F474842

General Info

Members Datasets Scaffolds Average Seq Length
681 285 681 188

Family's Representative Sequence

Representative Sequence 3300031838|Ga0307518_10100875|Ga0307518_101008752
Length 210
Sequence VTAPPVGPASGGAAHDAFNQAILADTGTDRQARPILTGSDLARITARMAHQILEKTRGADHTILLGIPTRGVPLARRLADRIAAFEGAEVPVGTLDVTLYRDDLKLRGTRALGPTDLPPDGIDGQRVILVDDVLFSGRTVRAALDALNDLGRPSQVQLAVLVDRGHRQLPIRADYVGKNLPTAQSESVRVLLHEIDGADAVLLAGGEGVG

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
72 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
73 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
87 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
88 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
89 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
90 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
131 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
132 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
133 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
134 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
135 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
136 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
137 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
138 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
139 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
140 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
141 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
142 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
143 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
144 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
145 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
146 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
147 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
148 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
149 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
150 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
151 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
152 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
153 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
154 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
155 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
156 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
157 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
158 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
159 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
160 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
161 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
162 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
163 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
164 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
165 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
166 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
167 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
168 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
169 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
170 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
171 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
172 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
173 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
174 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
175 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
176 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
177 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
178 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
179 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
180 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
181 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
182 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
183 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
184 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
185 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
186 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
187 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
188 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
189 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
190 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
191 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
192 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
193 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
194 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
195 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
196 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
197 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
198 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
199 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
200 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
201 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
202 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
203 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
204 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
205 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
206 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
207 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
208 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
209 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
210 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
211 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
212 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
213 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
214 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
215 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
216 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
217 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
218 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
219 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
220 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
221 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
222 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
223 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
224 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
225 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
226 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
227 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
228 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
229 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
230 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
231 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
232 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
233 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
234 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
235 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
236 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
237 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
238 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
239 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
240 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
241 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
242 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
243 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
244 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
245 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
258 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
259 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
260 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
261 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
262 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
263 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
264 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
265 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
266 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
267 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
268 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
269 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
270 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
271 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
274 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
275 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
276 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
277 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
278 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
279 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
280 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
281 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
282 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
283 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
284 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
285 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.59
Nodule 0
Rhizoplane 1.03
Rhizosphere 92.8
Stem 0
Stem Tuber 0
Unclassified 5.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10069958 3300005327 Bacteria 2872
2 Ga0070658_10262991 3300005327 Bacteria 1465
3 Ga0070676_10174955 3300005328 Bacteria 1391
4 Ga0070683_100000011 3300005329 Bacteria 283682
5 Ga0070683_100075606 3300005329 Bacteria 3147
6 Ga0070683_100080046 3300005329 Bacteria 3058
7 Ga0070683_100084660 3300005329 Bacteria 2971
8 Ga0070683_100273040 3300005329 Bacteria 1608
9 Ga0070683_100472851 3300005329 Bacteria 1197
10 Ga0070683_100629711 3300005329 Bacteria 1027
11 Ga0070690_100139199 3300005330 Unclassified 1646
12 Ga0070690_100208434 3300005330 Bacteria 1363
13 Ga0070680_100010403 3300005336 Bacteria 7172
14 Ga0070680_100543607 3300005336 Unclassified 995
15 Ga0070680_100936871 3300005336 Bacteria 747
16 Ga0068868_100205202 3300005338 Bacteria 1645
17 Ga0068868_100746846 3300005338 Bacteria 879
18 Ga0070660_100006653 3300005339 Bacteria 8018
19 Ga0070660_100013782 3300005339 Bacteria 5815
20 Ga0070660_100084760 3300005339 Bacteria 2491
21 Ga0070689_100334128 3300005340 Bacteria 1268
22 Ga0070691_10000315 3300005341 Bacteria 17057
23 Ga0070661_100114022 3300005344 Bacteria 2020
24 Ga0070661_100123089 3300005344 Unclassified 1944
25 Ga0070692_10188714 3300005345 Bacteria 1199
26 Ga0070669_100827793 3300005353 Bacteria 788
27 Ga0070671_100000477 3300005355 Bacteria 27818
28 Ga0070671_100480845 3300005355 Bacteria 1067
29 Ga0070673_100133956 3300005364 Unclassified 2083
30 Ga0070673_100193516 3300005364 Bacteria 1748
31 Ga0070688_100260009 3300005365 Bacteria 1239
