F474842
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 681 | 285 | 681 | 188 |
Family's Representative Sequence
| Representative Sequence | 3300031838|Ga0307518_10100875|Ga0307518_101008752 |
| Length | 210 |
| Sequence | VTAPPVGPASGGAAHDAFNQAILADTGTDRQARPILTGSDLARITARMAHQILEKTRGADHTILLGIPTRGVPLARRLADRIAAFEGAEVPVGTLDVTLYRDDLKLRGTRALGPTDLPPDGIDGQRVILVDDVLFSGRTVRAALDALNDLGRPSQVQLAVLVDRGHRQLPIRADYVGKNLPTAQSESVRVLLHEIDGADAVLLAGGEGVG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 6 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 7 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 10 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 28 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 35 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 38 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 40 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 41 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 42 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 44 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 45 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 46 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 47 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 48 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 49 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 50 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 54 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 55 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 56 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 57 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 58 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 87 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 88 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 89 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 90 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 131 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 132 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 133 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 134 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 135 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 136 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 137 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 138 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 139 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 140 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 141 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 142 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 143 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 144 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 145 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 146 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 147 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 148 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 149 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 150 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 151 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 152 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 153 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 154 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 155 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 156 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 157 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 158 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 159 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 160 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 161 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 162 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 163 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 164 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 165 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 166 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 167 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 168 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 169 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 170 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 235 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 236 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 237 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 238 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 239 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 240 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 241 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 242 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 244 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 245 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 248 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 250 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 253 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 254 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 257 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 269 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 270 | 3300049771 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control | Metagenome | Rhizosphere |
| 271 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 275 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 276 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 278 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 279 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 281 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 282 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 283 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 285 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.59 |
| Nodule | 0 |
| Rhizoplane | 1.03 |
| Rhizosphere | 92.8 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.58 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_10069958 | 3300005327 | Bacteria | 2872 |
| 2 | Ga0070658_10262991 | 3300005327 | Bacteria | 1465 |
| 3 | Ga0070676_10174955 | 3300005328 | Bacteria | 1391 |
| 4 | Ga0070683_100000011 | 3300005329 | Bacteria | 283682 |
| 5 | Ga0070683_100075606 | 3300005329 | Bacteria | 3147 |
| 6 | Ga0070683_100080046 | 3300005329 | Bacteria | 3058 |
| 7 | Ga0070683_100084660 | 3300005329 | Bacteria | 2971 |
| 8 | Ga0070683_100273040 | 3300005329 | Bacteria | 1608 |
| 9 | Ga0070683_100472851 | 3300005329 | Bacteria | 1197 |
| 10 | Ga0070683_100629711 | 3300005329 | Bacteria | 1027 |
| 11 | Ga0070690_100139199 | 3300005330 | Unclassified | 1646 |
| 12 | Ga0070690_100208434 | 3300005330 | Bacteria | 1363 |
| 13 | Ga0070680_100010403 | 3300005336 | Bacteria | 7172 |
| 14 | Ga0070680_100543607 | 3300005336 | Unclassified | 995 |
| 15 | Ga0070680_100936871 | 3300005336 | Bacteria | 747 |
| 16 | Ga0068868_100205202 | 3300005338 | Bacteria | 1645 |
| 17 | Ga0068868_100746846 | 3300005338 | Bacteria | 879 |
| 18 | Ga0070660_100006653 | 3300005339 | Bacteria | 8018 |
| 19 | Ga0070660_100013782 | 3300005339 | Bacteria | 5815 |
| 20 | Ga0070660_100084760 | 3300005339 | Bacteria | 2491 |
