
102 Ga0207648_10391778 3300026089 Bacteria 1257
103 Ga0207674_10184193 3300026116 Bacteria 2039
104 Ga0207698_10005573 3300026142 Bacteria 7786
105 Ga0209281_1000078 3300027111 Bacteria 261622
106 Ga0209371_1000009 3300027312 Bacteria 963030
107 Ga0209371_1003091 3300027312 Bacteria 8491
108 Ga0209282_1000143 3300027666 Bacteria 42143
109 Ga0209282_1018668 3300027666 Bacteria 4398
110 Ga0268266_10035496 3300028379 Bacteria 4241
111 Ga0268266_10217857 3300028379 Bacteria 1753
112 Ga0307515_10000252 3300028794 Bacteria 132500
113 Ga0307515_10211427 3300028794 Bacteria 1783
114 Ga0265338_10122497 3300028800 Bacteria 2069
115 Ga0268256_1000010 3300030500 Bacteria 963034
116 Ga0265330_10028065 3300031235 Bacteria 2540
117 Ga0265332_10034389 3300031238 Bacteria 2203
118 Ga0265328_10052816 3300031239 Bacteria 1491
119 Ga0265325_10000866 3300031241 Bacteria 21795
120 Ga0265329_10005267 3300031242 Bacteria 5251
121 Ga0265339_10002644 3300031249 Bacteria 12774
122 Ga0265313_10000070 3300031595 Bacteria 99384
123 Ga0265314_10019269 3300031711 Bacteria 5289
124 Ga0265342_10016810 3300031712 Bacteria 4770
125 Ga0307516_10062921 3300031730 Bacteria 3594
126 Ga0307516_10099260 3300031730 Bacteria 2729
127 Ga0307406_10016696 3300031901 Bacteria 4273
128 Ga0307406_10066741 3300031901 Bacteria 2343
129 Ga0307414_10091785 3300032004 Bacteria 2258
130 Ga0307414_10133730 3300032004 Bacteria 1930
131 Ga0373927_0000253 3300035695 Bacteria 42014
132 Ga0373925_0090657 3300037068 Bacteria 2337
133 Ga0395899_0000442 3300037312 Bacteria 47552
134 Ga0395900_0000643 3300037418 Bacteria 46926
135 Ga0395900_0082159 3300037418 Bacteria 3310
136 Ga0395898_0000914 3300037466 Bacteria 47305
137 Ga0395905_0000621 3300037471 Bacteria 47593
138 Ga0395905_0001015 3300037471 Bacteria 35803
139 Ga0395905_0008999 3300037471 Bacteria 9798
140 Ga0395905_0011274 3300037471 Bacteria 8642
141 Ga0395905_0049494 3300037471 Bacteria 3938
142 Ga0395905_0300258 3300037471 Bacteria 1493
143 Ga0395901_0000466 3300038443 Bacteria 47044
144 Ga0395901_0002791 3300038443 Bacteria 17615
145 Ga0395901_0075618 3300038443 Bacteria 3513
146 Ga0395901_0515622 3300038443 Bacteria 1215
147 Ga0451847_0065524 3300041503 Bacteria 1700
148 Ga0451855_0473552 3300041511 Bacteria 1775
149 Ga0439435_0001050 3300042436 Bacteria 4873
150 Ga0466972_0013553 3300044658 Bacteria 4092
151 Ga0466970_0173388 3300044765 Bacteria 1196
152 Ga0495638_0049351 3300046460 Bacteria 2631
153 Ga0495638_0053162 3300046460 Bacteria 2521
154 Ga0495638_0104465 3300046460 Bacteria 1689
155 Ga0495585_0024722 3300046492 Bacteria 3443
156 Ga0495631_0004529 3300046518 Bacteria 7385
157 Ga0495632_0018382 3300046519 Bacteria 3837
158 Ga0495654_0000134 3300046530 Bacteria 77701
159 Ga0495668_0009854 3300046616 Bacteria 5830
160 Ga0495668_0203927 3300046616 Bacteria 1083
161 Ga0495611_0086645 3300046648 Bacteria 1445
162 Ga0495625_0013911 3300046660 Bacteria 6443
163 Ga0495588_0022539 3300046674 Bacteria 3113
164 Ga0495671_0073681 3300046692 Bacteria 1676
165 Ga0495686_0087271 3300047472 Bacteria 1898
166 Ga0496110_0144255 3300048913 Bacteria 2153
167 Ga0496111_0001801 3300048914 Bacteria 12580
168 Ga0496111_0218788 3300048914 Bacteria 1415
169 Ga0496112_0106756 3300048915 Bacteria 2770
170 Ga0496116_0000036 3300048919 Bacteria 388508
171 Ga0496116_0017655 3300048919 Bacteria 5529
172 Ga0496116_0027532 3300048919 Bacteria 4138
173 Ga0496116_0048447 3300048919 Bacteria 2852
174 Ga0496116_0108955 3300048919 Bacteria 1634
175 Ga0496117_0000002 3300048920 Bacteria 2483758
176 Ga0496117_0002129 3300048920 Bacteria 25902
177 Ga0496117_0031028 3300048920 Bacteria 4088
178 Ga0496117_0051715 3300048920 Bacteria 2901
179 Ga0496117_0147913 3300048920 Bacteria 1395
180 Ga0496118_0002809 3300048921 Bacteria 22813
181 Ga0496118_0012231 3300048921 Bacteria 8269
182 Ga0496118_0036698 3300048921 Bacteria 3957
183 Ga0496118_0038531 3300048921 Bacteria 3829
184 Ga0496118_0114607 3300048921 Bacteria 1777
185 Ga0496119_0008885 3300048922 Bacteria 8740
186 Ga0496119_0016100 3300048922 Bacteria 5711
187 Ga0496119_0030332 3300048922 Bacteria 3648
188 Ga0496119_0032048 3300048922 Bacteria 3510
189 Ga0496119_0065574 3300048922 Bacteria 2150
190 Ga0496120_0003418 3300048923 Bacteria 14503
191 Ga0496120_0004133 3300048923 Bacteria 12496
192 Ga0496121_0000001 3300048924 Bacteria 1830318
193 Ga0496121_0004009 3300048924 Bacteria 20283
194 Ga0496121_0084366 3300048924 Bacteria 2504
195 Ga0496121_0142059 3300048924 Bacteria 1779
196 Ga0496122_0000001 3300048925 Bacteria 1827766
197 Ga0496122_0000009 3300048925 Bacteria 584024
198 Ga0496122_0001278 3300048925 Bacteria 41879
199 Ga0496122_0013033 3300048925 Bacteria 8189
200 Ga0496122_0025823 3300048925 Bacteria 5086
201 Ga0496122_0062193 3300048925 Bacteria 2734
202 Ga0496123_0000001 3300048926 Bacteria 1831497
203 Ga0496123_0000020 3300048926 Bacteria 388748
204 Ga0496123_0001041 3300048926 Bacteria 41987
205 Ga0496123_0016088 3300048926 Bacteria 6095
206 Ga0496124_0000187 3300048927 Bacteria 122984
207 Ga0496124_0003596 3300048927 Bacteria 18842
208 Ga0496124_0067412 3300048927 Bacteria 2978
209 Ga0496124_0099686 3300048927 Bacteria 2355
210 Ga0496124_0138710 3300048927 Bacteria 1922
211 Ga0496124_0153462 3300048927 Bacteria 1803
212 Ga0496125_0000001 3300048928 Bacteria 1766138
213 Ga0496125_0000306 3300048928 Bacteria 96360
214 Ga0496125_0001018 3300048928 Bacteria 43593
215 Ga0496125_0033579 3300048928 Bacteria 4537
216 Ga0496125_0071635 3300048928 Bacteria 2706
217 Ga0496126_0000289 3300048929 Bacteria 106590
218 Ga0496126_0003565 3300048929 Bacteria 19520
219 Ga0496126_0007323 3300048929 Bacteria 12119
220 Ga0496126_0176159 3300048929 Bacteria 1819
221 Ga0496126_0219280 3300048929 Bacteria 1598
222 Ga0495678_019334 3300049459 Bacteria 3041
223 Ga0501031_0000010 3300049568 Bacteria 146435
224 Ga0501031_0033507 3300049568 Bacteria 3351
225 Ga0501031_0051073 3300049568 Bacteria 2693
226 Ga0501031_0070166 3300049568 Bacteria 2282
227 Ga0501031_0082501 3300049568 Bacteria 2096
228 Ga0501032_0000023 3300049569 Bacteria 146435
229 Ga0501032_0001269 3300049569 Bacteria 20225