32 Ga0070659_100000655 3300005366 Bacteria 25206
33 Ga0070659_100108813 3300005366 Bacteria 2236
34 Ga0070659_100510914 3300005366 Bacteria 1025
35 Ga0070667_101413976 3300005367 Bacteria 653
36 Ga0070709_10242284 3300005434 Bacteria 1295
37 Ga0070714_100329343 3300005435 Bacteria 1430
38 Ga0070713_100011774 3300005436 Bacteria 6389
39 Ga0070713_100018726 3300005436 Bacteria 5267
40 Ga0070713_100104505 3300005436 Bacteria 2459
41 Ga0070713_100184902 3300005436 Bacteria 1875
42 Ga0070713_100383110 3300005436 Bacteria 1310
43 Ga0070710_10513243 3300005437 Bacteria 822
44 Ga0070701_10240910 3300005438 Bacteria 1088
45 Ga0070711_100080226 3300005439 Bacteria 2323
46 Ga0070711_100336915 3300005439 Bacteria 1209
47 Ga0070711_100390231 3300005439 Bacteria 1128
48 Ga0070708_100774496 3300005445 Bacteria 902
49 Ga0070678_100034618 3300005456 Bacteria 3519
50 Ga0070681_10001891 3300005458 Bacteria 18900
51 Ga0070681_10121574 3300005458 Bacteria 2545
52 Ga0070681_10215261 3300005458 Bacteria 1837
53 Ga0070681_10480069 3300005458 Bacteria 1156
54 Ga0068867_100452269 3300005459 Bacteria 1094
55 Ga0070685_10465052 3300005466 Bacteria 889
56 Ga0070706_100273609 3300005467 Bacteria 1576
57 Ga0070706_100645130 3300005467 Unclassified 983
58 Ga0070699_100223003 3300005518 Bacteria 1680
59 Ga0070679_100004611 3300005530 Bacteria 12725
60 Ga0070679_100314098 3300005530 Bacteria 1517
61 Ga0070679_100701429 3300005530 Bacteria 955
62 Ga0070684_100000001 3300005535 Bacteria 300240
63 Ga0070684_100001706 3300005535 Bacteria 16001
64 Ga0070684_100255017 3300005535 Bacteria 1603
65 Ga0070684_100318420 3300005535 Bacteria 1429
66 Ga0070684_100569298 3300005535 Unclassified 1052
67 Ga0070697_100086077 3300005536 Bacteria 2593
68 Ga0068853_100000049 3300005539 Bacteria 90347
69 Ga0068853_100044563 3300005539 Bacteria 3797
70 Ga0068853_100060899 3300005539 Bacteria 3263
71 Ga0068853_100284336 3300005539 Bacteria 1525
72 Ga0068853_100296303 3300005539 Bacteria 1494
73 Ga0068853_100440945 3300005539 Bacteria 1224
74 Ga0070693_100061726 3300005547 Bacteria 2180
75 Ga0070665_100009987 3300005548 Bacteria 9603
76 Ga0070665_100239030 3300005548 Bacteria 1817
77 Ga0070665_100648585 3300005548 Bacteria 1069
78 Ga0070665_100966263 3300005548 Bacteria 864
79 Ga0068855_100002363 3300005563 Bacteria 23276
80 Ga0068855_100002895 3300005563 Bacteria 21003
81 Ga0068855_100003302 3300005563 Bacteria 19746
82 Ga0068855_100054809 3300005563 Bacteria 4686
83 Ga0068855_100078450 3300005563 Bacteria 3831
84 Ga0068855_100125421 3300005563 Bacteria 2936
85 Ga0068855_100185561 3300005563 Bacteria 2349
86 Ga0068855_100223948 3300005563 Bacteria 2108
87 Ga0068855_100256143 3300005563 Bacteria 1951
88 Ga0068855_100399559 3300005563 Bacteria 1506
89 Ga0068855_100665896 3300005563 Bacteria 1117
90 Ga0068855_100795890 3300005563 Bacteria 1005
91 Ga0070664_100159379 3300005564 Bacteria 1996
92 Ga0070664_100195127 3300005564 Unclassified 1805
93 Ga0070664_100347654 3300005564 Bacteria 1348
94 Ga0068857_100002278 3300005577 Bacteria 15603
95 Ga0068857_100502601 3300005577 Bacteria 1138
96 Ga0068857_101164580 3300005577 Unclassified 746
97 Ga0068854_100000129 3300005578 Bacteria 52076
98 Ga0068856_100001516 3300005614 Bacteria 24367
99 Ga0068856_100028230 3300005614 Bacteria 5478
100 Ga0068856_100050129 3300005614 Bacteria 4115
101 Ga0068856_100057591 3300005614 Bacteria 3837
102 Ga0068856_100129987 3300005614 Bacteria 2523
103 Ga0068856_100902062 3300005614 Bacteria 903
104 Ga0070702_100512888 3300005615 Bacteria 883
105 Ga0068852_100002225 3300005616 Bacteria 13305
106 Ga0068852_100160780 3300005616 Bacteria 2097
107 Ga0068852_100885137 3300005616 Bacteria 909
108 Ga0068852_101040222 3300005616 Bacteria 838
109 Ga0068852_101099263 3300005616 Bacteria 815
110 Ga0068859_100093590 3300005617 Bacteria 3057
111 Ga0068859_100224671 3300005617 Bacteria 1966
112 Ga0068859_100254633 3300005617 Bacteria 1846
113 Ga0068859_100349276 3300005617 Bacteria 1574
114 Ga0068859_100705441 3300005617 Bacteria 1100
115 Ga0068864_100019848 3300005618 Bacteria 5620
116 Ga0068864_100482762 3300005618 Bacteria 1190
117 Ga0068864_101176682 3300005618 Bacteria 765
118 Ga0068863_100006748 3300005841 Bacteria 11251
119 Ga0068863_100047401 3300005841 Bacteria 4076
120 Ga0068863_100403112 3300005841 Bacteria 1338
121 Ga0068863_101282984 3300005841 Unclassified 739
122 Ga0068858_100039179 3300005842 Bacteria 4395
123 Ga0068858_100058294 3300005842 Bacteria 3570
124 Ga0068858_100514573 3300005842 Unclassified 1157
125 Ga0068858_101238021 3300005842 Bacteria 734
126 Ga0068860_101049113 3300005843 Bacteria 834
127 Ga0068860_101220584 3300005843 Bacteria 772
128 Ga0081540_1141879 3300005983 Bacteria 962
129 Ga0070717_10064577 3300006028 Bacteria 3040
130 Ga0070717_10666067 3300006028 Bacteria 945
131 Ga0070712_100563424 3300006175 Bacteria 961
132 Ga0070712_100636746 3300006175 Bacteria 905
133 Ga0097621_100032311 3300006237 Bacteria 4159
134 Ga0097621_100151535 3300006237 Bacteria 1989
135 Ga0097621_100449231 3300006237 Bacteria 1161
136 Ga0097621_100539288 3300006237 Bacteria 1061
137 Ga0097621_100749838 3300006237 Bacteria 902
138 Ga0068871_100353158 3300006358 Bacteria 1301
139 Ga0068871_100404852 3300006358 Bacteria 1216
140 Ga0068871_100551843 3300006358 Bacteria 1044
141 Ga0068871_101351619 3300006358 Bacteria 671
142 Ga0075428_100544883 3300006844 Unclassified 1240
143 Ga0075428_100744378 3300006844 Bacteria 1043
144 Ga0075429_100145959 3300006880 Bacteria 2071
145 Ga0068865_100069588 3300006881 Bacteria 2490
146 Ga0068865_100167555 3300006881 Bacteria 1681
147 Ga0075436_100012886 3300006914 Bacteria 5733
148 Ga0075436_100022470 3300006914 Bacteria 4332
149 Ga0075436_100193223 3300006914 Bacteria 1440
150 Ga0097620_100093588 3300006931 Bacteria 3057
151 Ga0097620_100224674 3300006931 Bacteria 1966
152 Ga0097620_100254631 3300006931 Bacteria 1846
153 Ga0097620_100349232 3300006931 Bacteria 1574
154 Ga0097620_100705451 3300006931 Bacteria 1100
155 Ga0105240_10000001 3300009093 Bacteria 2887840
156 Ga0105240_10000202 3300009093 Bacteria 121046
157 Ga0105240_10001456 3300009093 Bacteria 40471
158 Ga0105240_10001466 3300009093 Bacteria 40332
159 Ga0105240_10003229 3300009093 Bacteria 25527
160 Ga0105240_10003634 3300009093 Bacteria 23891
161 Ga0105240_10033834 3300009093 Bacteria 6599
162 Ga0105240_10045233 3300009093 Bacteria 5586
163 Ga0105240_10060633 3300009093 Bacteria 4716
164 Ga0105240_10091023 3300009093 Bacteria 3727
165 Ga0105240_10153005 3300009093 Bacteria 2746
166 Ga0105240_10299723 3300009093 Bacteria 1839
167 Ga0105240_10300226 3300009093 Unclassified 1837
168 Ga0105240_10730300 3300009093 Bacteria 1078
169 Ga0105240_10797941 3300009093 Bacteria 1023
170 Ga0105240_11277877 3300009093 Bacteria 775
171 Ga0105245_10035817 3300009098 Bacteria 4406
172 Ga0105245_10133758 3300009098 Bacteria 2328
173 Ga0105245_10152130 3300009098 Bacteria 2189
174 Ga0105245_10607858 3300009098 Unclassified 1120
175 Ga0105247_10632894 3300009101 Bacteria 797
176 Ga0114129_10688031 3300009147 Bacteria 1316
177 Ga0105243_10151796 3300009148 Bacteria 1988
178 Ga0105243_11229649 3300009148 Bacteria 763
179 Ga0105241_10004691 3300009174 Bacteria 10092
180 Ga0105241_10085959 3300009174 Bacteria 2473
181 Ga0105241_10932599 3300009174 Bacteria 808
182 Ga0105242_10294345 3300009176 Bacteria 1479
183 Ga0105242_10523237 3300009176 Bacteria 1132
184 Ga0105242_10588675 3300009176 Bacteria 1073
185 Ga0105248_10023774 3300009177 Bacteria 6810
186 Ga0105248_10047585 3300009177 Bacteria 4810
187 Ga0105248_10209075 3300009177 Bacteria 2198
188 Ga0105248_10344935 3300009177 Bacteria 1677
189 Ga0105248_10381993 3300009177 Bacteria 1586
190 Ga0105237_10062276 3300009545 Bacteria 3730
191 Ga0105237_10265226 3300009545 Bacteria 1720
192 Ga0105237_11069243 3300009545 Bacteria 814
193 Ga0105237_11086574 3300009545 Bacteria 807
194 Ga0105237_11171410 3300009545 Bacteria 775
195 Ga0105238_10001077 3300009551 Bacteria 27578
196 Ga0105238_10022724 3300009551 Bacteria 6391
197 Ga0105238_10030128 3300009551 Bacteria 5522
198 Ga0105238_10039587 3300009551 Bacteria 4780
199 Ga0105238_10054576 3300009551 Bacteria 4012
200 Ga0105238_10106338 3300009551 Bacteria 2788
201 Ga0105238_10146453 3300009551 Bacteria 2338
202 Ga0105238_10447302 3300009551 Bacteria 1289
203 Ga0105238_10839624 3300009551 Bacteria 935
204 Ga0105249_10847414 3300009553 Bacteria 980
205 Ga0105239_10006418 3300010375 Bacteria 13650
206 Ga0105239_10034686 3300010375 Bacteria 5542
207 Ga0105239_10050366 3300010375 Bacteria 4568
208 Ga0105239_10075890 3300010375 Bacteria 3696
209 Ga0105239_10998064 3300010375 Bacteria 962
210 Ga0157373_10061222 3300013100 Bacteria 2666
211 Ga0157371_10060357 3300013102 Bacteria 2689
212 Ga0157371_10544180 3300013102 Unclassified 860
213 Ga0157370_10002989 3300013104 Bacteria 20098
214 Ga0157370_10003670 3300013104 Bacteria 17924
215 Ga0157370_10004975 3300013104 Bacteria 15044
216 Ga0157370_10005288 3300013104 Bacteria 14503
217 Ga0157370_10012130 3300013104 Bacteria 8964
218 Ga0157370_10014494 3300013104 Bacteria 8058
219 Ga0157370_10213363 3300013104 Bacteria 1789
220 Ga0157370_10233827 3300013104 Bacteria 1701
221 Ga0157370_10326086 3300013104 Bacteria 1416
222 Ga0157370_10365503 3300013104 Bacteria 1330
223 Ga0157370_10407921 3300013104 Bacteria 1250
224 Ga0157370_10641143 3300013104 Bacteria 971
225 Ga0157369_10003568 3300013105 Bacteria 18484
226 Ga0157369_10024819 3300013105 Bacteria 6660
227 Ga0157369_10045430 3300013105 Bacteria 4777
228 Ga0157369_10045825 3300013105 Bacteria 4754
229 Ga0157369_10123957 3300013105 Bacteria 2741
230 Ga0157369_10402438 3300013105 Bacteria 1420
231 Ga0157369_10469865 3300013105 Bacteria 1302
232 Ga0157369_10511240 3300013105 Bacteria 1243
233 Ga0157369_11038839 3300013105 Bacteria 838
234 Ga0157369_11070589 3300013105 Bacteria 824
235 Ga0157374_10012560 3300013296 Bacteria 7370
236 Ga0157374_10027356 3300013296 Bacteria 5143
237 Ga0157374_10037335 3300013296 Bacteria 4459
238 Ga0157374_10043075 3300013296 Bacteria 4167
239 Ga0157374_10362595 3300013296 Bacteria 1441
240 Ga0157374_10931736 3300013296 Bacteria 887
241 Ga0157378_10056049 3300013297 Bacteria 3511
242 Ga0157378_10798524 3300013297 Bacteria 969
243 Ga0157378_11764960 3300013297 Bacteria 666
244 Ga0163162_10006711 3300013306 Bacteria 11158
245 Ga0163162_10162833 3300013306 Bacteria 2353
246 Ga0163162_10598451 3300013306 Bacteria 1229
247 Ga0163162_10725929 3300013306 Bacteria 1114
248 Ga0163162_10740275 3300013306 Bacteria 1103
249 Ga0157372_10005248 3300013307 Bacteria 13762
250 Ga0157372_10031848 3300013307 Bacteria 5778