| 21 | Ga0070689_100334128 | 3300005340 | Bacteria | 1268 |
| 22 | Ga0070691_10000315 | 3300005341 | Bacteria | 17057 |
| 23 | Ga0070661_100114022 | 3300005344 | Bacteria | 2020 |
| 24 | Ga0070661_100123089 | 3300005344 | Unclassified | 1944 |
| 25 | Ga0070692_10188714 | 3300005345 | Bacteria | 1199 |
| 26 | Ga0070669_100827793 | 3300005353 | Bacteria | 788 |
| 27 | Ga0070671_100000477 | 3300005355 | Bacteria | 27818 |
| 28 | Ga0070671_100480845 | 3300005355 | Bacteria | 1067 |
| 29 | Ga0070673_100133956 | 3300005364 | Unclassified | 2083 |
| 30 | Ga0070673_100193516 | 3300005364 | Bacteria | 1748 |
| 31 | Ga0070688_100260009 | 3300005365 | Bacteria | 1239 |
| 32 | Ga0070659_100000655 | 3300005366 | Bacteria | 25206 |
| 33 | Ga0070659_100108813 | 3300005366 | Bacteria | 2236 |
| 34 | Ga0070659_100510914 | 3300005366 | Bacteria | 1025 |
| 35 | Ga0070667_101413976 | 3300005367 | Bacteria | 653 |
| 36 | Ga0070709_10242284 | 3300005434 | Bacteria | 1295 |
| 37 | Ga0070714_100329343 | 3300005435 | Bacteria | 1430 |
| 38 | Ga0070713_100011774 | 3300005436 | Bacteria | 6389 |
| 39 | Ga0070713_100018726 | 3300005436 | Bacteria | 5267 |
| 40 | Ga0070713_100104505 | 3300005436 | Bacteria | 2459 |
| 41 | Ga0070713_100184902 | 3300005436 | Bacteria | 1875 |
| 42 | Ga0070713_100383110 | 3300005436 | Bacteria | 1310 |
| 43 | Ga0070710_10513243 | 3300005437 | Bacteria | 822 |
| 44 | Ga0070701_10240910 | 3300005438 | Bacteria | 1088 |
| 45 | Ga0070711_100080226 | 3300005439 | Bacteria | 2323 |
| 46 | Ga0070711_100336915 | 3300005439 | Bacteria | 1209 |
| 47 | Ga0070711_100390231 | 3300005439 | Bacteria | 1128 |
| 48 | Ga0070708_100774496 | 3300005445 | Bacteria | 902 |
| 49 | Ga0070678_100034618 | 3300005456 | Bacteria | 3519 |
| 50 | Ga0070681_10001891 | 3300005458 | Bacteria | 18900 |
| 51 | Ga0070681_10121574 | 3300005458 | Bacteria | 2545 |
| 52 | Ga0070681_10215261 | 3300005458 | Bacteria | 1837 |
| 53 | Ga0070681_10480069 | 3300005458 | Bacteria | 1156 |
| 54 | Ga0068867_100452269 | 3300005459 | Bacteria | 1094 |
| 55 | Ga0070685_10465052 | 3300005466 | Bacteria | 889 |
| 56 | Ga0070706_100273609 | 3300005467 | Bacteria | 1576 |
| 57 | Ga0070706_100645130 | 3300005467 | Unclassified | 983 |
| 58 | Ga0070699_100223003 | 3300005518 | Bacteria | 1680 |
| 59 | Ga0070679_100004611 | 3300005530 | Bacteria | 12725 |
| 60 | Ga0070679_100314098 | 3300005530 | Bacteria | 1517 |
| 61 | Ga0070679_100701429 | 3300005530 | Bacteria | 955 |
| 62 | Ga0070684_100000001 | 3300005535 | Bacteria | 300240 |
| 63 | Ga0070684_100001706 | 3300005535 | Bacteria | 16001 |
| 64 | Ga0070684_100255017 | 3300005535 | Bacteria | 1603 |
| 65 | Ga0070684_100318420 | 3300005535 | Bacteria | 1429 |
| 66 | Ga0070684_100569298 | 3300005535 | Unclassified | 1052 |
| 67 | Ga0070697_100086077 | 3300005536 | Bacteria | 2593 |
| 68 | Ga0068853_100000049 | 3300005539 | Bacteria | 90347 |
| 69 | Ga0068853_100044563 | 3300005539 | Bacteria | 3797 |
| 70 | Ga0068853_100060899 | 3300005539 | Bacteria | 3263 |
| 71 | Ga0068853_100284336 | 3300005539 | Bacteria | 1525 |
| 72 | Ga0068853_100296303 | 3300005539 | Bacteria | 1494 |
| 73 | Ga0068853_100440945 | 3300005539 | Bacteria | 1224 |
| 74 | Ga0070693_100061726 | 3300005547 | Bacteria | 2180 |
| 75 | Ga0070665_100009987 | 3300005548 | Bacteria | 9603 |
| 76 | Ga0070665_100239030 | 3300005548 | Bacteria | 1817 |
| 77 | Ga0070665_100648585 | 3300005548 | Bacteria | 1069 |
| 78 | Ga0070665_100966263 | 3300005548 | Bacteria | 864 |
| 79 | Ga0068855_100002363 | 3300005563 | Bacteria | 23276 |