230 Ga0501032_0065107 3300049569 Bacteria 2439
231 Ga0501032_0140647 3300049569 Bacteria 1589
232 Ga0501033_0000308 3300049570 Bacteria 46219
233 Ga0501033_0000318 3300049570 Bacteria 45707
234 Ga0501033_0000327 3300049570 Bacteria 45361
235 Ga0501033_0056474 3300049570 Bacteria 2901
236 Ga0501033_0075141 3300049570 Bacteria 2480
237 Ga0501033_0088547 3300049570 Bacteria 2265
238 Ga0501033_0167806 3300049570 Bacteria 1577
239 Ga0501033_0198160 3300049570 Bacteria 1435
240 Ga0501034_0000116 3300049571 Bacteria 146442
241 Ga0501034_0000222 3300049571 Bacteria 108857
242 Ga0501034_0028106 3300049571 Bacteria 5720
243 Ga0501034_0057570 3300049571 Bacteria 3907
244 Ga0501036_0000015 3300049572 Bacteria 146442
245 Ga0501036_0094841 3300049572 Bacteria 2522
246 Ga0501037_0000023 3300049573 Bacteria 146542
247 Ga0501037_0000136 3300049573 Bacteria 68536
248 Ga0501037_0272294 3300049573 Bacteria 1181
249 Ga0501038_0000025 3300049574 Bacteria 146542
250 Ga0501038_0082693 3300049574 Bacteria 2703
251 Ga0501039_0000037 3300049575 Bacteria 122286
252 Ga0501039_0132896 3300049575 Bacteria 1953
253 Ga0501043_0000006 3300049579 Bacteria 234413
254 Ga0501043_0000449 3300049579 Bacteria 36900
255 Ga0501046_0027024 3300049580 Bacteria 4685
256 Ga0501047_0001418 3300049581 Bacteria 23519
257 Ga0501047_0006051 3300049581 Bacteria 11377
258 Ga0501047_0242433 3300049581 Bacteria 1653
259 Ga0501067_0016882 3300049583 Bacteria 4033
260 Ga0501068_0035137 3300049584 Bacteria 2991
261 Ga0501069_0000024 3300049585 Bacteria 117140
262 Ga0501069_0025017 3300049585 Bacteria 3260
263 Ga0501070_0000093 3300049586 Bacteria 76623
264 Ga0501070_0001707 3300049586 Bacteria 19484
265 Ga0501070_0111586 3300049586 Bacteria 2260
266 Ga0501070_0147529 3300049586 Bacteria 1941
267 Ga0501071_0026366 3300049587 Bacteria 4078
268 Ga0501074_0001523 3300049590 Bacteria 15668
269 Ga0501076_0025165 3300049592 Bacteria 4605
270 Ga0501080_0005371 3300049742 Bacteria 11425
271 Ga0501083_0000097 3300049744 Bacteria 59474
272 Ga0501035_0000068 3300049822 Bacteria 128392
273 Ga0501035_0000074 3300049822 Bacteria 122269
274 Ga0501035_0001644 3300049822 Bacteria 22585
275 Ga0501035_0014747 3300049822 Bacteria 7215
276 Ga0501035_0073595 3300049822 Bacteria 3023
277 Ga0501035_0140566 3300049822 Bacteria 2100
278 Ga0501044_0000069 3300049823 Bacteria 125974
279 Ga0501044_0000096 3300049823 Bacteria 109532
280 Ga0501044_0002553 3300049823 Bacteria 20731
281 Ga0501044_0039574 3300049823 Bacteria 4917
282 Ga0501044_0077145 3300049823 Bacteria 3380
283 Ga0501044_0168738 3300049823 Bacteria 2161
284 nmdc:mga00v17_23736_c1 3300050491 Bacteria 3551
285 nmdc:mga00v17_532_c1 3300050491 Bacteria 21380
286 nmdc:mga00v17_841_c1 3300050491 Bacteria 16657
287 nmdc:mga0yw44_15153_c1 3300050492 Bacteria 4120
288 nmdc:mga0yw44_172518_c1 3300050492 Bacteria 1421
289 nmdc:mga0yw44_5970_c1 3300050492 Bacteria 5829
290 nmdc:mga06z11_116454_c1 3300050494 Bacteria 1486
291 nmdc:mga06z11_139900_c1 3300050494 Bacteria 1367
292 nmdc:mga06z11_53776_c1 3300050494 Bacteria 2072
293 nmdc:mga0sz30_6268_c1 3300050516 Bacteria 4411
294 Ga0500643_020022 3300053087 Bacteria 2195
295 Ga0500641_0003763 3300053096 Bacteria 5363
296 Ga0500556_0009617 3300053104 Bacteria 2816
297 Ga0500560_005973 3300053107 Bacteria 2743
298 Ga0500594_0012666 3300053118 Bacteria 1992
299 Ga0500608_038279 3300053122 Bacteria 2294
300 Ga0500618_000007 3300053125 Bacteria 226268
301 Ga0500618_000199 3300053125 Bacteria 47633
302 Ga0500618_010124 3300053125 Bacteria 2539
303 Ga0500618_016353 3300053125 Bacteria 1858
304 Ga0500559_0025206 3300053136 Bacteria 2530
305 Ga0500561_0000035 3300053137 Bacteria 27996
306 Ga0500568_0001718 3300053139 Bacteria 13603
307 Ga0500573_0049870 3300053140 Bacteria 2408
308 Ga0500573_0058518 3300053140 Bacteria 2209
309 Ga0500604_0000361 3300053151 Bacteria 12489
310 Ga0500616_0000120 3300053153 Bacteria 142980
311 Ga0500616_0123812 3300053153 Bacteria 1231
312 Ga0500620_000059 3300053155 Bacteria 20299
313 Ga0500622_0000466 3300053156 Bacteria 38413
314 Ga0500624_001812 3300053157 Bacteria 3101
315 Ga0500634_0000030 3300053161 Bacteria 76925
316 Ga0500634_0024408 3300053161 Bacteria 3288
317 Ga0500636_0000149 3300053177 Bacteria 36257
318 Ga0500636_0005980 3300053177 Bacteria 6973
319 Ga0501082_0021564 3300060353 Bacteria 5556

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005983 Ga0081540_1088515 Ga0081540_10885152 322
2 3300042436 Ga0439435_0001050 Ga0439435_0001050_1554_2630 322
3 iso_pu_bacteria 2756170246 2756678151 323
4 iso_pu_bacteria 2876377896 2876384392 325
5 3300038443 Ga0395901_0515622 Ga0395901_0515622_10_990 326
6 iso_pu_bacteria 2885334103 2885339600 326
7 3300005337 Ga0070682_100217697 Ga0070682_1002176971 328
8 3300005347 Ga0070668_100258276 Ga0070668_1002582762 328
9 3300025273 Ga0209673_1000132 Ga0209673_1000132100 332
10 3300025295 Ga0209564_1024682 Ga0209564_10246822 332
11 3300025299 Ga0209256_1000458 Ga0209256_100045830 332
12 iso_pu_bacteria 8004361976 8004362395 332
13 3300053153 Ga0500616_0123812 Ga0500616_0123812_85_1122 335
14 iso_pu_bacteria 2588253730 2588517388 335
15 iso_pu_bacteria 8005658619 8005662118 336
16 iso_pu_bacteria 2510461069 2510842477 337
17 iso_pu_bacteria 2818991272 2819241557 337
18 iso_pu_bacteria 2899803654 2899805513 337
19 iso_pu_bacteria 2989771324 2989775429 337
20 iso_pu_bacteria 3003930520 3003932360 337
21 iso_pu_bacteria 8005246636 8005248664 337
22 iso_pu_bacteria 2510917026 2511168951 338
23 iso_pu_bacteria 2513237084 2513569641 338
24 iso_pu_bacteria 2515154113 2515633255 338
25 iso_pu_bacteria 2517093000 2517098611 338
26 iso_pu_bacteria 2585427528 2585539217 338
27 iso_pu_bacteria 2585427593 2585837170 338
28 iso_pu_bacteria 2585427633 2585994771 338
29 iso_pu_bacteria 2585427634 2585999312 338
30 iso_pu_bacteria 2599185236 2599719292 338
31 iso_pu_bacteria 2600254933 2600374975 338
32 iso_pu_bacteria 2643221568 2643856126 338
33 iso_pu_bacteria 2724679232 2725952217 338
34 iso_pu_bacteria 2738541293 2738801813 338
35 iso_pu_bacteria 2738541333 2739033665 338
36 iso_pu_bacteria 2765235942 2766068387 338