251 Ga0157372_10053364 3300013307 Bacteria 4506
252 Ga0157372_10069139 3300013307 Bacteria 3972
253 Ga0157372_10192784 3300013307 Bacteria 2360
254 Ga0157372_10204851 3300013307 Bacteria 2286
255 Ga0157372_10320841 3300013307 Bacteria 1804
256 Ga0157372_10488364 3300013307 Bacteria 1436
257 Ga0157372_10606170 3300013307 Unclassified 1276
258 Ga0157375_10129517 3300013308 Bacteria 2641
259 Ga0157375_10630202 3300013308 Bacteria 1230
260 Ga0157375_10754248 3300013308 Bacteria 1124
261 Ga0157375_10896473 3300013308 Bacteria 1031
262 Ga0157375_11403802 3300013308 Bacteria 823
263 Ga0157375_12132339 3300013308 Unclassified 667
264 Ga0163163_10046741 3300014325 Bacteria 4252
265 Ga0163163_10181596 3300014325 Bacteria 2151
266 Ga0163163_10198281 3300014325 Bacteria 2056
267 Ga0163163_10363906 3300014325 Unclassified 1503
268 Ga0163163_10681478 3300014325 Bacteria 1091
269 Ga0163163_10792795 3300014325 Unclassified 1011
270 Ga0157380_10869106 3300014326 Bacteria 925
271 Ga0157377_10056138 3300014745 Bacteria 2235
272 Ga0157377_10430056 3300014745 Bacteria 906
273 Ga0157379_10019282 3300014968 Bacteria 6023
274 Ga0157379_10156477 3300014968 Bacteria 2056
275 Ga0157379_10162722 3300014968 Bacteria 2014
276 Ga0157379_10322252 3300014968 Bacteria 1411
277 Ga0157379_10904693 3300014968 Bacteria 837
278 Ga0157376_10009804 3300014969 Bacteria 6981
279 Ga0157376_10017134 3300014969 Bacteria 5519
280 Ga0157376_10048023 3300014969 Bacteria 3527
281 Ga0157376_10155870 3300014969 Bacteria 2065
282 Ga0157376_10248908 3300014969 Bacteria 1659
283 Ga0157376_10694341 3300014969 Bacteria 1022
284 Ga0157376_11314253 3300014969 Bacteria 753
285 Ga0157376_11758705 3300014969 Bacteria 656
286 Ga0163161_10193680 3300017792 Bacteria 1564
287 Ga0213873_10034584 3300021358 Bacteria 1274
288 Ga0213874_10040201 3300021377 Bacteria 1395
289 Ga0213876_10009021 3300021384 Bacteria 5373
290 Ga0213876_10127561 3300021384 Bacteria 1351
291 Ga0213876_10146786 3300021384 Bacteria 1254
292 Ga0213875_10003299 3300021388 Bacteria 9227
293 Ga0213875_10025228 3300021388 Bacteria 2833
294 Ga0213875_10093524 3300021388 Bacteria 1402
295 Ga0213875_10223391 3300021388 Bacteria 887
296 Ga0213875_10377130 3300021388 Bacteria 675
297 Ga0207692_10326202 3300025898 Bacteria 941
298 Ga0207680_10254469 3300025903 Bacteria 1214
299 Ga0207647_10006083 3300025904 Bacteria 8794
300 Ga0207647_10248006 3300025904 Bacteria 1022
301 Ga0207699_10057421 3300025906 Bacteria 2324
302 Ga0207705_10041534 3300025909 Bacteria 3300
303 Ga0207705_10083813 3300025909 Bacteria 2326
304 Ga0207705_10265714 3300025909 Bacteria 1311
305 Ga0207705_10476271 3300025909 Bacteria 969
306 Ga0207684_10433823 3300025910 Bacteria 1129
307 Ga0207684_10531568 3300025910 Unclassified 1007
308 Ga0207707_10163031 3300025912 Bacteria 1949
309 Ga0207707_10202741 3300025912 Bacteria 1729
310 Ga0207707_10328821 3300025912 Bacteria 1319
311 Ga0207695_10000001 3300025913 Bacteria 2888630
312 Ga0207695_10001149 3300025913 Bacteria 45947
313 Ga0207695_10003468 3300025913 Bacteria 22191
314 Ga0207695_10007220 3300025913 Bacteria 14201
315 Ga0207695_10023536 3300025913 Bacteria 6956
316 Ga0207695_10025828 3300025913 Bacteria 6566
317 Ga0207695_10036014 3300025913 Bacteria 5355
318 Ga0207695_10290848 3300025913 Bacteria 1526
319 Ga0207695_10717304 3300025913 Bacteria 880
320 Ga0207671_10005666 3300025914 Bacteria 11422
321 Ga0207671_10166701 3300025914 Bacteria 1708
322 Ga0207671_10642327 3300025914 Bacteria 845
323 Ga0207660_10005477 3300025917 Bacteria 8245
324 Ga0207660_10057471 3300025917 Bacteria 2786
325 Ga0207657_10001379 3300025919 Bacteria 25926
326 Ga0207657_10103554 3300025919 Bacteria 2359
327 Ga0207657_10180884 3300025919 Bacteria 1704
328 Ga0207649_10197204 3300025920 Bacteria 1419
329 Ga0207652_10006036 3300025921 Bacteria 9808
330 Ga0207652_10318294 3300025921 Unclassified 1405
331 Ga0207652_10734571 3300025921 Bacteria 879
332 Ga0207652_10792666 3300025921 Bacteria 842
333 Ga0207694_10101326 3300025924 Bacteria 2282
334 Ga0207694_10140283 3300025924 Bacteria 1943
335 Ga0207659_10707032 3300025926 Bacteria 863
336 Ga0207687_10403665 3300025927 Bacteria 1124
337 Ga0207700_10028747 3300025928 Bacteria 3914
338 Ga0207700_10290002 3300025928 Bacteria 1410
339 Ga0207700_10330262 3300025928 Bacteria 1323
340 Ga0207700_10686052 3300025928 Bacteria 914
341 Ga0207664_10043714 3300025929 Bacteria 3506
342 Ga0207664_10560046 3300025929 Bacteria 1026
343 Ga0207664_10797237 3300025929 Bacteria 850
344 Ga0207644_10043603 3300025931 Bacteria 3184
345 Ga0207644_10293731 3300025931 Bacteria 1308
346 Ga0207690_10001643 3300025932 Bacteria 13827
347 Ga0207670_10287786 3300025936 Bacteria 1283
348 Ga0207711_10052122 3300025941 Bacteria 3506
349 Ga0207711_10235492 3300025941 Bacteria 1678
350 Ga0207711_10259728 3300025941 Bacteria 1596
351 Ga0207661_10120142 3300025944 Bacteria 2236
352 Ga0207661_11138694 3300025944 Unclassified 718
353 Ga0207679_10248143 3300025945 Unclassified 1512
354 Ga0207667_10003594 3300025949 Bacteria 19145
355 Ga0207667_10022346 3300025949 Bacteria 6990
356 Ga0207667_10044399 3300025949 Bacteria 4710
357 Ga0207667_10098682 3300025949 Bacteria 3014
358 Ga0207667_10294111 3300025949 Bacteria 1659
359 Ga0207667_10314432 3300025949 Bacteria 1600
360 Ga0207667_10417980 3300025949 Bacteria 1364
361 Ga0207667_10459381 3300025949 Bacteria 1293
362 Ga0207667_10585464 3300025949 Bacteria 1126
363 Ga0207667_10783660 3300025949 Bacteria 951
364 Ga0207651_10201061 3300025960 Bacteria 1597
365 Ga0207712_10978781 3300025961 Bacteria 750
366 Ga0207640_10000011 3300025981 Bacteria 252283
367 Ga0207640_10527193 3300025981 Bacteria 988
368 Ga0207677_10119513 3300026023 Bacteria 1979
369 Ga0207677_10217928 3300026023 Bacteria 1529
370 Ga0207703_10027419 3300026035 Bacteria 4487
371 Ga0207639_10000025 3300026041 Bacteria 207451
372 Ga0207639_10054061 3300026041 Bacteria 3067
373 Ga0207639_10092952 3300026041 Bacteria 2418
374 Ga0207639_10441626 3300026041 Bacteria 1180
375 Ga0207678_10034832 3300026067 Bacteria 4384
376 Ga0207702_10030483 3300026078 Bacteria 4495
377 Ga0207702_10049086 3300026078 Bacteria 3561
378 Ga0207702_10087384 3300026078 Bacteria 2722
379 Ga0207702_10207777 3300026078 Bacteria 1819
380 Ga0207702_11034393 3300026078 Bacteria 815
381 Ga0207641_10270505 3300026088 Bacteria 1594
382 Ga0207648_11272500 3300026089 Bacteria 691
383 Ga0207676_10010923 3300026095 Bacteria 6479
384 Ga0207674_11119771 3300026116 Bacteria 757
385 Ga0207698_10139613 3300026142 Bacteria 2085
386 Ga0207698_10157970 3300026142 Bacteria 1979
387 Ga0207698_10171080 3300026142 Bacteria 1913
388 Ga0268266_10054155 3300028379 Bacteria 3447
389 Ga0268266_11413851 3300028379 Bacteria 671
390 Ga0268264_10878008 3300028381 Bacteria 899
391 Ga0265323_10001186 3300028653 Bacteria 13265
392 Ga0265338_10098863 3300028800 Bacteria 2386
393 Ga0265338_10194214 3300028800 Bacteria 1536
394 Ga0265332_10244653 3300031238 Bacteria 742
395 Ga0265325_10196818 3300031241 Bacteria 932
396 Ga0265325_10277842 3300031241 Unclassified 752
397 Ga0265339_10034566 3300031249 Bacteria 2840
398 Ga0265331_10024281 3300031250 Bacteria 3069
399 Ga0265331_10116825 3300031250 Bacteria 1221
400 Ga0265316_10295011 3300031344 Bacteria 1182
401 Ga0265316_10311279 3300031344 Bacteria 1145
402 Ga0265314_10026183 3300031711 Bacteria 4386
403 Ga0265342_10021562 3300031712 Bacteria 4111
404 Ga0307518_10100875 3300031838 Bacteria 2067
405 Ga0307409_101465994 3300031995 Bacteria 709
406 Ga0307411_10742165 3300032005 Bacteria 859
407 Ga0307510_10029977 3300033180 Bacteria 6177
408 Ga0373944_0197244 3300035089 Bacteria 727
409 Ga0373954_0042445 3300035118 Bacteria 2121
410 Ga0373943_0018087 3300035170 Bacteria 3234
411 Ga0373946_0014420 3300035171 Bacteria 2981
412 Ga0373924_0150212 3300035410 Bacteria 1019
413 Ga0373935_0851061 3300035692 Bacteria 674
414 Ga0373927_0004398 3300035695 Bacteria 9877
415 Ga0373927_0160841 3300035695 Bacteria 1471
416 Ga0373927_0393175 3300035695 Bacteria 915
417 Ga0373933_0417692 3300035724 Bacteria 876
418 Ga0373933_0717507 3300035724 Bacteria 658
419 Ga0373947_0041913 3300035725 Bacteria 2732
420 Ga0373947_0095549 3300035725 Bacteria 1860
421 Ga0373947_0608256 3300035725 Bacteria 745
422 Ga0373937_0348468 3300036401 Bacteria 1403
423 Ga0373937_0807698 3300036401 Bacteria 886
424 Ga0373937_1060252 3300036401 Bacteria 759
425 Ga0373937_1109377 3300036401 Bacteria 740
426 Ga0373925_0014038 3300037068 Bacteria 5799
427 Ga0373925_0441605 3300037068 Bacteria 1065
428 Ga0373925_0734242 3300037068 Unclassified 814
429 Ga0373925_0746332 3300037068 Bacteria 807
430 Ga0395899_0187046 3300037312 Unclassified 1451
431 Ga0395898_0174168 3300037466 Unclassified 2057
432 Ga0395898_0376561 3300037466 Bacteria 1354
433 Ga0395898_1125444 3300037466 Bacteria 718
434 Ga0395905_0047597 3300037471 Bacteria 4018
435 Ga0395905_0077157 3300037471 Bacteria 3122
436 Ga0436364_0051041 3300037853 Bacteria 969
437 Ga0436364_0103499 3300037853 Bacteria 3196
438 Ga0436364_0235071 3300037853 Bacteria 15101
439 Ga0436364_0309018 3300037853 Bacteria 153512
440 Ga0436364_0461614 3300037853 Bacteria 3425
441 Ga0436364_0720089 3300037853 Bacteria 3978
442 Ga0436364_0808515 3300037853 Bacteria 27053
443 Ga0436364_0851560 3300037853 Bacteria 1100
444 Ga0436364_0869275 3300037853 Bacteria 2574
445 Ga0436364_0876356 3300037853 Bacteria 6427
446 Ga0436364_1024913 3300037853 Bacteria 1139
447 Ga0436364_1424251 3300037853 Bacteria 2857
448 Ga0395901_0371642 3300038443 Bacteria 1473
449 Ga0436365_0073938 3300039437 Bacteria 2719
450 Ga0436365_0110820 3300039437 Unclassified 1072
451 Ga0436365_0165408 3300039437 Bacteria 30957
452 Ga0436365_1077991 3300039437 Bacteria 2488
453 Ga0436365_1344226 3300039437 Bacteria 801
454 Ga0436365_1620961 3300039437 Bacteria 1822
455 Ga0436365_1822297 3300039437 Bacteria 695
456 Ga0436365_1911883 3300039437 Bacteria 5768
457 Ga0436360_0145639 3300039438 Bacteria 2940
458 Ga0436360_0300036 3300039438 Unclassified 898
459 Ga0436361_0986900 3300039447 Bacteria 1282
460 Ga0436361_1094065 3300039447 Bacteria 1990
461 Ga0436363_0614006 3300039450 Unclassified 1098
462 Ga0436363_0818238 3300039450 Unclassified 790
463 Ga0436363_0820413 3300039450 Unclassified 849
464 Ga0436363_0896163 3300039450 Bacteria 5728
465 Ga0436363_1046906 3300039450 Bacteria 3388
466 Ga0436362_0283025 3300039453 Bacteria 4270
467 Ga0436362_0386289 3300039453 Bacteria 1021
468 Ga0436362_0474546 3300039453 Bacteria 1458
469 Ga0466966_0062296 3300044684 Bacteria 2352
470 Ga0466963_0123571 3300044694 Bacteria 1783
471 Ga0466963_0361048 3300044694 Bacteria 1023