| 80 | Ga0068855_100002895 | 3300005563 | Bacteria | 21003 |
| 81 | Ga0068855_100003302 | 3300005563 | Bacteria | 19746 |
| 82 | Ga0068855_100054809 | 3300005563 | Bacteria | 4686 |
| 83 | Ga0068855_100078450 | 3300005563 | Bacteria | 3831 |
| 84 | Ga0068855_100125421 | 3300005563 | Bacteria | 2936 |
| 85 | Ga0068855_100185561 | 3300005563 | Bacteria | 2349 |
| 86 | Ga0068855_100223948 | 3300005563 | Bacteria | 2108 |
| 87 | Ga0068855_100256143 | 3300005563 | Bacteria | 1951 |
| 88 | Ga0068855_100399559 | 3300005563 | Bacteria | 1506 |
| 89 | Ga0068855_100665896 | 3300005563 | Bacteria | 1117 |
| 90 | Ga0068855_100795890 | 3300005563 | Bacteria | 1005 |
| 91 | Ga0070664_100159379 | 3300005564 | Bacteria | 1996 |
| 92 | Ga0070664_100195127 | 3300005564 | Unclassified | 1805 |
| 93 | Ga0070664_100347654 | 3300005564 | Bacteria | 1348 |
| 94 | Ga0068857_100002278 | 3300005577 | Bacteria | 15603 |
| 95 | Ga0068857_100502601 | 3300005577 | Bacteria | 1138 |
| 96 | Ga0068857_101164580 | 3300005577 | Unclassified | 746 |
| 97 | Ga0068854_100000129 | 3300005578 | Bacteria | 52076 |
| 98 | Ga0068856_100001516 | 3300005614 | Bacteria | 24367 |
| 99 | Ga0068856_100028230 | 3300005614 | Bacteria | 5478 |
| 100 | Ga0068856_100050129 | 3300005614 | Bacteria | 4115 |
| 101 | Ga0068856_100057591 | 3300005614 | Bacteria | 3837 |
| 102 | Ga0068856_100129987 | 3300005614 | Bacteria | 2523 |
| 103 | Ga0068856_100902062 | 3300005614 | Bacteria | 903 |
| 104 | Ga0070702_100512888 | 3300005615 | Bacteria | 883 |
| 105 | Ga0068852_100002225 | 3300005616 | Bacteria | 13305 |
| 106 | Ga0068852_100160780 | 3300005616 | Bacteria | 2097 |
| 107 | Ga0068852_100885137 | 3300005616 | Bacteria | 909 |
| 108 | Ga0068852_101040222 | 3300005616 | Bacteria | 838 |
| 109 | Ga0068852_101099263 | 3300005616 | Bacteria | 815 |
| 110 | Ga0068859_100093590 | 3300005617 | Bacteria | 3057 |
| 111 | Ga0068859_100224671 | 3300005617 | Bacteria | 1966 |
| 112 | Ga0068859_100254633 | 3300005617 | Bacteria | 1846 |
| 113 | Ga0068859_100349276 | 3300005617 | Bacteria | 1574 |
| 114 | Ga0068859_100705441 | 3300005617 | Bacteria | 1100 |
| 115 | Ga0068864_100019848 | 3300005618 | Bacteria | 5620 |
| 116 | Ga0068864_100482762 | 3300005618 | Bacteria | 1190 |
| 117 | Ga0068864_101176682 | 3300005618 | Bacteria | 765 |
| 118 | Ga0068863_100006748 | 3300005841 | Bacteria | 11251 |
| 119 | Ga0068863_100047401 | 3300005841 | Bacteria | 4076 |
| 120 | Ga0068863_100403112 | 3300005841 | Bacteria | 1338 |
| 121 | Ga0068863_101282984 | 3300005841 | Unclassified | 739 |
| 122 | Ga0068858_100039179 | 3300005842 | Bacteria | 4395 |
| 123 | Ga0068858_100058294 | 3300005842 | Bacteria | 3570 |
| 124 | Ga0068858_100514573 | 3300005842 | Unclassified | 1157 |
| 125 | Ga0068858_101238021 | 3300005842 | Bacteria | 734 |
| 126 | Ga0068860_101049113 | 3300005843 | Bacteria | 834 |
| 127 | Ga0068860_101220584 | 3300005843 | Bacteria | 772 |
| 128 | Ga0081540_1141879 | 3300005983 | Bacteria | 962 |
| 129 | Ga0070717_10064577 | 3300006028 | Bacteria | 3040 |
| 130 | Ga0070717_10666067 | 3300006028 | Bacteria | 945 |
| 131 | Ga0070712_100563424 | 3300006175 | Bacteria | 961 |
| 132 | Ga0070712_100636746 | 3300006175 | Bacteria | 905 |
| 133 | Ga0097621_100032311 | 3300006237 | Bacteria | 4159 |
| 134 | Ga0097621_100151535 | 3300006237 | Bacteria | 1989 |
| 135 | Ga0097621_100449231 | 3300006237 | Bacteria | 1161 |
| 136 | Ga0097621_100539288 | 3300006237 | Bacteria | 1061 |
| 137 | Ga0097621_100749838 | 3300006237 | Bacteria | 902 |
| 138 | Ga0068871_100353158 | 3300006358 | Bacteria | 1301 |