37 iso_pu_bacteria 2791355265 2793355464 338
38 iso_pu_bacteria 2802429633 2806044836 338
39 iso_pu_bacteria 2802429634 2806054004 338
40 iso_pu_bacteria 2802429635 2806059904 338
41 iso_pu_bacteria 2802429636 2806066043 338
42 iso_pu_bacteria 2802429637 2806073375 338
43 iso_pu_bacteria 2818991461 2819684405 338
44 iso_pu_bacteria 2821123053 2821123921 338
45 iso_pu_bacteria 2838680041 2838684414 338
46 iso_pu_bacteria 2838694306 2838699905 338
47 iso_pu_bacteria 2838707686 2838711810 338
48 iso_pu_bacteria 2838736955 2838739050 338
49 iso_pu_bacteria 2841840854 2841842948 338
50 iso_pu_bacteria 2842077413 2842081881 338
51 iso_pu_bacteria 2842110456 2842115810 338
52 iso_pu_bacteria 2842118031 2842122457 338
53 iso_pu_bacteria 2842140634 2842142730 338
54 iso_pu_bacteria 2842237096 2842241222 338
55 iso_pu_bacteria 2842291075 2842295536 338
56 iso_pu_bacteria 2842370503 2842376672 338
57 iso_pu_bacteria 2842377471 2842381688 338
58 iso_pu_bacteria 2842384541 2842389005 338
59 iso_pu_bacteria 2842395702 2842396359 338
60 iso_pu_bacteria 2857516855 2857519188 338
61 iso_pu_bacteria 2857531043 2857531483 338
62 iso_pu_bacteria 2919166419 2919167108 338
63 iso_pu_bacteria 2919171160 2919171782 338
64 iso_pu_bacteria 2929138655 2929139189 338
65 iso_pu_bacteria 2933586486 2933591776 338
66 iso_pu_bacteria 2935894831 2935898246 338
67 iso_pu_bacteria 2936367885 2936370195 338
68 iso_pu_bacteria 2936375103 2936377867 338
69 iso_pu_bacteria 2978969890 2978973526 338
70 iso_pu_bacteria 2984587000 2984591809 338
71 iso_pu_bacteria 8005376324 8005381875 338
72 iso_pu_bacteria 8005556819 8005562117 338
73 iso_pu_bacteria 8005570704 8005576304 338
74 iso_pu_bacteria 8005695170 8005701929 338
75 iso_pu_bacteria 8024479707 8024483697 338
76 iso_pu_bacteria 8054460903 8054461610 338
77 iso_pu_bacteria 2510461069 2510840195 339
78 iso_pu_bacteria 2537561587 2537873778 339
79 iso_pu_bacteria 2554235003 2554246847 339
80 iso_pu_bacteria 2558860242 2559294073 339
81 iso_pu_bacteria 2558860983 2561469182 339
82 iso_pu_bacteria 2599185210 2599603599 339
83 iso_pu_bacteria 2600255279 2601608947 339
84 iso_pu_bacteria 2600255308 2601745722 339
85 iso_pu_bacteria 2643221582 2643920932 339
86 iso_pu_bacteria 2643221634 2644196311 339
87 iso_pu_bacteria 2643221693 2644519011 339
88 iso_pu_bacteria 2775507049 2776912460 339
89 iso_pu_bacteria 2808606387 2808986152 339
90 iso_pu_bacteria 2818991439 2819556278 339
91 iso_pu_bacteria 2838675328 2838677003 339
92 iso_pu_bacteria 2838714209 2838715890 339
93 iso_pu_bacteria 2838719591 2838720309 339
94 iso_pu_bacteria 2838724970 2838726643 339
95 iso_pu_bacteria 2841846520 2841847239 339
96 iso_pu_bacteria 2841859092 2841860225 339
97 iso_pu_bacteria 2842124991 2842126731 339
98 iso_pu_bacteria 2842130223 2842131896 339
99 iso_pu_bacteria 2842152218 2842152934 339
100 iso_pu_bacteria 2842170452 2842172134 339
101 iso_pu_bacteria 2842175837 2842176553 339
102 iso_pu_bacteria 2842187318 2842188999 339
103 iso_pu_bacteria 2842211629 2842213311 339
104 iso_pu_bacteria 2842224351 2842225071 339
105 iso_pu_bacteria 2842515876 2842517010 339
106 iso_pu_bacteria 2854896431 2854898556 339
107 iso_pu_bacteria 2854916844 2854921843 339
108 iso_pu_bacteria 2899792073 2899792290 339
109 iso_pu_bacteria 2899845264 2899846565 339
110 iso_pu_bacteria 2919114240 2919116092 339
111 iso_pu_bacteria 2923556063 2923556731 339
112 iso_pu_bacteria 2926754445 2926757046 339
113 iso_pu_bacteria 2926760298 2926761272 339
114 iso_pu_bacteria 2933006813 2933007579 339
115 iso_pu_bacteria 2933011516 2933012347 339
116 iso_pu_bacteria 2933594066 2933594791 339
117 iso_pu_bacteria 2979089926 2979093448 339
118 iso_pu_bacteria 2979095461 2979099166 339
119 iso_pu_bacteria 2979100975 2979105422 339
120 iso_pu_bacteria 2984509177 2984512727 339
121 iso_pu_bacteria 2984518228 2984520911 339
122 iso_pu_bacteria 2984537506 2984540206 339
123 iso_pu_bacteria 2984601300 2984602400 339
124 iso_pu_bacteria 650716007 650739266 339
125 iso_pu_bacteria 8003570095 8003570301 339
126 3300049570 Ga0501033_0075141 Ga0501033_0075141_1081_2124 340
127 3300049823 Ga0501044_0077145 Ga0501044_0077145_1568_2611 340
128 iso_pu_bacteria 2643221591 2643964777 340
129 iso_pu_bacteria 2932401849 2932404093 340
130 iso_pu_bacteria 8018150411 8018150880 340
131 3300003792 Ga0055540_1002759 Ga0055540_10027594 341
132 3300031901 Ga0307406_10066741 Ga0307406_100667411 341
133 3300035695 Ga0373927_0000253 Ga0373927_0000253_31980_33077 341
134 3300037068 Ga0373925_0090657 Ga0373925_0090657_265_1362 341
135 3300049569 Ga0501032_0140647 Ga0501032_0140647_292_1323 341
136 3300049570 Ga0501033_0000327 Ga0501033_0000327_30870_31901 341
137 3300049822 Ga0501035_0001644 Ga0501035_0001644_3875_4906 341
138 iso_pu_bacteria 2643221580 2643910052 341
139 iso_pu_bacteria 2643221674 2644413798 341
140 iso_pu_bacteria 2891373044 2891373440 341
141 iso_pu_bacteria 2989349275 2989349777 341
142 iso_pu_bacteria 3002141150 3002142197 341
143 3300002773 JGI25152J39213_1000107 JGI25152J39213_100010757 342
144 3300003187 JGI25151J46595_10000023 JGI25151J46595_10000023142 342
145 3300003215 JGI25153J46596_10002930 JGI25153J46596_100029306 342
146 3300003215 JGI25153J46596_10003277 JGI25153J46596_100032776 342
147 3300003354 JGI25160J50197_1004162 JGI25160J50197_10041623 342
148 3300003771 Ga0055526_1005720 Ga0055526_10057203 342
149 3300003771 Ga0055526_1013475 Ga0055526_10134753 342
150 3300003775 Ga0055524_1020717 Ga0055524_10207172 342
151 3300003781 Ga0055536_1003545 Ga0055536_10035453 342
152 3300003790 Ga0055528_1000514 Ga0055528_100051427 342
153 3300003794 Ga0055531_10006663 Ga0055531_100066633 342
154 3300004625 Ga0055543_1001872 Ga0055543_10018726 342
155 3300006051 Ga0075364_10000374 Ga0075364_100003749 342
156 3300006051 Ga0075364_10021680 Ga0075364_100216803 342
157 3300006353 Ga0075370_10003108 Ga0075370_100031082 342
158 3300006946 Ga0079104_1000010 Ga0079104_1000010307 342
159 3300013102 Ga0157371_10048186 Ga0157371_100481863 342
160 3300013105 Ga0157369_10136660 Ga0157369_101366602 342
161 3300025245 Ga0207425_1000038 Ga0207425_100003889 342