472 Ga0466957_0535629 3300044842 Bacteria 815
473 Ga0466959_0293662 3300045049 Bacteria 1114
474 Ga0466959_0537488 3300045049 Unclassified 789
475 Ga0451576_0083747 3300045051 Bacteria 3317
476 Ga0451576_0400612 3300045051 Bacteria 1439
477 Ga0451576_1108959 3300045051 Bacteria 828
478 Ga0466967_0173989 3300045976 Bacteria 2027
479 Ga0466967_0322831 3300045976 Bacteria 1489
480 Ga0495592_0073303 3300046454 Bacteria 2490
481 Ga0495592_0387775 3300046454 Bacteria 887
482 Ga0495603_0001767 3300046455 Bacteria 12736
483 Ga0495603_0013033 3300046455 Bacteria 5026
484 Ga0495603_0019518 3300046455 Bacteria 4103
485 Ga0495629_0005634 3300046459 Bacteria 9354
486 Ga0495629_0013549 3300046459 Bacteria 5882
487 Ga0495651_0007913 3300046462 Bacteria 8143
488 Ga0495651_0011853 3300046462 Bacteria 6704
489 Ga0495651_0113300 3300046462 Bacteria 2002
490 Ga0495651_0126402 3300046462 Bacteria 1872
491 Ga0495651_0286765 3300046462 Bacteria 1110
492 Ga0495653_0020438 3300046463 Bacteria 5368
493 Ga0495653_0101347 3300046463 Bacteria 2086
494 Ga0495650_0000022 3300046471 Bacteria 530747
495 Ga0495580_0035996 3300046472 Bacteria 3557
496 Ga0495580_0065684 3300046472 Bacteria 2541
497 Ga0495580_0068384 3300046472 Bacteria 2484
498 Ga0495580_0170964 3300046472 Bacteria 1503
499 Ga0495580_0399955 3300046472 Bacteria 926
500 Ga0495580_0534176 3300046472 Bacteria 780
501 Ga0495582_0002862 3300046473 Bacteria 9656
502 Ga0495639_0004884 3300046475 Bacteria 5751
503 Ga0495662_0005537 3300046476 Bacteria 6314
504 Ga0495662_0093504 3300046476 Bacteria 1467
505 Ga0495664_0001397 3300046477 Bacteria 12769
506 Ga0495664_0004911 3300046477 Bacteria 7316
507 Ga0495664_0184776 3300046477 Bacteria 1264
508 Ga0495584_0113080 3300046491 Bacteria 1374
509 Ga0495585_0027729 3300046492 Bacteria 3231
510 Ga0495594_0000297 3300046499 Bacteria 24372
511 Ga0495594_0001779 3300046499 Bacteria 11189
512 Ga0495594_0002650 3300046499 Bacteria 9312
513 Ga0495594_0056916 3300046499 Bacteria 2159
514 Ga0495583_0017996 3300046506 Bacteria 3735
515 Ga0495606_0048364 3300046507 Bacteria 2798
516 Ga0495606_0154904 3300046507 Bacteria 1342
517 Ga0495608_0088622 3300046511 Bacteria 2003
518 Ga0495616_0128829 3300046513 Bacteria 1161
519 Ga0495618_0077791 3300046514 Bacteria 2114
520 Ga0495628_0010170 3300046516 Bacteria 8002
521 Ga0495628_0038349 3300046516 Bacteria 3835
522 Ga0495630_0025955 3300046517 Bacteria 4336
523 Ga0495630_0101494 3300046517 Bacteria 2176
524 Ga0495630_0594047 3300046517 Bacteria 849
525 Ga0495631_0177317 3300046518 Unclassified 913
526 Ga0495644_0000092 3300046523 Bacteria 44328
527 Ga0495663_0186888 3300046525 Bacteria 719
528 Ga0495666_0000902 3300046526 Bacteria 13936
529 Ga0495642_0258581 3300046528 Bacteria 761
530 Ga0495652_0021122 3300046529 Bacteria 5787
531 Ga0495652_0050053 3300046529 Bacteria 3574
532 Ga0495652_0075456 3300046529 Bacteria 2800
533 Ga0495665_0000995 3300046531 Bacteria 15038
534 Ga0495640_0029687 3300046533 Bacteria 3922
535 Ga0495640_0100482 3300046533 Bacteria 1899
536 Ga0495586_0002103 3300046535 Bacteria 10826
537 Ga0495586_0519907 3300046535 Bacteria 687
538 Ga0495587_0007381 3300046536 Bacteria 7124
539 Ga0495587_0039275 3300046536 Bacteria 2834
540 Ga0495609_0012713 3300046538 Bacteria 3990
541 Ga0495609_0017279 3300046538 Bacteria 3350
542 Ga0495645_0006956 3300046543 Bacteria 7861
543 Ga0495645_0008197 3300046543 Bacteria 7288
544 Ga0495645_0030352 3300046543 Bacteria 3936
545 Ga0495645_0158275 3300046543 Bacteria 1568
546 Ga0495622_0040447 3300046557 Bacteria 2170
547 Ga0495667_0039806 3300046559 Bacteria 3123
548 Ga0495667_0381604 3300046559 Bacteria 889
549 Ga0495656_0052314 3300046615 Bacteria 1751
550 Ga0495668_0034923 3300046616 Bacteria 2819
551 Ga0495668_0295206 3300046616 Bacteria 888
552 Ga0495634_0001577 3300046642 Bacteria 20063
553 Ga0495634_0658993 3300046642 Bacteria 604
554 Ga0495611_0004376 3300046648 Bacteria 6119
555 Ga0495625_0013471 3300046660 Bacteria 6570
556 Ga0495625_0071321 3300046660 Bacteria 2438
557 Ga0495635_0038522 3300046663 Bacteria 3309
558 Ga0495635_0284303 3300046663 Bacteria 1111
559 Ga0495661_0035936 3300046665 Bacteria 3106
560 Ga0495588_0053920 3300046674 Bacteria 2074
561 Ga0495599_0009354 3300046678 Bacteria 5986
562 Ga0495599_0009921 3300046678 Bacteria 5828
563 Ga0495623_0018407 3300046679 Bacteria 4512
564 Ga0495623_0031310 3300046679 Bacteria 3420
565 Ga0495623_0245996 3300046679 Bacteria 1008
566 Ga0495646_0008599 3300046680 Bacteria 6485
567 Ga0495646_0040607 3300046680 Bacteria 2864
568 Ga0495669_0003958 3300046684 Bacteria 6096
569 Ga0495613_0000761 3300046689 Bacteria 25225
570 Ga0495613_0032323 3300046689 Bacteria 3886
571 Ga0495613_0061755 3300046689 Bacteria 2743
572 Ga0495624_0014348 3300046690 Bacteria 5380
573 Ga0495624_0151191 3300046690 Bacteria 1420
574 Ga0495670_0045419 3300046691 Bacteria 2193
575 Ga0495649_0138288 3300046694 Bacteria 1283
576 Ga0495600_0000609 3300046809 Bacteria 18474
577 Ga0495600_0123019 3300046809 Bacteria 1687
578 Ga0495600_0150287 3300046809 Bacteria 1508
579 Ga0495581_0002974 3300047315 Bacteria 9703
580 Ga0495581_0082824 3300047315 Bacteria 1858
581 Ga0495581_0085239 3300047315 Bacteria 1831
582 Ga0495604_0017533 3300047317 Bacteria 5734
583 Ga0495604_0187325 3300047317 Bacteria 1444
584 Ga0495636_0041817 3300047318 Bacteria 1903
585 Ga0495636_0354616 3300047318 Bacteria 693
586 Ga0495674_0009515 3300047319 Bacteria 9232
587 Ga0495674_0034853 3300047319 Bacteria 4547
588 Ga0495674_0078289 3300047319 Bacteria 2840
589 Ga0495674_0121538 3300047319 Bacteria 2206
590 Ga0495674_0127098 3300047319 Bacteria 2150
591 Ga0495674_0346563 3300047319 Bacteria 1206
592 Ga0495676_0001068 3300047321 Bacteria 23231
593 Ga0495680_0312991 3300047322 Bacteria 1100
594 Ga0495680_0511824 3300047322 Bacteria 813
595 Ga0495675_0000836 3300047444 Bacteria 18808
596 Ga0495675_0037454 3300047444 Bacteria 3089
597 Ga0495675_0270133 3300047444 Bacteria 1016
598 Ga0495673_0040361 3300047469 Bacteria 2109
599 Ga0495684_0052075 3300047471 Bacteria 3123
600 Ga0495684_0129281 3300047471 Bacteria 1898
601 Ga0495684_0129292 3300047471 Bacteria 1898
602 Ga0495684_0231346 3300047471 Bacteria 1352
603 Ga0495686_0003025 3300047472 Bacteria 14929
604 Ga0495686_0003149 3300047472 Bacteria 14557
605 Ga0495686_0354508 3300047472 Bacteria 797
606 Ga0495602_0265235 3300048088 Bacteria 1272
607 Ga0495614_0006733 3300048089 Bacteria 5143
608 Ga0495614_0060219 3300048089 Bacteria 1631
609 Ga0496104_0258266 3300048907 Bacteria 1655
610 Ga0496105_0414509 3300048908 Bacteria 1067
611 Ga0496108_0439946 3300048911 Bacteria 1139
612 Ga0496112_1360524 3300048915 Bacteria 625
613 Ga0496113_0072700 3300048916 Bacteria 2618
614 Ga0496114_0698019 3300048917 Bacteria 890
615 Ga0496115_0047237 3300048918 Bacteria 3442
616 Ga0496126_0000231 3300048929 Bacteria 120254
617 Ga0496126_0006179 3300048929 Bacteria 13408
618 Ga0495682_0119058 3300049460 Bacteria 946
619 Ga0501297_013572 3300049520 Bacteria 957
620 Ga0501299_031817 3300049522 Bacteria 1022
621 Ga0501031_0007915 3300049568 Bacteria 6918
622 Ga0501032_0062044 3300049569 Bacteria 2505
623 Ga0501032_0594142 3300049569 Unclassified 704
624 Ga0501033_0111213 3300049570 Bacteria 1993
625 Ga0501033_0172446 3300049570 Bacteria 1553
626 Ga0501034_0035637 3300049571 Bacteria 5043
627 Ga0501036_0015802 3300049572 Bacteria 6305
628 Ga0501037_0001492 3300049573 Bacteria 17101
629 Ga0501037_0169814 3300049573 Bacteria 1551
630 Ga0501038_0003506 3300049574 Bacteria 14603
631 Ga0501038_0203625 3300049574 Bacteria 1587
632 Ga0501039_0020927 3300049575 Bacteria 5016
633 Ga0501043_0003763 3300049579 Bacteria 12473
634 Ga0501046_0024228 3300049580 Bacteria 4982
635 Ga0501047_0014625 3300049581 Bacteria 7467
636 Ga0501047_0098157 3300049581 Bacteria 2808
637 Ga0501047_0104789 3300049581 Bacteria 2708
638 Ga0501047_0166193 3300049581 Bacteria 2077
639 Ga0501048_0025324 3300049582 Bacteria 4324
640 Ga0501048_0354577 3300049582 Unclassified 1046
641 Ga0501067_0018174 3300049583 Bacteria 3893
642 Ga0501068_0001328 3300049584 Bacteria 13111
643 Ga0501068_0680203 3300049584 Unclassified 672
644 Ga0501069_0002181 3300049585 Bacteria 9856
645 Ga0501070_0035051 3300049586 Bacteria 4194
646 Ga0501070_0119715 3300049586 Bacteria 2176
647 Ga0501070_0199021 3300049586 Bacteria 1645
648 Ga0501072_0000523 3300049588 Bacteria 27564
649 Ga0501073_0000999 3300049589 Bacteria 20422
650 Ga0501073_0032062 3300049589 Bacteria 3748
651 Ga0501073_0103008 3300049589 Bacteria 1982
652 Ga0501073_0714255 3300049589 Unclassified 691
653 Ga0501074_0006388 3300049590 Bacteria 8509
654 Ga0501077_0013202 3300049593 Bacteria 5176
655 Ga0501079_0000555 3300049741 Bacteria 24463
656 Ga0501080_0112917 3300049742 Bacteria 2518
657 Ga0501083_0023532 3300049744 Bacteria 4270
658 Ga0501265_016162 3300049762 Bacteria 965
659 Ga0501270_025753 3300049767 Bacteria 934
660 Ga0501274_013685 3300049771 Bacteria 781
661 Ga0501035_0010538 3300049822 Bacteria 8566
662 Ga0501035_0037545 3300049822 Bacteria 4386
663 Ga0501044_0020162 3300049823 Bacteria 7115
664 Ga0501044_0141892 3300049823 Bacteria 2390
665 Ga0501044_0144312 3300049823 Bacteria 2367
666 Ga0501044_0159271 3300049823 Bacteria 2235
667 Ga0501045_0073298 3300049824 Bacteria 2521
668 nmdc:mga05p37_589668_c1 3300050507 Bacteria 1257
669 nmdc:mga05p37_963770_c1 3300050507 Bacteria 911
670 nmdc:mga09592_311112_c1 3300050508 Bacteria 1365
671 nmdc:mga0qj67_35717_c1 3300050509 Bacteria 3887
672 nmdc:mga0n895_515833_c1 3300050512 Bacteria 1203
673 nmdc:mga08x19_4575_c1 3300050514 Bacteria 8211
674 Ga0495612_0028781 3300053078 Bacteria 2238
675 Ga0500643_027477 3300053087 Bacteria 1769
676 Ga0500651_0000003 3300053093 Bacteria 422045
677 Ga0500638_171414 3300053162 Bacteria 945
678 Ga0501084_0000282 3300054114 Bacteria 38465
679 Ga0500661_002041 3300055283 Bacteria 3812
680 Ga0501082_0001154 3300060353 Bacteria 23280
681 Ga0501082_0071448 3300060353 Bacteria 2989

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025912 Ga0207707_10202741 Ga0207707_102027413 167
2 3300025921 Ga0207652_10734571 Ga0207652_107345712 182
3 3300025921 Ga0207652_10792666 Ga0207652_107926662 182
4 3300031712 Ga0265342_10021562 Ga0265342_100215625 182
5 3300031838 Ga0307518_10100875 Ga0307518_101008752 182
6 3300037466 Ga0395898_0376561 Ga0395898_0376561_598_1170 182
7 3300037471 Ga0395905_0047597 Ga0395905_0047597_3293_3856 182
8 3300037471 Ga0395905_0077157 Ga0395905_0077157_959_1522 182
9 3300039437 Ga0436365_0110820 Ga0436365_0110820_250_816 182
10 3300044684 Ga0466966_0062296 Ga0466966_0062296_592_1164 182