| 139 | Ga0068871_100404852 | 3300006358 | Bacteria | 1216 |
| 140 | Ga0068871_100551843 | 3300006358 | Bacteria | 1044 |
| 141 | Ga0068871_101351619 | 3300006358 | Bacteria | 671 |
| 142 | Ga0075428_100544883 | 3300006844 | Unclassified | 1240 |
| 143 | Ga0075428_100744378 | 3300006844 | Bacteria | 1043 |
| 144 | Ga0075429_100145959 | 3300006880 | Bacteria | 2071 |
| 145 | Ga0068865_100069588 | 3300006881 | Bacteria | 2490 |
| 146 | Ga0068865_100167555 | 3300006881 | Bacteria | 1681 |
| 147 | Ga0075436_100012886 | 3300006914 | Bacteria | 5733 |
| 148 | Ga0075436_100022470 | 3300006914 | Bacteria | 4332 |
| 149 | Ga0075436_100193223 | 3300006914 | Bacteria | 1440 |
| 150 | Ga0097620_100093588 | 3300006931 | Bacteria | 3057 |
| 151 | Ga0097620_100224674 | 3300006931 | Bacteria | 1966 |
| 152 | Ga0097620_100254631 | 3300006931 | Bacteria | 1846 |
| 153 | Ga0097620_100349232 | 3300006931 | Bacteria | 1574 |
| 154 | Ga0097620_100705451 | 3300006931 | Bacteria | 1100 |
| 155 | Ga0105240_10000001 | 3300009093 | Bacteria | 2887840 |
| 156 | Ga0105240_10000202 | 3300009093 | Bacteria | 121046 |
| 157 | Ga0105240_10001456 | 3300009093 | Bacteria | 40471 |
| 158 | Ga0105240_10001466 | 3300009093 | Bacteria | 40332 |
| 159 | Ga0105240_10003229 | 3300009093 | Bacteria | 25527 |
| 160 | Ga0105240_10003634 | 3300009093 | Bacteria | 23891 |
| 161 | Ga0105240_10033834 | 3300009093 | Bacteria | 6599 |
| 162 | Ga0105240_10045233 | 3300009093 | Bacteria | 5586 |
| 163 | Ga0105240_10060633 | 3300009093 | Bacteria | 4716 |
| 164 | Ga0105240_10091023 | 3300009093 | Bacteria | 3727 |
| 165 | Ga0105240_10153005 | 3300009093 | Bacteria | 2746 |
| 166 | Ga0105240_10299723 | 3300009093 | Bacteria | 1839 |
| 167 | Ga0105240_10300226 | 3300009093 | Unclassified | 1837 |
| 168 | Ga0105240_10730300 | 3300009093 | Bacteria | 1078 |
| 169 | Ga0105240_10797941 | 3300009093 | Bacteria | 1023 |
| 170 | Ga0105240_11277877 | 3300009093 | Bacteria | 775 |
| 171 | Ga0105245_10035817 | 3300009098 | Bacteria | 4406 |
| 172 | Ga0105245_10133758 | 3300009098 | Bacteria | 2328 |
| 173 | Ga0105245_10152130 | 3300009098 | Bacteria | 2189 |
| 174 | Ga0105245_10607858 | 3300009098 | Unclassified | 1120 |
| 175 | Ga0105247_10632894 | 3300009101 | Bacteria | 797 |
| 176 | Ga0114129_10688031 | 3300009147 | Bacteria | 1316 |
| 177 | Ga0105243_10151796 | 3300009148 | Bacteria | 1988 |
| 178 | Ga0105243_11229649 | 3300009148 | Bacteria | 763 |
| 179 | Ga0105241_10004691 | 3300009174 | Bacteria | 10092 |
| 180 | Ga0105241_10085959 | 3300009174 | Bacteria | 2473 |
| 181 | Ga0105241_10932599 | 3300009174 | Bacteria | 808 |
| 182 | Ga0105242_10294345 | 3300009176 | Bacteria | 1479 |
| 183 | Ga0105242_10523237 | 3300009176 | Bacteria | 1132 |
| 184 | Ga0105242_10588675 | 3300009176 | Bacteria | 1073 |
| 185 | Ga0105248_10023774 | 3300009177 | Bacteria | 6810 |
| 186 | Ga0105248_10047585 | 3300009177 | Bacteria | 4810 |
| 187 | Ga0105248_10209075 | 3300009177 | Bacteria | 2198 |
| 188 | Ga0105248_10344935 | 3300009177 | Bacteria | 1677 |
| 189 | Ga0105248_10381993 | 3300009177 | Bacteria | 1586 |
| 190 | Ga0105237_10062276 | 3300009545 | Bacteria | 3730 |
| 191 | Ga0105237_10265226 | 3300009545 | Bacteria | 1720 |
| 192 | Ga0105237_11069243 | 3300009545 | Bacteria | 814 |
| 193 | Ga0105237_11086574 | 3300009545 | Bacteria | 807 |
| 194 | Ga0105237_11171410 | 3300009545 | Bacteria | 775 |
| 195 | Ga0105238_10001077 | 3300009551 | Bacteria | 27578 |
| 196 | Ga0105238_10022724 | 3300009551 | Bacteria | 6391 |
| 197 | Ga0105238_10030128 | 3300009551 | Bacteria | 5522 |