162 3300025258 Ga0209129_1000036 Ga0209129_100003689 342
163 3300025273 Ga0209673_1000023 Ga0209673_1000023233 342
164 3300025273 Ga0209673_1003829 Ga0209673_10038298 342
165 3300025292 Ga0209676_1009947 Ga0209676_10099473 342
166 3300025294 Ga0209025_1000108 Ga0209025_100010889 342
167 3300025295 Ga0209564_1000100 Ga0209564_1000100149 342
168 3300025297 Ga0209758_1000104 Ga0209758_1000104138 342
169 3300025297 Ga0209758_1000303 Ga0209758_100030374 342
170 3300025297 Ga0209758_1008060 Ga0209758_10080603 342
171 3300025299 Ga0209256_1000818 Ga0209256_10008187 342
172 3300025299 Ga0209256_1002923 Ga0209256_100292311 342
173 3300025303 Ga0209051_1001670 Ga0209051_10016704 342
174 3300027111 Ga0209281_1000078 Ga0209281_1000078186 342
175 3300031730 Ga0307516_10099260 Ga0307516_100992603 342
176 3300041503 Ga0451847_0065524 Ga0451847_0065524_270_1310 342
177 3300041511 Ga0451855_0473552 Ga0451855_0473552_600_1640 342
178 3300044765 Ga0466970_0173388 Ga0466970_0173388_36_1118 342
179 3300046492 Ga0495585_0024722 Ga0495585_0024722_2033_3073 342
180 3300046518 Ga0495631_0004529 Ga0495631_0004529_4941_5981 342
181 3300046519 Ga0495632_0018382 Ga0495632_0018382_1718_2758 342
182 3300046530 Ga0495654_0000134 Ga0495654_0000134_61908_62945 342
183 3300046616 Ga0495668_0009854 Ga0495668_0009854_310_1350 342
184 3300046648 Ga0495611_0086645 Ga0495611_0086645_315_1355 342
185 3300046660 Ga0495625_0013911 Ga0495625_0013911_4100_5140 342
186 3300048913 Ga0496110_0144255 Ga0496110_0144255_205_1242 342
187 3300048914 Ga0496111_0001801 Ga0496111_0001801_10744_11781 342
188 3300048919 Ga0496116_0000036 Ga0496116_0000036_24175_25212 342
189 3300048919 Ga0496116_0017655 Ga0496116_0017655_2749_3795 342
190 3300048919 Ga0496116_0108955 Ga0496116_0108955_445_1485 342
191 3300048920 Ga0496117_0031028 Ga0496117_0031028_142_1188 342
192 3300048920 Ga0496117_0051715 Ga0496117_0051715_1529_2566 342
193 3300048921 Ga0496118_0012231 Ga0496118_0012231_2073_3113 342
194 3300048921 Ga0496118_0036698 Ga0496118_0036698_1135_2181 342
195 3300048921 Ga0496118_0114607 Ga0496118_0114607_36_1073 342
196 3300048922 Ga0496119_0016100 Ga0496119_0016100_4407_5444 342
197 3300048922 Ga0496119_0032048 Ga0496119_0032048_1737_2783 342
198 3300048924 Ga0496121_0000001 Ga0496121_0000001_650707_651744 342
199 3300048924 Ga0496121_0004009 Ga0496121_0004009_13262_14299 342
200 3300048924 Ga0496121_0084366 Ga0496121_0084366_1234_2280 342
201 3300048924 Ga0496121_0142059 Ga0496121_0142059_443_1480 342
202 3300048925 Ga0496122_0013033 Ga0496122_0013033_288_1325 342
203 3300048925 Ga0496122_0025823 Ga0496122_0025823_2997_4034 342
204 3300048925 Ga0496122_0062193 Ga0496122_0062193_1229_2275 342
205 3300048926 Ga0496123_0016088 Ga0496123_0016088_1594_2631 342
206 3300048927 Ga0496124_0000187 Ga0496124_0000187_90875_91912 342
207 3300048927 Ga0496124_0067412 Ga0496124_0067412_1747_2784 342
208 3300048927 Ga0496124_0099686 Ga0496124_0099686_1036_2073 342
209 3300048928 Ga0496125_0000001 Ga0496125_0000001_764677_765714 342
210 3300048929 Ga0496126_0000289 Ga0496126_0000289_79405_80442 342
211 3300048929 Ga0496126_0007323 Ga0496126_0007323_10531_11559 342
212 3300049459 Ga0495678_019334 Ga0495678_019334_1183_2223 342
213 3300050491 nmdc:mga00v17_23736_c1 nmdc:mga00v17_23736_c1_910_1947 342
214 3300050491 nmdc:mga00v17_841_c1 nmdc:mga00v17_841_c1_10046_11083 342
215 3300053118 Ga0500594_0012666 Ga0500594_0012666_773_1813 342
216 3300053125 Ga0500618_000007 Ga0500618_000007_145420_146457 342
217 3300053125 Ga0500618_010124 Ga0500618_010124_1344_2423 342
218 3300053125 Ga0500618_016353 Ga0500618_016353_655_1692 342
219 3300053140 Ga0500573_0049870 Ga0500573_0049870_1258_2310 342
220 3300053153 Ga0500616_0000120 Ga0500616_0000120_63663_64700 342
221 3300053161 Ga0500634_0024408 Ga0500634_0024408_992_2029 342
222 3300053177 Ga0500636_0000149 Ga0500636_0000149_10476_11519 342
223 3300053177 Ga0500636_0005980 Ga0500636_0005980_5687_6724 342
224 iso_pu_bacteria 2503198000 2503200145 342
225 iso_pu_bacteria 2508501123 2509113087 342
226 iso_pu_bacteria 2508501127 2509143939 342
227 iso_pu_bacteria 2509276018 2509367872 342
228 iso_pu_bacteria 2509276022 2509396261 342
229 iso_pu_bacteria 2510065059 2510315556 342
230 iso_pu_bacteria 2512875016 2512931549 342
231 iso_pu_bacteria 2512875024 2512959382 342
232 iso_pu_bacteria 2513237090 2513611340 342
233 iso_pu_bacteria 2513237164 2514033561 342
234 iso_pu_bacteria 2513237305 2514419699 342
235 iso_pu_bacteria 2597489875 2597813277 342
236 iso_pu_bacteria 2599185301 2599936797 342
237 iso_pu_bacteria 2643221550 2643771145 342
238 iso_pu_bacteria 2643221551 2643776158 342
239 iso_pu_bacteria 2643221555 2643794605 342
240 iso_pu_bacteria 2643221564 2643839985 342
241 iso_pu_bacteria 2643221595 2643986455 342
242 iso_pu_bacteria 2643221623 2644129423 342
243 iso_pu_bacteria 2643221627 2644152687 342
244 iso_pu_bacteria 2687453392 2688598395 342
245 iso_pu_bacteria 2693429783 2694631028 342
246 iso_pu_bacteria 2693429784 2694636474 342
247 iso_pu_bacteria 2721755686 2723575330 342
248 iso_pu_bacteria 2738543024 2739307129 342
249 iso_pu_bacteria 2791355123 2792752739 342
250 iso_pu_bacteria 2841734538 2841739152 342
251 iso_pu_bacteria 2844002411 2844005010 342
252 iso_pu_bacteria 2844002411 2844007481 342
253 iso_pu_bacteria 2844009547 2844013650 342
254 iso_pu_bacteria 2847670302 2847675567 342
255 iso_pu_bacteria 2847686936 2847692209 342
256 iso_pu_bacteria 2856314179 2856319453 342
257 iso_pu_bacteria 2856320880 2856327530 342
258 iso_pu_bacteria 2856328259 2856334514 342
259 iso_pu_bacteria 2856334872 2856340364 342
260 iso_pu_bacteria 2856342000 2856343893 342
261 iso_pu_bacteria 2857349434 2857351197 342
262 iso_pu_bacteria 2857367948 2857371496 342
263 iso_pu_bacteria 2869162929 2869168241 342
264 iso_pu_bacteria 2869169390 2869171915 342
265 iso_pu_bacteria 2869242130 2869242554 342
266 iso_pu_bacteria 2869249662 2869254086 342
267 iso_pu_bacteria 2869256925 2869260799 342
268 iso_pu_bacteria 2869264136 2869269412 342
269 iso_pu_bacteria 2869271264 2869276481 342