11 3300045049 Ga0466959_0293662 Ga0466959_0293662_16_588 182
12 3300046615 Ga0495656_0052314 Ga0495656_0052314_752_1309 182
13 3300005328 Ga0070676_10174955 Ga0070676_101749551 183
14 3300005329 Ga0070683_100075606 Ga0070683_1000756063 183
15 3300005329 Ga0070683_100273040 Ga0070683_1002730402 183
16 3300005329 Ga0070683_100472851 Ga0070683_1004728511 183
17 3300005329 Ga0070683_100629711 Ga0070683_1006297112 183
18 3300005330 Ga0070690_100139199 Ga0070690_1001391992 183
19 3300005330 Ga0070690_100208434 Ga0070690_1002084342 183
20 3300005336 Ga0070680_100010403 Ga0070680_1000104035 183
21 3300005336 Ga0070680_100936871 Ga0070680_1009368711 183
22 3300005338 Ga0068868_100205202 Ga0068868_1002052022 183
23 3300005338 Ga0068868_100746846 Ga0068868_1007468461 183
24 3300005339 Ga0070660_100006653 Ga0070660_1000066539 183
25 3300005339 Ga0070660_100013782 Ga0070660_1000137822 183
26 3300005340 Ga0070689_100334128 Ga0070689_1003341282 183
27 3300005341 Ga0070691_10000315 Ga0070691_100003156 183
28 3300005344 Ga0070661_100114022 Ga0070661_1001140222 183
29 3300005344 Ga0070661_100123089 Ga0070661_1001230893 183
30 3300005345 Ga0070692_10188714 Ga0070692_101887142 183
31 3300005353 Ga0070669_100827793 Ga0070669_1008277931 183
32 3300005355 Ga0070671_100000477 Ga0070671_10000047723 183
33 3300005364 Ga0070673_100193516 Ga0070673_1001935162 183
34 3300005365 Ga0070688_100260009 Ga0070688_1002600092 183
35 3300005366 Ga0070659_100000655 Ga0070659_10000065512 183
36 3300005366 Ga0070659_100108813 Ga0070659_1001088134 183
37 3300005435 Ga0070714_100329343 Ga0070714_1003293432 183
38 3300005436 Ga0070713_100011774 Ga0070713_1000117746 183
39 3300005436 Ga0070713_100018726 Ga0070713_1000187263 183
40 3300005436 Ga0070713_100383110 Ga0070713_1003831102 183
41 3300005439 Ga0070711_100080226 Ga0070711_1000802263 183
42 3300005439 Ga0070711_100336915 Ga0070711_1003369152 183
43 3300005439 Ga0070711_100390231 Ga0070711_1003902312 183
44 3300005445 Ga0070708_100774496 Ga0070708_1007744962 183
45 3300005456 Ga0070678_100034618 Ga0070678_1000346182 183
46 3300005458 Ga0070681_10001891 Ga0070681_100018916 183
47 3300005459 Ga0068867_100452269 Ga0068867_1004522692 183
48 3300005466 Ga0070685_10465052 Ga0070685_104650521 183
49 3300005530 Ga0070679_100004611 Ga0070679_10000461114 183
50 3300005530 Ga0070679_100701429 Ga0070679_1007014292 183
51 3300005535 Ga0070684_100001706 Ga0070684_1000017064 183
52 3300005535 Ga0070684_100318420 Ga0070684_1003184203 183
53 3300005535 Ga0070684_100569298 Ga0070684_1005692982 183
54 3300005539 Ga0068853_100000049 Ga0068853_10000004924 183
55 3300005539 Ga0068853_100044563 Ga0068853_1000445634 183
56 3300005539 Ga0068853_100284336 Ga0068853_1002843362 183
57 3300005539 Ga0068853_100440945 Ga0068853_1004409451 183
58 3300005547 Ga0070693_100061726 Ga0070693_1000617262 183
59 3300005548 Ga0070665_100009987 Ga0070665_1000099879 183
60 3300005548 Ga0070665_100239030 Ga0070665_1002390302 183
61 3300005548 Ga0070665_100648585 Ga0070665_1006485851 183
62 3300005548 Ga0070665_100966263 Ga0070665_1009662631 183
63 3300005563 Ga0068855_100002363 Ga0068855_10000236316 183
64 3300005563 Ga0068855_100003302 Ga0068855_10000330210 183
65 3300005563 Ga0068855_100185561 Ga0068855_1001855613 183
66 3300005563 Ga0068855_100223948 Ga0068855_1002239483 183
67 3300005563 Ga0068855_100256143 Ga0068855_1002561433 183
68 3300005563 Ga0068855_100399559 Ga0068855_1003995592 183
69 3300005563 Ga0068855_100795890 Ga0068855_1007958902 183
70 3300005564 Ga0070664_100159379 Ga0070664_1001593792 183
71 3300005564 Ga0070664_100347654 Ga0070664_1003476542 183
72 3300005577 Ga0068857_100002278 Ga0068857_10000227815 183
73 3300005577 Ga0068857_100502601 Ga0068857_1005026012 183
74 3300005577 Ga0068857_101164580 Ga0068857_1011645802 183
75 3300005578 Ga0068854_100000129 Ga0068854_10000012912 183
76 3300005614 Ga0068856_100001516 Ga0068856_10000151616 183
77 3300005614 Ga0068856_100028230 Ga0068856_1000282303 183
78 3300005614 Ga0068856_100129987 Ga0068856_1001299872 183
79 3300005615 Ga0070702_100512888 Ga0070702_1005128881 183
80 3300005616 Ga0068852_100160780 Ga0068852_1001607802 183
81 3300005616 Ga0068852_101040222 Ga0068852_1010402221 183
82 3300005617 Ga0068859_100093590 Ga0068859_1000935905 183
83 3300005617 Ga0068859_100224671 Ga0068859_1002246712 183
84 3300005617 Ga0068859_100254633 Ga0068859_1002546332 183
85 3300005618 Ga0068864_100019848 Ga0068864_1000198484 183
86 3300005618 Ga0068864_100482762 Ga0068864_1004827622 183
87 3300005841 Ga0068863_100006748 Ga0068863_1000067487 183
88 3300005841 Ga0068863_100047401 Ga0068863_1000474012 183
89 3300005841 Ga0068863_100403112 Ga0068863_1004031122 183
90 3300005842 Ga0068858_100058294 Ga0068858_1000582943 183
91 3300005842 Ga0068858_100514573 Ga0068858_1005145732 183
92 3300005842 Ga0068858_101238021 Ga0068858_1012380211 183
93 3300005843 Ga0068860_101220584 Ga0068860_1012205842 183
94 3300006028 Ga0070717_10666067 Ga0070717_106660672 183
95 3300006175 Ga0070712_100636746 Ga0070712_1006367461 183
96 3300006237 Ga0097621_100032311 Ga0097621_1000323115 183
97 3300006237 Ga0097621_100151535 Ga0097621_1001515353 183
98 3300006237 Ga0097621_100449231 Ga0097621_1004492312 183
99 3300006237 Ga0097621_100749838 Ga0097621_1007498382 183
100 3300006358 Ga0068871_100353158 Ga0068871_1003531582 183
101 3300006358 Ga0068871_100404852 Ga0068871_1004048522 183
102 3300006358 Ga0068871_100551843 Ga0068871_1005518431 183
103 3300006358 Ga0068871_101351619 Ga0068871_1013516191 183
104 3300006844 Ga0075428_100544883 Ga0075428_1005448833 183
105 3300006881 Ga0068865_100069588 Ga0068865_1000695882 183
106 3300006881 Ga0068865_100167555 Ga0068865_1001675552 183
107 3300006931 Ga0097620_100093588 Ga0097620_1000935885 183
108 3300006931 Ga0097620_100224674 Ga0097620_1002246742 183
109 3300006931 Ga0097620_100254631 Ga0097620_1002546313 183
110 3300009093 Ga0105240_10000001 Ga0105240_100000011868 183
111 3300009093 Ga0105240_10000202 Ga0105240_1000020228 183
112 3300009093 Ga0105240_10001456 Ga0105240_1000145614 183
113 3300009093 Ga0105240_10003229 Ga0105240_1000322917 183
114 3300009093 Ga0105240_10003634 Ga0105240_1000363413 183
115 3300009093 Ga0105240_10060633 Ga0105240_100606336 183
116 3300009093 Ga0105240_10797941 Ga0105240_107979412 183
117 3300009093 Ga0105240_11277877 Ga0105240_112778771 183
118 3300009098 Ga0105245_10035817 Ga0105245_100358175 183
119 3300009098 Ga0105245_10133758 Ga0105245_101337583 183
120 3300009098 Ga0105245_10152130 Ga0105245_101521303 183
121 3300009098 Ga0105245_10607858 Ga0105245_106078581 183
122 3300009101 Ga0105247_10632894 Ga0105247_106328942 183
123 3300009148 Ga0105243_10151796 Ga0105243_101517963 183
124 3300009148 Ga0105243_11229649 Ga0105243_112296491 183
125 3300009174 Ga0105241_10004691 Ga0105241_100046914 183
126 3300009174 Ga0105241_10085959 Ga0105241_100859593 183
127 3300009174 Ga0105241_10932599 Ga0105241_109325991 183
128 3300009176 Ga0105242_10294345 Ga0105242_102943452 183
129 3300009176 Ga0105242_10588675 Ga0105242_105886752 183
130 3300009177 Ga0105248_10023774 Ga0105248_100237745 183
131 3300009177 Ga0105248_10209075 Ga0105248_102090754 183
132 3300009177 Ga0105248_10381993 Ga0105248_103819932 183
133 3300009545 Ga0105237_11171410 Ga0105237_111714101 183
134 3300009551 Ga0105238_10001077 Ga0105238_1000107715 183
135 3300009551 Ga0105238_10022724 Ga0105238_100227245 183
136 3300009551 Ga0105238_10030128 Ga0105238_100301283 183
137 3300009551 Ga0105238_10039587 Ga0105238_100395876 183
138 3300010375 Ga0105239_10006418 Ga0105239_1000641814 183
139 3300010375 Ga0105239_10050366 Ga0105239_100503665 183
140 3300013104 Ga0157370_10003670 Ga0157370_100036703 183
141 3300013104 Ga0157370_10004975 Ga0157370_1000497513 183
142 3300013104 Ga0157370_10005288 Ga0157370_100052884 183
143 3300013104 Ga0157370_10012130 Ga0157370_100121306 183
144 3300013104 Ga0157370_10014494 Ga0157370_100144947 183
145 3300013104 Ga0157370_10213363 Ga0157370_102133632 183
146 3300013104 Ga0157370_10365503 Ga0157370_103655031 183
147 3300013105 Ga0157369_10003568 Ga0157369_100035685 183
148 3300013105 Ga0157369_10024819 Ga0157369_100248195 183
149 3300013105 Ga0157369_10045825 Ga0157369_100458252 183
150 3300013105 Ga0157369_10123957 Ga0157369_101239574 183
151 3300013105 Ga0157369_11038839 Ga0157369_110388391 183
152 3300013105 Ga0157369_11070589 Ga0157369_110705892 183
153 3300013296 Ga0157374_10027356 Ga0157374_100273566 183
154 3300013296 Ga0157374_10043075 Ga0157374_100430752 183
155 3300013296 Ga0157374_10362595 Ga0157374_103625952 183
156 3300013296 Ga0157374_10931736 Ga0157374_109317362 183
157 3300013297 Ga0157378_10056049 Ga0157378_100560494 183
158 3300013297 Ga0157378_10798524 Ga0157378_107985242 183
159 3300013306 Ga0163162_10006711 Ga0163162_1000671113 183
160 3300013306 Ga0163162_10162833 Ga0163162_101628332 183
161 3300013306 Ga0163162_10598451 Ga0163162_105984512 183
162 3300013306 Ga0163162_10725929 Ga0163162_107259291 183
163 3300013307 Ga0157372_10005248 Ga0157372_100052485 183
164 3300013307 Ga0157372_10031848 Ga0157372_100318482 183
165 3300013307 Ga0157372_10053364 Ga0157372_100533642 183
166 3300013307 Ga0157372_10192784 Ga0157372_101927843 183
167 3300013307 Ga0157372_10320841 Ga0157372_103208411 183
168 3300013307 Ga0157372_10488364 Ga0157372_104883642 183
169 3300013308 Ga0157375_10129517 Ga0157375_101295173 183
170 3300013308 Ga0157375_10630202 Ga0157375_106302022 183
171 3300013308 Ga0157375_10754248 Ga0157375_107542482 183
172 3300013308 Ga0157375_10896473 Ga0157375_108964732 183
173 3300013308 Ga0157375_11403802 Ga0157375_114038021 183
174 3300013308 Ga0157375_12132339 Ga0157375_121323391 183
175 3300014325 Ga0163163_10046741 Ga0163163_100467414 183
176 3300014325 Ga0163163_10181596 Ga0163163_101815963 183
177 3300014325 Ga0163163_10198281 Ga0163163_101982813 183
178 3300014325 Ga0163163_10363906 Ga0163163_103639062 183
179 3300014325 Ga0163163_10681478 Ga0163163_106814782 183
180 3300014325 Ga0163163_10792795 Ga0163163_107927951 183
181 3300014745 Ga0157377_10056138 Ga0157377_100561383 183
182 3300014745 Ga0157377_10430056 Ga0157377_104300562 183
183 3300014968 Ga0157379_10019282 Ga0157379_100192823 183
184 3300014968 Ga0157379_10156477 Ga0157379_101564772 183
185 3300014968 Ga0157379_10162722 Ga0157379_101627222 183
186 3300014968 Ga0157379_10322252 Ga0157379_103222521 183
187 3300014968 Ga0157379_10904693 Ga0157379_109046931 183
188 3300014969 Ga0157376_10009804 Ga0157376_100098042 183
189 3300014969 Ga0157376_10017134 Ga0157376_100171345 183
190 3300014969 Ga0157376_10048023 Ga0157376_100480234 183
191 3300014969 Ga0157376_10155870 Ga0157376_101558703 183