| 198 | Ga0105238_10039587 | 3300009551 | Bacteria | 4780 |
| 199 | Ga0105238_10054576 | 3300009551 | Bacteria | 4012 |
| 200 | Ga0105238_10106338 | 3300009551 | Bacteria | 2788 |
| 201 | Ga0105238_10146453 | 3300009551 | Bacteria | 2338 |
| 202 | Ga0105238_10447302 | 3300009551 | Bacteria | 1289 |
| 203 | Ga0105238_10839624 | 3300009551 | Bacteria | 935 |
| 204 | Ga0105249_10847414 | 3300009553 | Bacteria | 980 |
| 205 | Ga0105239_10006418 | 3300010375 | Bacteria | 13650 |
| 206 | Ga0105239_10034686 | 3300010375 | Bacteria | 5542 |
| 207 | Ga0105239_10050366 | 3300010375 | Bacteria | 4568 |
| 208 | Ga0105239_10075890 | 3300010375 | Bacteria | 3696 |
| 209 | Ga0105239_10998064 | 3300010375 | Bacteria | 962 |
| 210 | Ga0157373_10061222 | 3300013100 | Bacteria | 2666 |
| 211 | Ga0157371_10060357 | 3300013102 | Bacteria | 2689 |
| 212 | Ga0157371_10544180 | 3300013102 | Unclassified | 860 |
| 213 | Ga0157370_10002989 | 3300013104 | Bacteria | 20098 |
| 214 | Ga0157370_10003670 | 3300013104 | Bacteria | 17924 |
| 215 | Ga0157370_10004975 | 3300013104 | Bacteria | 15044 |
| 216 | Ga0157370_10005288 | 3300013104 | Bacteria | 14503 |
| 217 | Ga0157370_10012130 | 3300013104 | Bacteria | 8964 |
| 218 | Ga0157370_10014494 | 3300013104 | Bacteria | 8058 |
| 219 | Ga0157370_10213363 | 3300013104 | Bacteria | 1789 |
| 220 | Ga0157370_10233827 | 3300013104 | Bacteria | 1701 |
| 221 | Ga0157370_10326086 | 3300013104 | Bacteria | 1416 |
| 222 | Ga0157370_10365503 | 3300013104 | Bacteria | 1330 |
| 223 | Ga0157370_10407921 | 3300013104 | Bacteria | 1250 |
| 224 | Ga0157370_10641143 | 3300013104 | Bacteria | 971 |
| 225 | Ga0157369_10003568 | 3300013105 | Bacteria | 18484 |
| 226 | Ga0157369_10024819 | 3300013105 | Bacteria | 6660 |
| 227 | Ga0157369_10045430 | 3300013105 | Bacteria | 4777 |
| 228 | Ga0157369_10045825 | 3300013105 | Bacteria | 4754 |
| 229 | Ga0157369_10123957 | 3300013105 | Bacteria | 2741 |
| 230 | Ga0157369_10402438 | 3300013105 | Bacteria | 1420 |
| 231 | Ga0157369_10469865 | 3300013105 | Bacteria | 1302 |
| 232 | Ga0157369_10511240 | 3300013105 | Bacteria | 1243 |
| 233 | Ga0157369_11038839 | 3300013105 | Bacteria | 838 |
| 234 | Ga0157369_11070589 | 3300013105 | Bacteria | 824 |
| 235 | Ga0157374_10012560 | 3300013296 | Bacteria | 7370 |
| 236 | Ga0157374_10027356 | 3300013296 | Bacteria | 5143 |
| 237 | Ga0157374_10037335 | 3300013296 | Bacteria | 4459 |
| 238 | Ga0157374_10043075 | 3300013296 | Bacteria | 4167 |
| 239 | Ga0157374_10362595 | 3300013296 | Bacteria | 1441 |
| 240 | Ga0157374_10931736 | 3300013296 | Bacteria | 887 |
| 241 | Ga0157378_10056049 | 3300013297 | Bacteria | 3511 |
| 242 | Ga0157378_10798524 | 3300013297 | Bacteria | 969 |
| 243 | Ga0157378_11764960 | 3300013297 | Bacteria | 666 |
| 244 | Ga0163162_10006711 | 3300013306 | Bacteria | 11158 |
| 245 | Ga0163162_10162833 | 3300013306 | Bacteria | 2353 |
| 246 | Ga0163162_10598451 | 3300013306 | Bacteria | 1229 |
| 247 | Ga0163162_10725929 | 3300013306 | Bacteria | 1114 |
| 248 | Ga0163162_10740275 | 3300013306 | Bacteria | 1103 |
| 249 | Ga0157372_10005248 | 3300013307 | Bacteria | 13762 |
| 250 | Ga0157372_10031848 | 3300013307 | Bacteria | 5778 |
| 251 | Ga0157372_10053364 | 3300013307 | Bacteria | 4506 |
| 252 | Ga0157372_10069139 | 3300013307 | Bacteria | 3972 |
| 253 | Ga0157372_10192784 | 3300013307 | Bacteria | 2360 |
| 254 | Ga0157372_10204851 | 3300013307 | Bacteria | 2286 |
| 255 | Ga0157372_10320841 | 3300013307 | Bacteria | 1804 |
| 256 | Ga0157372_10488364 | 3300013307 | Bacteria | 1436 |
| 257 | Ga0157372_10606170 | 3300013307 | Unclassified | 1276 |