270 iso_pu_bacteria 2869278585 2869280419 342
271 iso_pu_bacteria 2869285874 2869286516 342
272 iso_pu_bacteria 2871429161 2871434669 342
273 iso_pu_bacteria 2871435913 2871437350 342
274 iso_pu_bacteria 2871451962 2871459211 342
275 iso_pu_bacteria 2871459585 2871463864 342
276 iso_pu_bacteria 2871466892 2871471905 342
277 iso_pu_bacteria 2871474448 2871474621 342
278 iso_pu_bacteria 2871481445 2871482595 342
279 iso_pu_bacteria 2871488783 2871494590 342
280 iso_pu_bacteria 2874102143 2874109173 342
281 iso_pu_bacteria 2874116593 2874122994 342
282 iso_pu_bacteria 2874123672 2874130556 342
283 iso_pu_bacteria 2874131515 2874137856 342
284 iso_pu_bacteria 2874139085 2874144169 342
285 iso_pu_bacteria 2874146452 2874149874 342
286 iso_pu_bacteria 2874155637 2874158132 342
287 iso_pu_bacteria 2874162495 2874164475 342
288 iso_pu_bacteria 2874168670 2874169800 342
289 iso_pu_bacteria 2876363079 2876368531 342
290 iso_pu_bacteria 2876392853 2876398393 342
291 iso_pu_bacteria 2876399893 2876403678 342
292 iso_pu_bacteria 2876413966 2876416336 342
293 iso_pu_bacteria 2876420981 2876427812 342
294 iso_pu_bacteria 2878035449 2878040688 342
295 iso_pu_bacteria 2878738818 2878745164 342
296 iso_pu_bacteria 2878745973 2878751802 342
297 iso_pu_bacteria 2878753008 2878758828 342
298 iso_pu_bacteria 2878760144 2878765424 342
299 iso_pu_bacteria 2878767105 2878773132 342
300 iso_pu_bacteria 2878774303 2878775660 342
301 iso_pu_bacteria 2878781027 2878786823 342
302 iso_pu_bacteria 2881147464 2881151283 342
303 iso_pu_bacteria 2881147464 2881155097 342
304 iso_pu_bacteria 2881155292 2881161756 342
305 iso_pu_bacteria 2881161766 2881167483 342
306 iso_pu_bacteria 2881853255 2881856723 342
307 iso_pu_bacteria 2881861095 2881864645 342
308 iso_pu_bacteria 2882632389 2882636225 342
309 iso_pu_bacteria 2882912400 2882918522 342
310 iso_pu_bacteria 2885305155 2885309382 342
311 iso_pu_bacteria 2885312484 2885318030 342
312 iso_pu_bacteria 2885318864 2885322406 342
313 iso_pu_bacteria 2885326080 2885330044 342
314 iso_pu_bacteria 2885342637 2885350084 342
315 iso_pu_bacteria 2888337043 2888339374 342
316 iso_pu_bacteria 2888343758 2888346750 342
317 iso_pu_bacteria 2888350351 2888355712 342
318 iso_pu_bacteria 2889010040 2889010649 342
319 iso_pu_bacteria 2889016732 2889017652 342
320 iso_pu_bacteria 2894817345 2894817705 342
321 iso_pu_bacteria 2903448605 2903451263 342
322 iso_pu_bacteria 2903492973 2903503933 342
323 iso_pu_bacteria 2903492973 2903504748 342
324 iso_pu_bacteria 2903521522 2903527530 342
325 iso_pu_bacteria 2903528002 2903533984 342
326 iso_pu_bacteria 2903540706 2903546255 342
327 iso_pu_bacteria 2904659560 2904664948 342
328 iso_pu_bacteria 2906308376 2906314200 342
329 iso_pu_bacteria 2906321335 2906327366 342
330 iso_pu_bacteria 2906328253 2906330056 342
331 iso_pu_bacteria 2906370794 2906371559 342
332 iso_pu_bacteria 2906378014 2906381073 342
333 iso_pu_bacteria 2906386501 2906391604 342
334 iso_pu_bacteria 2906393657 2906398248 342
335 iso_pu_bacteria 2906401398 2906402850 342
336 iso_pu_bacteria 2906408224 2906408853 342
337 iso_pu_bacteria 2906414383 2906420173 342
338 iso_pu_bacteria 2922151315 2922152230 342
339 iso_pu_bacteria 2922158528 2922161163 342
340 iso_pu_bacteria 2922172374 2922175285 342
341 iso_pu_bacteria 2922185730 2922190244 342
342 iso_pu_bacteria 2924718760 2924724122 342
343 iso_pu_bacteria 2924726620 2924733253 342
344 iso_pu_bacteria 2924733363 2924735892 342
345 iso_pu_bacteria 2924741084 2924742220 342
346 iso_pu_bacteria 2924748358 2924748377 342
347 iso_pu_bacteria 2924762789 2924765070 342
348 iso_pu_bacteria 2924776078 2924783301 342
349 iso_pu_bacteria 2924784321 2924789030 342
350 iso_pu_bacteria 2937813078 2937815690 342
351 iso_pu_bacteria 2937822353 2937824403 342
352 iso_pu_bacteria 2937836603 2937839339 342
353 iso_pu_bacteria 2937848649 2937851872 342
354 iso_pu_bacteria 2937861824 2937867932 342
355 iso_pu_bacteria 2937877337 2937882172 342
356 iso_pu_bacteria 2937891427 2937898051 342
357 iso_pu_bacteria 2937972304 2937978633 342
358 iso_pu_bacteria 2937980651 2937985649 342
359 iso_pu_bacteria 2937994558 2938000113 342
360 iso_pu_bacteria 2958034702 2958036289 342
361 iso_pu_bacteria 2958041894 2958045653 342
362 iso_pu_bacteria 2958064165 2958064420 342
363 iso_pu_bacteria 2958071322 2958072076 342
364 iso_pu_bacteria 2958084443 2958089294 342
365 iso_pu_bacteria 2958100919 2958104492 342
366 iso_pu_bacteria 2958108152 2958111581 342
367 iso_pu_bacteria 2958115193 2958118411 342
368 iso_pu_bacteria 2958122699 2958122756 342
369 iso_pu_bacteria 2958130278 2958130919 342
370 iso_pu_bacteria 2958158011 2958160181 342
371 iso_pu_bacteria 2958165035 2958170577 342
372 iso_pu_bacteria 2958172287 2958179071 342
373 iso_pu_bacteria 2958179912 2958184840 342
374 iso_pu_bacteria 2961077736 2961083007 342
375 iso_pu_bacteria 2961114664 2961119947 342
376 iso_pu_bacteria 2961136820 2961142486 342
377 iso_pu_bacteria 2961163497 2961169032 342
378 iso_pu_bacteria 2961170736 2961176094 342
379 iso_pu_bacteria 2961183825 2961184323 342
380 iso_pu_bacteria 2963644680 2963647662 342
381 iso_pu_bacteria 2965018300 2965024319 342
382 iso_pu_bacteria 2965025482 2965031805 342
383 iso_pu_bacteria 2965040258 2965041823 342
384 iso_pu_bacteria 2965047637 2965052883 342
385 iso_pu_bacteria 2965062239 2965064198 342
386 iso_pu_bacteria 2967996073 2968001981 342
387 iso_pu_bacteria 2968003550 2968008995 342
388 iso_pu_bacteria 2968016561 2968018500 342
389 iso_pu_bacteria 2968083720 2968090293 342
390 iso_pu_bacteria 2968091066 2968096319 342
391 iso_pu_bacteria 2968097103 2968098818 342
392 iso_pu_bacteria 2968110612 2968116304 342
393 iso_pu_bacteria 2968117919 2968119906 342
394 iso_pu_bacteria 2968128360 2968129139 342
395 iso_pu_bacteria 2968138860 2968143955 342
396 iso_pu_bacteria 2968171901 2968177426 342
397 iso_pu_bacteria 2970469710 2970471327 342
398 iso_pu_bacteria 2970489779 2970492934 342
399 iso_pu_bacteria 2970503327 2970508760 342
400 iso_pu_bacteria 2970510686 2970515556 342
401 iso_pu_bacteria 2970524798 2970528533 342
402 iso_pu_bacteria 2970540015 2970544688 342