192 3300014969 Ga0157376_10248908 Ga0157376_102489082 183
193 3300014969 Ga0157376_10694341 Ga0157376_106943412 183
194 3300014969 Ga0157376_11314253 Ga0157376_113142531 183
195 3300014969 Ga0157376_11758705 Ga0157376_117587051 183
196 3300025898 Ga0207692_10326202 Ga0207692_103262021 183
197 3300025904 Ga0207647_10006083 Ga0207647_100060832 183
198 3300025913 Ga0207695_10000001 Ga0207695_100000011871 183
199 3300025913 Ga0207695_10001149 Ga0207695_1000114917 183
200 3300025913 Ga0207695_10023536 Ga0207695_100235367 183
201 3300025914 Ga0207671_10642327 Ga0207671_106423272 183
202 3300025919 Ga0207657_10001379 Ga0207657_1000137921 183
203 3300025921 Ga0207652_10006036 Ga0207652_1000603610 183
204 3300025924 Ga0207694_10140283 Ga0207694_101402832 183
205 3300025927 Ga0207687_10403665 Ga0207687_104036652 183
206 3300025928 Ga0207700_10028747 Ga0207700_100287474 183
207 3300025931 Ga0207644_10043603 Ga0207644_100436032 183
208 3300025931 Ga0207644_10293731 Ga0207644_102937311 183
209 3300025932 Ga0207690_10001643 Ga0207690_1000164314 183
210 3300025936 Ga0207670_10287786 Ga0207670_102877862 183
211 3300025941 Ga0207711_10052122 Ga0207711_100521223 183
212 3300025949 Ga0207667_10003594 Ga0207667_1000359416 183
213 3300025949 Ga0207667_10022346 Ga0207667_100223462 183
214 3300025949 Ga0207667_10417980 Ga0207667_104179802 183
215 3300025960 Ga0207651_10201061 Ga0207651_102010613 183
216 3300025981 Ga0207640_10000011 Ga0207640_10000011103 183
217 3300025981 Ga0207640_10527193 Ga0207640_105271932 183
218 3300026023 Ga0207677_10217928 Ga0207677_102179282 183
219 3300026041 Ga0207639_10000025 Ga0207639_100000252 183
220 3300026078 Ga0207702_10030483 Ga0207702_100304833 183
221 3300026088 Ga0207641_10270505 Ga0207641_102705053 183
222 3300026089 Ga0207648_11272500 Ga0207648_112725001 183
223 3300026095 Ga0207676_10010923 Ga0207676_100109235 183
224 3300026116 Ga0207674_11119771 Ga0207674_111197711 183
225 3300028379 Ga0268266_10054155 Ga0268266_100541553 183
226 3300033180 Ga0307510_10029977 Ga0307510_100299773 183
227 3300035692 Ga0373935_0851061 Ga0373935_0851061_44_619 183
228 3300037068 Ga0373925_0746332 Ga0373925_0746332_214_789 183
229 3300039437 Ga0436365_1344226 Ga0436365_1344226_139_708 183
230 3300044694 Ga0466963_0123571 Ga0466963_0123571_398_994 183
231 3300045051 Ga0451576_0400612 Ga0451576_0400612_576_1145 183
232 3300045976 Ga0466967_0173989 Ga0466967_0173989_599_1195 183
233 3300046454 Ga0495592_0073303 Ga0495592_0073303_1235_1810 183
234 3300046455 Ga0495603_0001767 Ga0495603_0001767_9309_9884 183
235 3300046455 Ga0495603_0013033 Ga0495603_0013033_354_929 183
236 3300046455 Ga0495603_0019518 Ga0495603_0019518_1025_1600 183
237 3300046459 Ga0495629_0005634 Ga0495629_0005634_2297_2872 183
238 3300046459 Ga0495629_0013549 Ga0495629_0013549_1440_2015 183
239 3300046462 Ga0495651_0007913 Ga0495651_0007913_1037_1612 183
240 3300046462 Ga0495651_0113300 Ga0495651_0113300_756_1331 183
241 3300046463 Ga0495653_0020438 Ga0495653_0020438_2950_3525 183
242 3300046471 Ga0495650_0000022 Ga0495650_0000022_515160_515732 183
243 3300046472 Ga0495580_0035996 Ga0495580_0035996_1371_1946 183
244 3300046472 Ga0495580_0068384 Ga0495580_0068384_1148_1723 183
245 3300046473 Ga0495582_0002862 Ga0495582_0002862_5444_6019 183
246 3300046475 Ga0495639_0004884 Ga0495639_0004884_3770_4345 183
247 3300046476 Ga0495662_0005537 Ga0495662_0005537_2108_2683 183
248 3300046477 Ga0495664_0001397 Ga0495664_0001397_8797_9372 183
249 3300046491 Ga0495584_0113080 Ga0495584_0113080_561_1136 183
250 3300046492 Ga0495585_0027729 Ga0495585_0027729_1939_2514 183
251 3300046499 Ga0495594_0000297 Ga0495594_0000297_9622_10197 183
252 3300046499 Ga0495594_0001779 Ga0495594_0001779_6787_7362 183
253 3300046499 Ga0495594_0002650 Ga0495594_0002650_1103_1678 183
254 3300046506 Ga0495583_0017996 Ga0495583_0017996_1602_2177 183
255 3300046507 Ga0495606_0048364 Ga0495606_0048364_372_947 183
256 3300046507 Ga0495606_0154904 Ga0495606_0154904_706_1278 183
257 3300046513 Ga0495616_0128829 Ga0495616_0128829_190_765 183
258 3300046516 Ga0495628_0010170 Ga0495628_0010170_2640_3215 183
259 3300046517 Ga0495630_0025955 Ga0495630_0025955_3419_3994 183
260 3300046518 Ga0495631_0177317 Ga0495631_0177317_98_673 183
261 3300046523 Ga0495644_0000092 Ga0495644_0000092_23722_24297 183
262 3300046525 Ga0495663_0186888 Ga0495663_0186888_81_656 183
263 3300046526 Ga0495666_0000902 Ga0495666_0000902_9424_9999 183
264 3300046528 Ga0495642_0258581 Ga0495642_0258581_30_605 183
265 3300046529 Ga0495652_0021122 Ga0495652_0021122_1594_2169 183
266 3300046529 Ga0495652_0075456 Ga0495652_0075456_1708_2283 183
267 3300046531 Ga0495665_0000995 Ga0495665_0000995_673_1245 183
268 3300046533 Ga0495640_0100482 Ga0495640_0100482_173_748 183
269 3300046535 Ga0495586_0002103 Ga0495586_0002103_941_1513 183
270 3300046536 Ga0495587_0039275 Ga0495587_0039275_2212_2787 183
271 3300046538 Ga0495609_0012713 Ga0495609_0012713_2943_3518 183
272 3300046538 Ga0495609_0017279 Ga0495609_0017279_2694_3269 183
273 3300046543 Ga0495645_0008197 Ga0495645_0008197_1024_1599 183
274 3300046543 Ga0495645_0030352 Ga0495645_0030352_648_1223 183
275 3300046543 Ga0495645_0158275 Ga0495645_0158275_895_1470 183
276 3300046557 Ga0495622_0040447 Ga0495622_0040447_1048_1623 183
277 3300046559 Ga0495667_0039806 Ga0495667_0039806_648_1223 183
278 3300046616 Ga0495668_0034923 Ga0495668_0034923_953_1528 183
279 3300046616 Ga0495668_0295206 Ga0495668_0295206_127_696 183
280 3300046642 Ga0495634_0001577 Ga0495634_0001577_13955_14527 183
281 3300046648 Ga0495611_0004376 Ga0495611_0004376_65_640 183
282 3300046660 Ga0495625_0013471 Ga0495625_0013471_3115_3690 183
283 3300046660 Ga0495625_0071321 Ga0495625_0071321_567_1142 183
284 3300046665 Ga0495661_0035936 Ga0495661_0035936_1461_2033 183
285 3300046674 Ga0495588_0053920 Ga0495588_0053920_372_947 183
286 3300046678 Ga0495599_0009354 Ga0495599_0009354_4085_4660 183
287 3300046679 Ga0495623_0031310 Ga0495623_0031310_2483_3058 183
288 3300046680 Ga0495646_0008599 Ga0495646_0008599_5221_5796 183
289 3300046684 Ga0495669_0003958 Ga0495669_0003958_2716_3291 183
290 3300046689 Ga0495613_0000761 Ga0495613_0000761_13029_13604 183
291 3300046689 Ga0495613_0032323 Ga0495613_0032323_2173_2748 183
292 3300046690 Ga0495624_0014348 Ga0495624_0014348_1919_2494 183
293 3300046691 Ga0495670_0045419 Ga0495670_0045419_1389_1964 183
294 3300046694 Ga0495649_0138288 Ga0495649_0138288_247_816 183
295 3300046809 Ga0495600_0000609 Ga0495600_0000609_3638_4213 183
296 3300046809 Ga0495600_0123019 Ga0495600_0123019_246_821 183
297 3300047315 Ga0495581_0002974 Ga0495581_0002974_2430_3005 183
298 3300047315 Ga0495581_0082824 Ga0495581_0082824_1023_1598 183
299 3300047318 Ga0495636_0041817 Ga0495636_0041817_917_1492 183
300 3300047319 Ga0495674_0034853 Ga0495674_0034853_3909_4484 183
301 3300047321 Ga0495676_0001068 Ga0495676_0001068_15520_16095 183
302 3300047444 Ga0495675_0000836 Ga0495675_0000836_15115_15690 183
303 3300047469 Ga0495673_0040361 Ga0495673_0040361_114_689 183
304 3300047471 Ga0495684_0129281 Ga0495684_0129281_811_1386 183
305 3300047472 Ga0495686_0003025 Ga0495686_0003025_3361_3936 183
306 3300047472 Ga0495686_0003149 Ga0495686_0003149_2148_2747 183
307 3300047472 Ga0495686_0354508 Ga0495686_0354508_203_778 183
308 3300048088 Ga0495602_0265235 Ga0495602_0265235_647_1222 183
309 3300048089 Ga0495614_0006733 Ga0495614_0006733_3953_4528 183
310 3300048089 Ga0495614_0060219 Ga0495614_0060219_1038_1613 183
311 3300048908 Ga0496105_0414509 Ga0496105_0414509_363_938 183
312 3300048911 Ga0496108_0439946 Ga0496108_0439946_362_937 183
313 3300048917 Ga0496114_0698019 Ga0496114_0698019_272_844 183
314 3300048929 Ga0496126_0000231 Ga0496126_0000231_40832_41407 183
315 3300048929 Ga0496126_0006179 Ga0496126_0006179_5619_6194 183
316 3300049460 Ga0495682_0119058 Ga0495682_0119058_322_891 183
317 3300053087 Ga0500643_027477 Ga0500643_027477_578_1150 183
318 3300053093 Ga0500651_0000003 Ga0500651_0000003_301589_302161 183
319 3300053162 Ga0500638_171414 Ga0500638_171414_38_610 183
320 3300055283 Ga0500661_002041 Ga0500661_002041_2411_2983 183
321 3300005366 Ga0070659_100510914 Ga0070659_1005109141 184
322 3300005539 Ga0068853_100060899 Ga0068853_1000608994 184
323 3300005563 Ga0068855_100125421 Ga0068855_1001254213 184
324 3300005563 Ga0068855_100665896 Ga0068855_1006658962 184
325 3300005564 Ga0070664_100195127 Ga0070664_1001951272 184
326 3300005614 Ga0068856_100050129 Ga0068856_1000501293 184
327 3300005614 Ga0068856_100057591 Ga0068856_1000575913 184
328 3300006237 Ga0097621_100539288 Ga0097621_1005392882 184
329 3300006880 Ga0075429_100145959 Ga0075429_1001459593 184
330 3300006914 Ga0075436_100022470 Ga0075436_1000224701 184
331 3300006914 Ga0075436_100193223 Ga0075436_1001932231 184
332 3300009545 Ga0105237_10265226 Ga0105237_102652262 184
333 3300009545 Ga0105237_11086574 Ga0105237_110865742 184
334 3300009551 Ga0105238_10106338 Ga0105238_101063383 184
335 3300010375 Ga0105239_10998064 Ga0105239_109980641 184
336 3300013100 Ga0157373_10061222 Ga0157373_100612222 184
337 3300013102 Ga0157371_10060357 Ga0157371_100603574 184
338 3300013104 Ga0157370_10407921 Ga0157370_104079212 184
339 3300013104 Ga0157370_10641143 Ga0157370_106411431 184
340 3300013105 Ga0157369_10045430 Ga0157369_100454307 184
341 3300013105 Ga0157369_10511240 Ga0157369_105112402 184
342 3300013296 Ga0157374_10012560 Ga0157374_100125604 184
343 3300013296 Ga0157374_10037335 Ga0157374_100373356 184
344 3300013307 Ga0157372_10606170 Ga0157372_106061702 184
345 3300025904 Ga0207647_10248006 Ga0207647_102480062 184
346 3300025909 Ga0207705_10476271 Ga0207705_104762712 184
347 3300025913 Ga0207695_10036014 Ga0207695_100360143 184
348 3300025914 Ga0207671_10166701 Ga0207671_101667012 184
349 3300025919 Ga0207657_10180884 Ga0207657_101808842 184
350 3300025920 Ga0207649_10197204 Ga0207649_101972042 184
351 3300025928 Ga0207700_10686052 Ga0207700_106860522 184
352 3300025929 Ga0207664_10043714 Ga0207664_100437143 184
353 3300025945 Ga0207679_10248143 Ga0207679_102481431 184
354 3300025949 Ga0207667_10098682 Ga0207667_100986823 184
355 3300025949 Ga0207667_10783660 Ga0207667_107836601 184
356 3300026041 Ga0207639_10054061 Ga0207639_100540612 184
357 3300026078 Ga0207702_10087384 Ga0207702_100873843 184
358 3300026142 Ga0207698_10171080 Ga0207698_101710802 184
359 3300031995 Ga0307409_101465994 Ga0307409_1014659941 184
360 3300032005 Ga0307411_10742165 Ga0307411_107421651 184
361 3300035725 Ga0373947_0041913 Ga0373947_0041913_1142_1720 184
362 3300039450 Ga0436363_0614006 Ga0436363_0614006_431_1012 184
363 3300039450 Ga0436363_1046906 Ga0436363_1046906_2487_3188 184
364 3300046663 Ga0495635_0284303 Ga0495635_0284303_514_1068 184
365 3300048916 Ga0496113_0072700 Ga0496113_0072700_1276_1842 184
366 3300048918 Ga0496115_0047237 Ga0496115_0047237_1888_2454 184
367 3300049520 Ga0501297_013572 Ga0501297_013572_245_820 184
368 3300049522 Ga0501299_031817 Ga0501299_031817_356_931 184
369 3300049584 Ga0501068_0680203 Ga0501068_0680203_74_634 184
370 3300049762 Ga0501265_016162 Ga0501265_016162_115_690 184
371 3300049767 Ga0501270_025753 Ga0501270_025753_130_705 184
372 3300049771 Ga0501274_013685 Ga0501274_013685_22_597 184
373 3300050508 nmdc:mga09592_311112_c1 nmdc:mga09592_311112_c1_68_622 184
374 3300050509 nmdc:mga0qj67_35717_c1 nmdc:mga0qj67_35717_c1_226_780 184
375 3300005364 Ga0070673_100133956 Ga0070673_1001339563 185
376 3300005437 Ga0070710_10513243 Ga0070710_105132432 185
377 3300005438 Ga0070701_10240910 Ga0070701_102409101 185
378 3300005617 Ga0068859_100705441 Ga0068859_1007054411 185
379 3300005618 Ga0068864_101176682 Ga0068864_1011766822 185
380 3300005842 Ga0068858_100039179 Ga0068858_1000391795 185
381 3300005843 Ga0068860_101049113 Ga0068860_1010491132 185
382 3300006931 Ga0097620_100705451 Ga0097620_1007054512 185
383 3300009093 Ga0105240_10001466 Ga0105240_1000146621 185
384 3300009093 Ga0105240_10091023 Ga0105240_100910233 185
385 3300009093 Ga0105240_10299723 Ga0105240_102997233 185
386 3300009176 Ga0105242_10523237 Ga0105242_105232372 185
387 3300009177 Ga0105248_10344935 Ga0105248_103449352 185
388 3300009545 Ga0105237_11069243 Ga0105237_110692432 185
389 3300009551 Ga0105238_10839624 Ga0105238_108396241 185
390 3300009553 Ga0105249_10847414 Ga0105249_108474141 185
391 3300010375 Ga0105239_10034686 Ga0105239_100346862 185
392 3300013306 Ga0163162_10740275 Ga0163162_107402751 185
393 3300014326 Ga0157380_10869106 Ga0157380_108691061 185
394 3300017792 Ga0163161_10193680 Ga0163161_101936802 185
395 3300021358 Ga0213873_10034584 Ga0213873_100345842 185
396 3300021384 Ga0213876_10146786 Ga0213876_101467862 185
397 3300025903 Ga0207680_10254469 Ga0207680_102544692 185
398 3300025906 Ga0207699_10057421 Ga0207699_100574213 185
399 3300025913 Ga0207695_10007220 Ga0207695_100072205 185
400 3300025913 Ga0207695_10025828 Ga0207695_100258285 185
401 3300025913 Ga0207695_10290848 Ga0207695_102908483 185
402 3300025941 Ga0207711_10235492 Ga0207711_102354921 185
403 3300025961 Ga0207712_10978781 Ga0207712_109787812 185
404 3300026035 Ga0207703_10027419 Ga0207703_100274195 185
405 3300026041 Ga0207639_10092952 Ga0207639_100929522 185
406 3300026078 Ga0207702_11034393 Ga0207702_110343932 185
407 3300028379 Ga0268266_11413851 Ga0268266_114138512 185
408 3300028381 Ga0268264_10878008 Ga0268264_108780081 185
409 3300028800 Ga0265338_10098863 Ga0265338_100988631 185
410 3300031238 Ga0265332_10244653 Ga0265332_102446531 185
411 3300035170 Ga0373943_0018087 Ga0373943_0018087_1676_2239 185
412 3300035171 Ga0373946_0014420 Ga0373946_0014420_2370_2933 185
413 3300035725 Ga0373947_0095549 Ga0373947_0095549_330_893 185
414 3300035725 Ga0373947_0608256 Ga0373947_0608256_133_696 185
415 3300036401 Ga0373937_1060252 Ga0373937_1060252_115_678 185
416 3300039437 Ga0436365_1620961 Ga0436365_1620961_1020_1580 185
417 3300039447 Ga0436361_0986900 Ga0436361_0986900_129_689 185
418 3300039450 Ga0436363_0818238 Ga0436363_0818238_37_597 185
419 3300039453 Ga0436362_0474546 Ga0436362_0474546_556_1116 185
420 3300046472 Ga0495580_0065684 Ga0495580_0065684_29_592 185
421 3300046499 Ga0495594_0056916 Ga0495594_0056916_348_911 185
422 3300047318 Ga0495636_0354616 Ga0495636_0354616_88_657 185
423 3300047319 Ga0495674_0121538 Ga0495674_0121538_1174_1737 185
424 3300049568 Ga0501031_0007915 Ga0501031_0007915_3011_3568 185
425 3300049569 Ga0501032_0062044 Ga0501032_0062044_1476_2033 185
426 3300049570 Ga0501033_0111213 Ga0501033_0111213_735_1292 185
427 3300049571 Ga0501034_0035637 Ga0501034_0035637_4127_4684 185
428 3300049572 Ga0501036_0015802 Ga0501036_0015802_1494_2051 185
429 3300049573 Ga0501037_0001492 Ga0501037_0001492_13910_14467 185
430 3300049574 Ga0501038_0003506 Ga0501038_0003506_5445_6002 185
431 3300049575 Ga0501039_0020927 Ga0501039_0020927_23_580 185
432 3300049579 Ga0501043_0003763 Ga0501043_0003763_3513_4070 185
433 3300049580 Ga0501046_0024228 Ga0501046_0024228_2310_2867 185
434 3300049581 Ga0501047_0014625 Ga0501047_0014625_607_1164 185
435 3300049582 Ga0501048_0025324 Ga0501048_0025324_2620_3177 185
436 3300049583 Ga0501067_0018174 Ga0501067_0018174_702_1259 185
437 3300049584 Ga0501068_0001328 Ga0501068_0001328_6432_6989 185
438 3300049585 Ga0501069_0002181 Ga0501069_0002181_1979_2536 185
439 3300049586 Ga0501070_0199021 Ga0501070_0199021_387_944 185
440 3300049588 Ga0501072_0000523 Ga0501072_0000523_21435_21992 185
441 3300049589 Ga0501073_0000999 Ga0501073_0000999_3499_4056 185
442 3300049590 Ga0501074_0006388 Ga0501074_0006388_620_1177 185
443 3300049593 Ga0501077_0013202 Ga0501077_0013202_112_669 185
444 3300049741 Ga0501079_0000555 Ga0501079_0000555_15389_15946 185
445 3300049742 Ga0501080_0112917 Ga0501080_0112917_387_944 185
446 3300049744 Ga0501083_0023532 Ga0501083_0023532_702_1259 185
447 3300049822 Ga0501035_0037545 Ga0501035_0037545_1195_1752 185
448 3300049823 Ga0501044_0141892 Ga0501044_0141892_259_816 185
449 3300049824 Ga0501045_0073298 Ga0501045_0073298_1198_1755 185
450 3300053078 Ga0495612_0028781 Ga0495612_0028781_433_996 185
451 3300054114 Ga0501084_0000282 Ga0501084_0000282_23039_23596 185
452 3300060353 Ga0501082_0001154 Ga0501082_0001154_14870_15427 185
453 3300005327 Ga0070658_10069958 Ga0070658_100699584 186
454 3300005327 Ga0070658_10262991 Ga0070658_102629913 186
455 3300005329 Ga0070683_100000011 Ga0070683_10000001129 186
456 3300005329 Ga0070683_100080046 Ga0070683_1000800463 186
457 3300005329 Ga0070683_100084660 Ga0070683_1000846603 186
458 3300005336 Ga0070680_100543607 Ga0070680_1005436071 186
459 3300005339 Ga0070660_100084760 Ga0070660_1000847602 186
460 3300005355 Ga0070671_100480845 Ga0070671_1004808452 186
461 3300005367 Ga0070667_101413976 Ga0070667_1014139761 186
462 3300005434 Ga0070709_10242284 Ga0070709_102422842 186
463 3300005436 Ga0070713_100104505 Ga0070713_1001045052 186
464 3300005436 Ga0070713_100184902 Ga0070713_1001849023 186
465 3300005458 Ga0070681_10121574 Ga0070681_101215743 186
466 3300005458 Ga0070681_10215261 Ga0070681_102152613 186
467 3300005458 Ga0070681_10480069 Ga0070681_104800691 186
468 3300005467 Ga0070706_100273609 Ga0070706_1002736092 186
469 3300005467 Ga0070706_100645130 Ga0070706_1006451302 186
470 3300005518 Ga0070699_100223003 Ga0070699_1002230032 186
471 3300005530 Ga0070679_100314098 Ga0070679_1003140982 186
472 3300005535 Ga0070684_100000001 Ga0070684_100000001229 186
473 3300005535 Ga0070684_100255017 Ga0070684_1002550171 186
474 3300005536 Ga0070697_100086077 Ga0070697_1000860772 186
475 3300005539 Ga0068853_100296303 Ga0068853_1002963032 186
476 3300005563 Ga0068855_100002895 Ga0068855_1000028954 186
477 3300005563 Ga0068855_100054809 Ga0068855_1000548092 186
478 3300005563 Ga0068855_100078450 Ga0068855_1000784504 186
479 3300005614 Ga0068856_100902062 Ga0068856_1009020622 186
480 3300005616 Ga0068852_100002225 Ga0068852_10000222513 186
481 3300005616 Ga0068852_100885137 Ga0068852_1008851372 186
482 3300005616 Ga0068852_101099263 Ga0068852_1010992632 186
483 3300005617 Ga0068859_100349276 Ga0068859_1003492761 186
484 3300005841 Ga0068863_101282984 Ga0068863_1012829842 186
485 3300005983 Ga0081540_1141879 Ga0081540_11418791 186
486 3300006028 Ga0070717_10064577 Ga0070717_100645772 186
487 3300006175 Ga0070712_100563424 Ga0070712_1005634241 186
488 3300006844 Ga0075428_100744378 Ga0075428_1007443781 186
489 3300006914 Ga0075436_100012886 Ga0075436_1000128865 186
490 3300006931 Ga0097620_100349232 Ga0097620_1003492322 186
491 3300009093 Ga0105240_10033834 Ga0105240_100338343 186
492 3300009093 Ga0105240_10045233 Ga0105240_100452335 186
493 3300009093 Ga0105240_10153005 Ga0105240_101530054 186
494 3300009093 Ga0105240_10300226 Ga0105240_103002262 186
495 3300009093 Ga0105240_10730300 Ga0105240_107303002 186
496 3300009147 Ga0114129_10688031 Ga0114129_106880312 186
497 3300009177 Ga0105248_10047585 Ga0105248_100475852 186
498 3300009545 Ga0105237_10062276 Ga0105237_100622763 186
499 3300009551 Ga0105238_10054576 Ga0105238_100545762 186
500 3300009551 Ga0105238_10146453 Ga0105238_101464532 186
501 3300009551 Ga0105238_10447302 Ga0105238_104473021 186
502 3300010375 Ga0105239_10075890 Ga0105239_100758903 186
503 3300013102 Ga0157371_10544180 Ga0157371_105441801 186
504 3300013104 Ga0157370_10002989 Ga0157370_1000298913 186
505 3300013104 Ga0157370_10233827 Ga0157370_102338272 186
506 3300013104 Ga0157370_10326086 Ga0157370_103260862 186
507 3300013105 Ga0157369_10402438 Ga0157369_104024382 186
508 3300013105 Ga0157369_10469865 Ga0157369_104698653 186
509 3300013297 Ga0157378_11764960 Ga0157378_117649601 186
510 3300013307 Ga0157372_10069139 Ga0157372_100691393 186
511 3300013307 Ga0157372_10204851 Ga0157372_102048513 186
512 3300021377 Ga0213874_10040201 Ga0213874_100402013 186
513 3300021384 Ga0213876_10009021 Ga0213876_100090214 186
514 3300021384 Ga0213876_10127561 Ga0213876_101275612 186
515 3300021388 Ga0213875_10003299 Ga0213875_100032993 186
516 3300021388 Ga0213875_10025228 Ga0213875_100252283 186
517 3300021388 Ga0213875_10093524 Ga0213875_100935242 186
518 3300021388 Ga0213875_10223391 Ga0213875_102233912 186
519 3300021388 Ga0213875_10377130 Ga0213875_103771301 186
520 3300025909 Ga0207705_10041534 Ga0207705_100415344 186
521 3300025909 Ga0207705_10083813 Ga0207705_100838134 186
522 3300025909 Ga0207705_10265714 Ga0207705_102657142 186
523 3300025910 Ga0207684_10433823 Ga0207684_104338232 186
524 3300025910 Ga0207684_10531568 Ga0207684_105315682 186
525 3300025912 Ga0207707_10163031 Ga0207707_101630312 186
526 3300025912 Ga0207707_10328821 Ga0207707_103288212 186
527 3300025913 Ga0207695_10003468 Ga0207695_1000346820 186
528 3300025913 Ga0207695_10717304 Ga0207695_107173041 186
529 3300025914 Ga0207671_10005666 Ga0207671_100056663 186
530 3300025917 Ga0207660_10005477 Ga0207660_100054774 186
531 3300025917 Ga0207660_10057471 Ga0207660_100574713 186
532 3300025919 Ga0207657_10103554 Ga0207657_101035542 186
533 3300025921 Ga0207652_10318294 Ga0207652_103182942 186
534 3300025924 Ga0207694_10101326 Ga0207694_101013263 186
535 3300025926 Ga0207659_10707032 Ga0207659_107070322 186
536 3300025928 Ga0207700_10290002 Ga0207700_102900021 186
537 3300025928 Ga0207700_10330262 Ga0207700_103302622 186
538 3300025929 Ga0207664_10560046 Ga0207664_105600462 186