403 iso_pu_bacteria 2970547951 2970548955 342
404 iso_pu_bacteria 2970554993 2970560272 342
405 iso_pu_bacteria 2970593180 2970595016 342
406 iso_pu_bacteria 2970619444 2970620500 342
407 iso_pu_bacteria 2970627176 2970628097 342
408 iso_pu_bacteria 2977821940 2977827368 342
409 iso_pu_bacteria 2977828996 2977830473 342
410 iso_pu_bacteria 2977843712 2977845926 342
411 iso_pu_bacteria 2977851361 2977855867 342
412 iso_pu_bacteria 2977872689 2977874827 342
413 iso_pu_bacteria 2977922695 2977924170 342
414 iso_pu_bacteria 2977935797 2977936066 342
415 iso_pu_bacteria 2977942078 2977942704 342
416 iso_pu_bacteria 2977950692 2977954879 342
417 iso_pu_bacteria 2979710463 2979713629 342
418 iso_pu_bacteria 2979742915 2979749497 342
419 iso_pu_bacteria 2979764755 2979770879 342
420 iso_pu_bacteria 2979772303 2979778867 342
421 iso_pu_bacteria 2979779861 2979785542 342
422 iso_pu_bacteria 2979793036 2979799343 342
423 iso_pu_bacteria 2979808191 2979811592 342
424 iso_pu_bacteria 2987636660 2987638381 342
425 iso_pu_bacteria 2987659509 2987665063 342
426 iso_pu_bacteria 2987666974 2987667976 342
427 iso_pu_bacteria 2987673487 2987675181 342
428 iso_pu_bacteria 2996310559 2996314114 342
429 iso_pu_bacteria 2996336353 2996339053 342
430 iso_pu_bacteria 2996341866 2996342326 342
431 iso_pu_bacteria 2996348954 2996350119 342
432 iso_pu_bacteria 2996386984 2996392299 342
433 iso_pu_bacteria 3000135777 3000140711 342
434 iso_pu_bacteria 3004167301 3004168842 342
435 iso_pu_bacteria 3004188549 3004194120 342
436 iso_pu_bacteria 3004195979 3004197474 342
437 iso_pu_bacteria 3004203850 3004205375 342
438 iso_pu_bacteria 3004211236 3004215904 342
439 iso_pu_bacteria 3004218560 3004221930 342
440 iso_pu_bacteria 3004239961 3004242817 342
441 iso_pu_bacteria 3004248173 3004250494 342
442 iso_pu_bacteria 3004268573 3004274889 342
443 iso_pu_bacteria 3004275668 3004276818 342
444 iso_pu_bacteria 3004289098 3004293185 342
445 iso_pu_bacteria 3004334049 3004334414 342
446 iso_pu_bacteria 637000159 637074649 342
447 iso_pu_bacteria 649633066 649872922 342
448 iso_pu_bacteria 8002285264 8002289084 342
449 iso_pu_bacteria 8004312739 8004320380 342
450 iso_pu_bacteria 8004374579 8004380349 342
451 iso_pu_bacteria 8004387939 8004393690 342
452 iso_pu_bacteria 8004445564 8004451720 342
453 iso_pu_bacteria 8004633249 8004638625 342
454 iso_pu_bacteria 8004640170 8004640871 342
455 iso_pu_bacteria 8004703790 8004709313 342
456 iso_pu_bacteria 8004714634 8004720458 342
457 iso_pu_bacteria 8045864390 8045864743 342
458 iso_pu_bacteria 8054563764 8054563875 342
459 iso_pu_bacteria 8055617313 8055620729 342
460 3300003856 Ga0058692_1027145 Ga0058692_10271451 343
461 3300005548 Ga0070665_100012214 Ga0070665_1000122146 343
462 3300006948 Ga0099826_10000070 Ga0099826_1000007026 343
463 3300006948 Ga0099826_10004568 Ga0099826_100045688 343
464 3300013100 Ga0157373_10008462 Ga0157373_100084627 343
465 3300013102 Ga0157371_10000200 Ga0157371_1000020060 343
466 3300013104 Ga0157370_10000090 Ga0157370_10000090111 343
467 3300025294 Ga0209025_1001927 Ga0209025_10019272 343
468 3300027312 Ga0209371_1000009 Ga0209371_1000009210 343
469 3300027312 Ga0209371_1003091 Ga0209371_10030913 343
470 3300027666 Ga0209282_1000143 Ga0209282_100014332 343
471 3300027666 Ga0209282_1018668 Ga0209282_10186685 343
472 3300028379 Ga0268266_10035496 Ga0268266_100354962 343
473 3300028794 Ga0307515_10000252 Ga0307515_1000025270 343
474 3300028794 Ga0307515_10211427 Ga0307515_102114272 343
475 3300030500 Ga0268256_1000010 Ga0268256_1000010209 343
476 3300031730 Ga0307516_10062921 Ga0307516_100629213 343
477 3300046460 Ga0495638_0049351 Ga0495638_0049351_1514_2551 343
478 3300046460 Ga0495638_0053162 Ga0495638_0053162_597_1634 343
479 3300046460 Ga0495638_0104465 Ga0495638_0104465_10_1047 343
480 3300046674 Ga0495588_0022539 Ga0495588_0022539_1967_3007 343
481 3300046692 Ga0495671_0073681 Ga0495671_0073681_529_1569 343
482 3300048919 Ga0496116_0048447 Ga0496116_0048447_283_1338 343
483 3300048920 Ga0496117_0000002 Ga0496117_0000002_1742211_1743251 343
484 3300048920 Ga0496117_0147913 Ga0496117_0147913_78_1118 343
485 3300048921 Ga0496118_0002809 Ga0496118_0002809_367_1407 343
486 3300048921 Ga0496118_0038531 Ga0496118_0038531_1739_2779 343
487 3300048922 Ga0496119_0008885 Ga0496119_0008885_6450_7490 343
488 3300048922 Ga0496119_0030332 Ga0496119_0030332_389_1429 343
489 3300048923 Ga0496120_0003418 Ga0496120_0003418_9769_10809 343
490 3300048925 Ga0496122_0000001 Ga0496122_0000001_1113001_1114041 343
491 3300048925 Ga0496122_0000009 Ga0496122_0000009_228430_229473 343
492 3300048926 Ga0496123_0000001 Ga0496123_0000001_1116732_1117772 343
493 3300048926 Ga0496123_0000020 Ga0496123_0000020_32882_33925 343
494 3300048928 Ga0496125_0033579 Ga0496125_0033579_1258_2298 343
495 3300048929 Ga0496126_0176159 Ga0496126_0176159_697_1734 343
496 3300048929 Ga0496126_0219280 Ga0496126_0219280_368_1408 343
497 3300049575 Ga0501039_0132896 Ga0501039_0132896_547_1683 343
498 3300049592 Ga0501076_0025165 Ga0501076_0025165_1161_2297 343
499 3300050491 nmdc:mga00v17_532_c1 nmdc:mga00v17_532_c1_8865_9905 343
500 3300050492 nmdc:mga0yw44_172518_c1 nmdc:mga0yw44_172518_c1_209_1249 343
501 3300053107 Ga0500560_005973 Ga0500560_005973_1503_2543 343
502 3300053122 Ga0500608_038279 Ga0500608_038279_928_1965 343
503 3300053125 Ga0500618_000199 Ga0500618_000199_252_1292 343
504 3300053137 Ga0500561_0000035 Ga0500561_0000035_8866_9906 343
505 3300053156 Ga0500622_0000466 Ga0500622_0000466_5700_6737 343
506 3300053157 Ga0500624_001812 Ga0500624_001812_1669_2709 343
507 iso_pu_bacteria 2958144490 2958150002 343
508 3300005344 Ga0070661_100002605 Ga0070661_1000026056 344
509 3300005563 Ga0068855_100028171 Ga0068855_1000281712 344
510 3300005578 Ga0068854_100007457 Ga0068854_1000074576 344
511 3300005614 Ga0068856_100078650 Ga0068856_1000786503 344
512 3300005616 Ga0068852_100002797 Ga0068852_1000027976 344
513 3300005834 Ga0068851_10002485 Ga0068851_100024853 344
514 3300009174 Ga0105241_10051143 Ga0105241_100511433 344
515 3300009545 Ga0105237_10021807 Ga0105237_100218072 344