539 3300025929 Ga0207664_10797237 Ga0207664_107972372 186
540 3300025941 Ga0207711_10259728 Ga0207711_102597282 186
541 3300025944 Ga0207661_10120142 Ga0207661_101201423 186
542 3300025944 Ga0207661_11138694 Ga0207661_111386941 186
543 3300025949 Ga0207667_10044399 Ga0207667_100443994 186
544 3300025949 Ga0207667_10294111 Ga0207667_102941112 186
545 3300025949 Ga0207667_10314432 Ga0207667_103144323 186
546 3300025949 Ga0207667_10459381 Ga0207667_104593812 186
547 3300025949 Ga0207667_10585464 Ga0207667_105854642 186
548 3300026023 Ga0207677_10119513 Ga0207677_101195133 186
549 3300026041 Ga0207639_10441626 Ga0207639_104416262 186
550 3300026067 Ga0207678_10034832 Ga0207678_100348323 186
551 3300026078 Ga0207702_10049086 Ga0207702_100490864 186
552 3300026078 Ga0207702_10207777 Ga0207702_102077773 186
553 3300026142 Ga0207698_10139613 Ga0207698_101396132 186
554 3300026142 Ga0207698_10157970 Ga0207698_101579703 186
555 3300028653 Ga0265323_10001186 Ga0265323_100011868 186
556 3300028800 Ga0265338_10194214 Ga0265338_101942142 186
557 3300031241 Ga0265325_10196818 Ga0265325_101968181 186
558 3300031241 Ga0265325_10277842 Ga0265325_102778421 186
559 3300031249 Ga0265339_10034566 Ga0265339_100345662 186
560 3300031250 Ga0265331_10024281 Ga0265331_100242813 186
561 3300031250 Ga0265331_10116825 Ga0265331_101168252 186
562 3300031344 Ga0265316_10295011 Ga0265316_102950112 186
563 3300031344 Ga0265316_10311279 Ga0265316_103112792 186
564 3300031711 Ga0265314_10026183 Ga0265314_100261834 186
565 3300035089 Ga0373944_0197244 Ga0373944_0197244_75_638 186
566 3300035118 Ga0373954_0042445 Ga0373954_0042445_647_1210 186
567 3300035410 Ga0373924_0150212 Ga0373924_0150212_407_970 186
568 3300035695 Ga0373927_0004398 Ga0373927_0004398_5913_6476 186
569 3300035695 Ga0373927_0160841 Ga0373927_0160841_521_1084 186
570 3300035695 Ga0373927_0393175 Ga0373927_0393175_297_863 186
571 3300035724 Ga0373933_0417692 Ga0373933_0417692_87_653 186
572 3300035724 Ga0373933_0717507 Ga0373933_0717507_64_624 186
573 3300036401 Ga0373937_0348468 Ga0373937_0348468_263_829 186
574 3300036401 Ga0373937_0807698 Ga0373937_0807698_33_614 186
575 3300036401 Ga0373937_1109377 Ga0373937_1109377_105_668 186
576 3300037068 Ga0373925_0014038 Ga0373925_0014038_3289_3852 186
577 3300037068 Ga0373925_0441605 Ga0373925_0441605_316_879 186
578 3300037068 Ga0373925_0734242 Ga0373925_0734242_19_600 186
579 3300037312 Ga0395899_0187046 Ga0395899_0187046_457_1038 186
580 3300037466 Ga0395898_0174168 Ga0395898_0174168_1319_1900 186
581 3300037466 Ga0395898_1125444 Ga0395898_1125444_46_627 186
582 3300037853 Ga0436364_0051041 Ga0436364_0051041_375_950 186
583 3300037853 Ga0436364_0103499 Ga0436364_0103499_849_1424 186
584 3300037853 Ga0436364_0235071 Ga0436364_0235071_3771_4352 186
585 3300037853 Ga0436364_0309018 Ga0436364_0309018_77125_77706 186
586 3300037853 Ga0436364_0461614 Ga0436364_0461614_1785_2360 186
587 3300037853 Ga0436364_0720089 Ga0436364_0720089_131_694 186
588 3300037853 Ga0436364_0808515 Ga0436364_0808515_24420_24980 186
589 3300037853 Ga0436364_0851560 Ga0436364_0851560_200_772 186
590 3300037853 Ga0436364_0869275 Ga0436364_0869275_1422_1997 186
591 3300037853 Ga0436364_0876356 Ga0436364_0876356_1538_2113 186
592 3300037853 Ga0436364_1024913 Ga0436364_1024913_154_717 186
593 3300037853 Ga0436364_1424251 Ga0436364_1424251_1219_1806 186
594 3300038443 Ga0395901_0371642 Ga0395901_0371642_175_756 186
595 3300039437 Ga0436365_0073938 Ga0436365_0073938_1046_1630 186
596 3300039437 Ga0436365_0165408 Ga0436365_0165408_18903_19475 186
597 3300039437 Ga0436365_1077991 Ga0436365_1077991_653_1240 186
598 3300039437 Ga0436365_1822297 Ga0436365_1822297_62_634 186
599 3300039437 Ga0436365_1911883 Ga0436365_1911883_4207_4785 186
600 3300039438 Ga0436360_0145639 Ga0436360_0145639_926_1498 186
601 3300039438 Ga0436360_0300036 Ga0436360_0300036_108_683 186
602 3300039447 Ga0436361_1094065 Ga0436361_1094065_1057_1629 186
603 3300039450 Ga0436363_0820413 Ga0436363_0820413_105_674 186
604 3300039450 Ga0436363_0896163 Ga0436363_0896163_4187_4759 186
605 3300039453 Ga0436362_0283025 Ga0436362_0283025_925_1497 186
606 3300039453 Ga0436362_0386289 Ga0436362_0386289_415_1005 186
607 3300044694 Ga0466963_0361048 Ga0466963_0361048_215_784 186
608 3300044842 Ga0466957_0535629 Ga0466957_0535629_118_693 186
609 3300045049 Ga0466959_0537488 Ga0466959_0537488_149_721 186
610 3300045051 Ga0451576_0083747 Ga0451576_0083747_951_1514 186
611 3300045051 Ga0451576_1108959 Ga0451576_1108959_103_666 186
612 3300045976 Ga0466967_0322831 Ga0466967_0322831_492_1061 186
613 3300046454 Ga0495592_0387775 Ga0495592_0387775_66_629 186
614 3300046462 Ga0495651_0011853 Ga0495651_0011853_2715_3278 186
615 3300046462 Ga0495651_0126402 Ga0495651_0126402_127_690 186
616 3300046462 Ga0495651_0286765 Ga0495651_0286765_396_962 186
617 3300046463 Ga0495653_0101347 Ga0495653_0101347_1439_2002 186
618 3300046472 Ga0495580_0170964 Ga0495580_0170964_415_978 186
619 3300046472 Ga0495580_0399955 Ga0495580_0399955_54_617 186
620 3300046472 Ga0495580_0534176 Ga0495580_0534176_157_720 186
621 3300046476 Ga0495662_0093504 Ga0495662_0093504_856_1419 186
622 3300046477 Ga0495664_0004911 Ga0495664_0004911_4827_5390 186
623 3300046477 Ga0495664_0184776 Ga0495664_0184776_129_692 186
624 3300046511 Ga0495608_0088622 Ga0495608_0088622_671_1234 186
625 3300046514 Ga0495618_0077791 Ga0495618_0077791_131_694 186
626 3300046516 Ga0495628_0038349 Ga0495628_0038349_3014_3577 186
627 3300046517 Ga0495630_0101494 Ga0495630_0101494_591_1154 186
628 3300046517 Ga0495630_0594047 Ga0495630_0594047_256_819 186
629 3300046529 Ga0495652_0050053 Ga0495652_0050053_1015_1578 186
630 3300046533 Ga0495640_0029687 Ga0495640_0029687_3077_3640 186
631 3300046535 Ga0495586_0519907 Ga0495586_0519907_12_575 186
632 3300046536 Ga0495587_0007381 Ga0495587_0007381_6300_6863 186
633 3300046543 Ga0495645_0006956 Ga0495645_0006956_1246_1809 186
634 3300046559 Ga0495667_0381604 Ga0495667_0381604_50_613 186
635 3300046642 Ga0495634_0658993 Ga0495634_0658993_30_593 186
636 3300046663 Ga0495635_0038522 Ga0495635_0038522_78_641 186
637 3300046678 Ga0495599_0009921 Ga0495599_0009921_1379_1942 186
638 3300046679 Ga0495623_0018407 Ga0495623_0018407_1983_2546 186
639 3300046679 Ga0495623_0245996 Ga0495623_0245996_428_991 186
640 3300046680 Ga0495646_0040607 Ga0495646_0040607_312_875 186
641 3300046689 Ga0495613_0061755 Ga0495613_0061755_1796_2359 186
642 3300046690 Ga0495624_0151191 Ga0495624_0151191_810_1376 186
643 3300046809 Ga0495600_0150287 Ga0495600_0150287_40_603 186
644 3300047315 Ga0495581_0085239 Ga0495581_0085239_69_632 186
645 3300047317 Ga0495604_0017533 Ga0495604_0017533_1536_2099 186
646 3300047317 Ga0495604_0187325 Ga0495604_0187325_664_1227 186
647 3300047319 Ga0495674_0009515 Ga0495674_0009515_5723_6286 186
648 3300047319 Ga0495674_0078289 Ga0495674_0078289_2228_2791 186
649 3300047319 Ga0495674_0127098 Ga0495674_0127098_1314_1877 186
650 3300047319 Ga0495674_0346563 Ga0495674_0346563_617_1180 186
651 3300047322 Ga0495680_0312991 Ga0495680_0312991_337_900 186
652 3300047322 Ga0495680_0511824 Ga0495680_0511824_49_612 186
653 3300047444 Ga0495675_0037454 Ga0495675_0037454_1200_1763 186
654 3300047444 Ga0495675_0270133 Ga0495675_0270133_287_850 186
655 3300047471 Ga0495684_0052075 Ga0495684_0052075_719_1282 186
656 3300047471 Ga0495684_0129292 Ga0495684_0129292_984_1547 186
657 3300047471 Ga0495684_0231346 Ga0495684_0231346_204_767 186
658 3300048907 Ga0496104_0258266 Ga0496104_0258266_784_1365 186
659 3300048915 Ga0496112_1360524 Ga0496112_1360524_33_596 186
660 3300049569 Ga0501032_0594142 Ga0501032_0594142_46_618 186
661 3300049570 Ga0501033_0172446 Ga0501033_0172446_124_705 186
662 3300049573 Ga0501037_0169814 Ga0501037_0169814_759_1340 186
663 3300049574 Ga0501038_0203625 Ga0501038_0203625_589_1170 186
664 3300049581 Ga0501047_0098157 Ga0501047_0098157_875_1447 186
665 3300049581 Ga0501047_0104789 Ga0501047_0104789_352_933 186
666 3300049581 Ga0501047_0166193 Ga0501047_0166193_745_1317 186
667 3300049582 Ga0501048_0354577 Ga0501048_0354577_259_840 186
668 3300049586 Ga0501070_0035051 Ga0501070_0035051_1056_1637 186
669 3300049586 Ga0501070_0119715 Ga0501070_0119715_907_1479 186
670 3300049589 Ga0501073_0032062 Ga0501073_0032062_2178_2768 186
671 3300049589 Ga0501073_0103008 Ga0501073_0103008_349_930 186
672 3300049589 Ga0501073_0714255 Ga0501073_0714255_50_622 186
673 3300049822 Ga0501035_0010538 Ga0501035_0010538_7899_8480 186
674 3300049823 Ga0501044_0020162 Ga0501044_0020162_5701_6273 186
675 3300049823 Ga0501044_0144312 Ga0501044_0144312_1076_1657 186
676 3300049823 Ga0501044_0159271 Ga0501044_0159271_782_1354 186
677 3300050507 nmdc:mga05p37_589668_c1 nmdc:mga05p37_589668_c1_117_683 186
678 3300050507 nmdc:mga05p37_963770_c1 nmdc:mga05p37_963770_c1_108_674 186
679 3300050512 nmdc:mga0n895_515833_c1 nmdc:mga0n895_515833_c1_190_753 186
680 3300050514 nmdc:mga08x19_4575_c1 nmdc:mga08x19_4575_c1_255_818 186
681 3300060353 Ga0501082_0071448 Ga0501082_0071448_400_990 186

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00156

Pribosyltran

Phosphoribosyl transferase domain

32

193

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
4p81-assembly1.cif.gz_C structure of ancestral pyrr protein (ancorangepyrr) 0.9758 5 180
4p81-assembly1.cif.gz_B structure of ancestral pyrr protein (ancorangepyrr) 0.9749 5 180
4p81-assembly1.cif.gz_A structure of ancestral pyrr protein (ancorangepyrr) 0.9746 7 180
4p83-assembly1.cif.gz_A structure of engineered pyrr protein (purple pyrr) 0.9744 7 178
4p81-assembly1.cif.gz_D structure of ancestral pyrr protein (ancorangepyrr) 0.973 5 180
ID Description Score Start End Superfamily
4p83D00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9668 7 180 3.40.50.2020
4p83D00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9558 7 180 3.40.50.2020
af_P9WHK3_1_193_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8605 1 178 3.40.50.2020
1vdmG00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8517 12 155 3.40.50.2020
4zfnB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8392 12 157 3.40.50.2020
ID Description Score Start End GO Terms
AF-U2TCS4-F1-model_v4 Pyrimidine operon regulatory protein/uracil phosphoribosyltransferase PyrR domain protein 0.986 95 180 GO:0016757
AF-A0A645JJQ7-F1-model_v4 Bifunctional protein PyrR 0.9856 97 180
AF-A0A6L6C5Y7-F1-model_v4 deleted 0.9821 97 183
AF-X8AUL1-F1-model_v4 deleted 0.9815 96 178
AF-J9HBG7-F1-model_v4 deleted 0.9767 96 183

Feature Viewer

pLDDT pTM Quality
89.91 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map