516 3300009551 Ga0105238_10008714 Ga0105238_100087142 344
517 3300010375 Ga0105239_10162575 Ga0105239_101625752 344
518 3300025321 Ga0207656_10018732 Ga0207656_100187323 344
519 3300025911 Ga0207654_10039277 Ga0207654_100392772 344
520 3300025920 Ga0207649_10001800 Ga0207649_100018005 344
521 3300025924 Ga0207694_10239555 Ga0207694_102395551 344
522 3300026041 Ga0207639_10026652 Ga0207639_100266524 344
523 3300026078 Ga0207702_10096643 Ga0207702_100966433 344
524 3300026142 Ga0207698_10005573 Ga0207698_100055736 344
525 3300031901 Ga0307406_10016696 Ga0307406_100166962 344
526 3300037471 Ga0395905_0001015 Ga0395905_0001015_27467_28507 344
527 3300037471 Ga0395905_0008999 Ga0395905_0008999_149_1189 344
528 3300037471 Ga0395905_0011274 Ga0395905_0011274_2547_3587 344
529 3300047472 Ga0495686_0087271 Ga0495686_0087271_817_1857 344
530 3300048919 Ga0496116_0027532 Ga0496116_0027532_460_1494 344
531 3300048927 Ga0496124_0153462 Ga0496124_0153462_480_1514 344
532 3300048928 Ga0496125_0000306 Ga0496125_0000306_11553_12587 344
533 3300049568 Ga0501031_0000010 Ga0501031_0000010_42054_43091 344
534 3300049569 Ga0501032_0000023 Ga0501032_0000023_103345_104382 344
535 3300049570 Ga0501033_0000308 Ga0501033_0000308_2156_3193 344
536 3300049571 Ga0501034_0000116 Ga0501034_0000116_42061_43098 344
537 3300049572 Ga0501036_0000015 Ga0501036_0000015_42061_43098 344
538 3300049573 Ga0501037_0000023 Ga0501037_0000023_42161_43198 344
539 3300049574 Ga0501038_0000025 Ga0501038_0000025_42161_43198 344
540 3300049575 Ga0501039_0000037 Ga0501039_0000037_42061_43098 344
541 3300049579 Ga0501043_0000449 Ga0501043_0000449_13550_14587 344
542 3300049580 Ga0501046_0027024 Ga0501046_0027024_1038_2075 344
543 3300049581 Ga0501047_0001418 Ga0501047_0001418_21610_22647 344
544 3300049822 Ga0501035_0000074 Ga0501035_0000074_42042_43079 344
545 3300049823 Ga0501044_0000069 Ga0501044_0000069_82877_83914 344
546 3300053096 Ga0500641_0003763 Ga0500641_0003763_3290_4432 344
547 3300053104 Ga0500556_0009617 Ga0500556_0009617_213_1253 344
548 3300053136 Ga0500559_0025206 Ga0500559_0025206_370_1410 344
549 3300053140 Ga0500573_0058518 Ga0500573_0058518_619_1704 344
550 3300003187 JGI25151J46595_10005137 JGI25151J46595_100051372 345
551 3300006195 Ga0075366_10005534 Ga0075366_100055342 345
552 3300025294 Ga0209025_1001057 Ga0209025_100105720 345
553 3300028379 Ga0268266_10217857 Ga0268266_102178572 345
554 3300028800 Ga0265338_10122497 Ga0265338_101224972 345
555 3300031235 Ga0265330_10028065 Ga0265330_100280651 345
556 3300031238 Ga0265332_10034389 Ga0265332_100343892 345
557 3300031239 Ga0265328_10052816 Ga0265328_100528161 345
558 3300031241 Ga0265325_10000866 Ga0265325_100008669 345
559 3300031242 Ga0265329_10005267 Ga0265329_100052675 345
560 3300031249 Ga0265339_10002644 Ga0265339_1000264412 345
561 3300031595 Ga0265313_10000070 Ga0265313_10000070107 345
562 3300031711 Ga0265314_10019269 Ga0265314_100192695 345
563 3300031712 Ga0265342_10016810 Ga0265342_100168102 345
564 3300032004 Ga0307414_10091785 Ga0307414_100917852 345
565 3300032004 Ga0307414_10133730 Ga0307414_101337302 345
566 3300048920 Ga0496117_0002129 Ga0496117_0002129_13448_14500 345
567 3300048925 Ga0496122_0001278 Ga0496122_0001278_11251_12303 345
568 3300048926 Ga0496123_0001041 Ga0496123_0001041_11251_12303 345
569 3300048927 Ga0496124_0003596 Ga0496124_0003596_11871_12923 345
570 3300048928 Ga0496125_0001018 Ga0496125_0001018_35864_36916 345
571 3300048928 Ga0496125_0071635 Ga0496125_0071635_92_1144 345
572 3300048929 Ga0496126_0003565 Ga0496126_0003565_15692_16744 345
573 3300049568 Ga0501031_0033507 Ga0501031_0033507_468_1547 345
574 3300049568 Ga0501031_0051073 Ga0501031_0051073_656_1726 345
575 3300049568 Ga0501031_0082501 Ga0501031_0082501_801_1880 345
576 3300049569 Ga0501032_0001269 Ga0501032_0001269_13909_14988 345
577 3300049570 Ga0501033_0000318 Ga0501033_0000318_23840_24919 345
578 3300049570 Ga0501033_0056474 Ga0501033_0056474_32_1075 345
579 3300049570 Ga0501033_0088547 Ga0501033_0088547_1070_2149 345
580 3300049570 Ga0501033_0167806 Ga0501033_0167806_330_1400 345
581 3300049570 Ga0501033_0198160 Ga0501033_0198160_366_1406 345
582 3300049571 Ga0501034_0000222 Ga0501034_0000222_91097_92134 345
583 3300049573 Ga0501037_0000136 Ga0501037_0000136_45536_46615 345
584 3300049579 Ga0501043_0000006 Ga0501043_0000006_73793_74872 345
585 3300049581 Ga0501047_0242433 Ga0501047_0242433_371_1450 345
586 3300049584 Ga0501068_0035137 Ga0501068_0035137_36_1115 345
587 3300049585 Ga0501069_0000024 Ga0501069_0000024_44614_45693 345
588 3300049586 Ga0501070_0000093 Ga0501070_0000093_25414_26493 345
589 3300049587 Ga0501071_0026366 Ga0501071_0026366_1143_2222 345
590 3300049590 Ga0501074_0001523 Ga0501074_0001523_11803_12882 345
591 3300049742 Ga0501080_0005371 Ga0501080_0005371_9962_11041 345
592 3300049744 Ga0501083_0000097 Ga0501083_0000097_22841_23920 345
593 3300049822 Ga0501035_0000068 Ga0501035_0000068_77311_78390 345
594 3300049822 Ga0501035_0014747 Ga0501035_0014747_1355_2434 345
595 3300049822 Ga0501035_0073595 Ga0501035_0073595_1520_2590 345
596 3300049823 Ga0501044_0000096 Ga0501044_0000096_63840_64919 345
597 3300049823 Ga0501044_0039574 Ga0501044_0039574_3740_4819 345
598 3300053151 Ga0500604_0000361 Ga0500604_0000361_5495_6532 345
599 3300053161 Ga0500634_0000030 Ga0500634_0000030_39990_41027 345
600 3300060353 Ga0501082_0021564 Ga0501082_0021564_4044_5123 345
601 3300001989 JGI24739J22299_10015586 JGI24739J22299_100155862 346
602 3300002705 JGI25156J39149_1002906 JGI25156J39149_10029062 346
603 3300002741 JGI25157J39369_1001345 JGI25157J39369_10013455 346
604 3300003214 JGI25165J46597_1000015 JGI25165J46597_1000015227 346
605 3300005339 Ga0070660_100225548 Ga0070660_1002255481 346
606 3300005543 Ga0070672_100259190 Ga0070672_1002591902 346
607 3300005548 Ga0070665_100048847 Ga0070665_1000488472 346
608 3300005577 Ga0068857_100055754 Ga0068857_1000557542 346
609 3300005616 Ga0068852_100169080 Ga0068852_1001690803 346
610 3300005843 Ga0068860_100348622 Ga0068860_1003486222 346
611 3300005985 Ga0081539_10001815 Ga0081539_1000181516 346
612 3300006038 Ga0075365_10009120 Ga0075365_100091202 346
613 3300006038 Ga0075365_10038867 Ga0075365_100388673 346
614 3300006038 Ga0075365_10132616 Ga0075365_101326161 346
615 3300006048 Ga0075363_100047888 Ga0075363_1000478882 346
616 3300006051 Ga0075364_10079814 Ga0075364_100798143 346
617 3300006178 Ga0075367_10005310 Ga0075367_100053105 346
618 3300006186 Ga0075369_10003698 Ga0075369_100036983 346
619 3300006353 Ga0075370_10028633 Ga0075370_100286334 346
620 3300009093 Ga0105240_10252007 Ga0105240_102520072 346
621 3300010375 Ga0105239_10235907 Ga0105239_102359072 346
622 3300013105 Ga0157369_10104463 Ga0157369_101044633 346
623 3300013105 Ga0157369_10368524 Ga0157369_103685241 346
624 3300025250 Ga0209026_1000025 Ga0209026_100002585 346
625 3300025254 Ga0209148_1000181 Ga0209148_100018145 346
626 3300025261 Ga0209233_1000010 Ga0209233_1000010325 346
627 3300025261 Ga0209233_1020899 Ga0209233_10208991 346
628 3300025272 Ga0209455_1000127 Ga0209455_100012745 346
629 3300025904 Ga0207647_10004726 Ga0207647_100047266 346
630 3300025904 Ga0207647_10039896 Ga0207647_100398964 346
631 3300025909 Ga0207705_10288636 Ga0207705_102886361 346
632 3300025919 Ga0207657_10079377 Ga0207657_100793774 346
633 3300025924 Ga0207694_10013751 Ga0207694_100137512 346
634 3300025949 Ga0207667_10400376 Ga0207667_104003762 346
635 3300025981 Ga0207640_10279022 Ga0207640_102790221 346
636 3300026041 Ga0207639_10302416 Ga0207639_103024162 346
637 3300026089 Ga0207648_10391778 Ga0207648_103917782 346
638 3300026116 Ga0207674_10184193 Ga0207674_101841931 346
639 3300037312 Ga0395899_0000442 Ga0395899_0000442_30341_31396 346
640 3300037418 Ga0395900_0000643 Ga0395900_0000643_29715_30770 346
641 3300037418 Ga0395900_0082159 Ga0395900_0082159_1663_2703 346
642 3300037466 Ga0395898_0000914 Ga0395898_0000914_30094_31149 346
643 3300037471 Ga0395905_0000621 Ga0395905_0000621_29645_30700 346
644 3300037471 Ga0395905_0049494 Ga0395905_0049494_2393_3433 346
645 3300037471 Ga0395905_0300258 Ga0395905_0300258_116_1156 346
646 3300038443 Ga0395901_0000466 Ga0395901_0000466_29833_30888 346
647 3300038443 Ga0395901_0002791 Ga0395901_0002791_5718_6758 346
648 3300038443 Ga0395901_0075618 Ga0395901_0075618_1589_2629 346
649 3300044658 Ga0466972_0013553 Ga0466972_0013553_915_1955 346
650 3300046616 Ga0495668_0203927 Ga0495668_0203927_16_1056 346
651 3300048914 Ga0496111_0218788 Ga0496111_0218788_64_1104 346
652 3300048915 Ga0496112_0106756 Ga0496112_0106756_277_1317 346
653 3300048922 Ga0496119_0065574 Ga0496119_0065574_1029_2069 346
654 3300048923 Ga0496120_0004133 Ga0496120_0004133_2998_4038 346
655 3300048927 Ga0496124_0138710 Ga0496124_0138710_180_1220 346
656 3300049568 Ga0501031_0070166 Ga0501031_0070166_218_1270 346
657 3300049569 Ga0501032_0065107 Ga0501032_0065107_654_1718 346
658 3300049571 Ga0501034_0028106 Ga0501034_0028106_1409_2452 346
659 3300049571 Ga0501034_0057570 Ga0501034_0057570_558_1610 346
660 3300049572 Ga0501036_0094841 Ga0501036_0094841_154_1206 346
661 3300049573 Ga0501037_0272294 Ga0501037_0272294_26_1078 346
662 3300049574 Ga0501038_0082693 Ga0501038_0082693_437_1489 346
663 3300049581 Ga0501047_0006051 Ga0501047_0006051_8036_9181 346
664 3300049583 Ga0501067_0016882 Ga0501067_0016882_1441_2487 346
665 3300049585 Ga0501069_0025017 Ga0501069_0025017_1984_3066 346
666 3300049586 Ga0501070_0001707 Ga0501070_0001707_10775_11857 346
667 3300049586 Ga0501070_0111586 Ga0501070_0111586_878_1930 346
668 3300049586 Ga0501070_0147529 Ga0501070_0147529_622_1668 346
669 3300049822 Ga0501035_0140566 Ga0501035_0140566_993_2045 346
670 3300049823 Ga0501044_0002553 Ga0501044_0002553_14969_16051 346
671 3300049823 Ga0501044_0168738 Ga0501044_0168738_910_1992 346
672 3300050492 nmdc:mga0yw44_15153_c1 nmdc:mga0yw44_15153_c1_324_1364 346
673 3300050492 nmdc:mga0yw44_5970_c1 nmdc:mga0yw44_5970_c1_3842_4882 346
674 3300050494 nmdc:mga06z11_116454_c1 nmdc:mga06z11_116454_c1_294_1334 346
675 3300050494 nmdc:mga06z11_139900_c1 nmdc:mga06z11_139900_c1_267_1307 346
676 3300050494 nmdc:mga06z11_53776_c1 nmdc:mga06z11_53776_c1_678_1718 346
677 3300050516 nmdc:mga0sz30_6268_c1 nmdc:mga0sz30_6268_c1_1153_2211 346
678 3300053087 Ga0500643_020022 Ga0500643_020022_16_1059 346
679 3300053139 Ga0500568_0001718 Ga0500568_0001718_4147_5259 346
680 3300053155 Ga0500620_000059 Ga0500620_000059_17741_18781 346
681 iso_pu_bacteria 2643221558 2643813982 346

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

14

161

0.98

PF12857

TOBE_3

TOBE-like domain

280

334

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2onk-assembly1.cif.gz_B abc transporter modbc in complex with its binding protein moda 0.9481 1 236
4u00-assembly1.cif.gz_A crystal structure of ttha1159 in complex with adp 0.9284 3 236
6b89-assembly1.cif.gz_A e. coli lptb in complex with adp and novobiocin 0.9276 1 224
7z17-assembly1.cif.gz_J e. coli c-p lyase bound to a phnk abc dimer in an open conformation 0.9251 3 237
4yms-assembly1.cif.gz_A crystal structure of an amino acid abc transporter 0.925 3 237
ID Description Score Start End Superfamily
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9767 1 219 3.40.50.300
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9699 1 219 3.40.50.300
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9653 1 220 3.40.50.300
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9609 1 220 3.40.50.300
af_Q58762_1_229_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9596 3 239 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A2V9R859-F1-model_v4 ABC transporter domain-containing protein 0.9743 1 155 GO:0005524
GO:0016887
AF-A0A0P9DFL4-F1-model_v4 ABC transporter domain-containing protein 0.9725 3 162 GO:0005524
GO:0016887
AF-A0A656JPS2-F1-model_v4 ABC transporter 0.967 2 155 GO:0005524
GO:0016887
AF-A0A349H0M9-F1-model_v4 Spermidine/putrescine ABC transporter ATP-binding protein 0.9669 3 148 GO:0005524
GO:0016887
AF-A0A1V4RJG8-F1-model_v4 Sugar ABC transporter ATP-binding protein 0.9651 2 150 GO:0005524
GO:0016887
GO:0055052

Feature Viewer

pLDDT pTM Quality
91.48 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map