| 258 | Ga0157375_10129517 | 3300013308 | Bacteria | 2641 |
| 259 | Ga0157375_10630202 | 3300013308 | Bacteria | 1230 |
| 260 | Ga0157375_10754248 | 3300013308 | Bacteria | 1124 |
| 261 | Ga0157375_10896473 | 3300013308 | Bacteria | 1031 |
| 262 | Ga0157375_11403802 | 3300013308 | Bacteria | 823 |
| 263 | Ga0157375_12132339 | 3300013308 | Unclassified | 667 |
| 264 | Ga0163163_10046741 | 3300014325 | Bacteria | 4252 |
| 265 | Ga0163163_10181596 | 3300014325 | Bacteria | 2151 |
| 266 | Ga0163163_10198281 | 3300014325 | Bacteria | 2056 |
| 267 | Ga0163163_10363906 | 3300014325 | Unclassified | 1503 |
| 268 | Ga0163163_10681478 | 3300014325 | Bacteria | 1091 |
| 269 | Ga0163163_10792795 | 3300014325 | Unclassified | 1011 |
| 270 | Ga0157380_10869106 | 3300014326 | Bacteria | 925 |
| 271 | Ga0157377_10056138 | 3300014745 | Bacteria | 2235 |
| 272 | Ga0157377_10430056 | 3300014745 | Bacteria | 906 |
| 273 | Ga0157379_10019282 | 3300014968 | Bacteria | 6023 |
| 274 | Ga0157379_10156477 | 3300014968 | Bacteria | 2056 |
| 275 | Ga0157379_10162722 | 3300014968 | Bacteria | 2014 |
| 276 | Ga0157379_10322252 | 3300014968 | Bacteria | 1411 |
| 277 | Ga0157379_10904693 | 3300014968 | Bacteria | 837 |
| 278 | Ga0157376_10009804 | 3300014969 | Bacteria | 6981 |
| 279 | Ga0157376_10017134 | 3300014969 | Bacteria | 5519 |
| 280 | Ga0157376_10048023 | 3300014969 | Bacteria | 3527 |
| 281 | Ga0157376_10155870 | 3300014969 | Bacteria | 2065 |
| 282 | Ga0157376_10248908 | 3300014969 | Bacteria | 1659 |
| 283 | Ga0157376_10694341 | 3300014969 | Bacteria | 1022 |
| 284 | Ga0157376_11314253 | 3300014969 | Bacteria | 753 |
| 285 | Ga0157376_11758705 | 3300014969 | Bacteria | 656 |
| 286 | Ga0163161_10193680 | 3300017792 | Bacteria | 1564 |
| 287 | Ga0213873_10034584 | 3300021358 | Bacteria | 1274 |
| 288 | Ga0213874_10040201 | 3300021377 | Bacteria | 1395 |
| 289 | Ga0213876_10009021 | 3300021384 | Bacteria | 5373 |
| 290 | Ga0213876_10127561 | 3300021384 | Bacteria | 1351 |
| 291 | Ga0213876_10146786 | 3300021384 | Bacteria | 1254 |
| 292 | Ga0213875_10003299 | 3300021388 | Bacteria | 9227 |
| 293 | Ga0213875_10025228 | 3300021388 | Bacteria | 2833 |
| 294 | Ga0213875_10093524 | 3300021388 | Bacteria | 1402 |
| 295 | Ga0213875_10223391 | 3300021388 | Bacteria | 887 |
| 296 | Ga0213875_10377130 | 3300021388 | Bacteria | 675 |
| 297 | Ga0207692_10326202 | 3300025898 | Bacteria | 941 |
| 298 | Ga0207680_10254469 | 3300025903 | Bacteria | 1214 |
| 299 | Ga0207647_10006083 | 3300025904 | Bacteria | 8794 |
| 300 | Ga0207647_10248006 | 3300025904 | Bacteria | 1022 |
| 301 | Ga0207699_10057421 | 3300025906 | Bacteria | 2324 |
| 302 | Ga0207705_10041534 | 3300025909 | Bacteria | 3300 |
| 303 | Ga0207705_10083813 | 3300025909 | Bacteria | 2326 |
| 304 | Ga0207705_10265714 | 3300025909 | Bacteria | 1311 |
| 305 | Ga0207705_10476271 | 3300025909 | Bacteria | 969 |
| 306 | Ga0207684_10433823 | 3300025910 | Bacteria | 1129 |
| 307 | Ga0207684_10531568 | 3300025910 | Unclassified | 1007 |
| 308 | Ga0207707_10163031 | 3300025912 | Bacteria | 1949 |
| 309 | Ga0207707_10202741 | 3300025912 | Bacteria | 1729 |
| 310 | Ga0207707_10328821 | 3300025912 | Bacteria | 1319 |
| 311 | Ga0207695_10000001 | 3300025913 | Bacteria | 2888630 |
| 312 | Ga0207695_10001149 | 3300025913 | Bacteria | 45947 |
| 313 | Ga0207695_10003468 | 3300025913 | Bacteria | 22191 |
| 314 | Ga0207695_10007220 | 3300025913 | Bacteria | 14201 |
| 315 | Ga0207695_10023536 | 3300025913 | Bacteria | 6956 |
| 316 | Ga0207695_10025828 | 3300025913 | Bacteria | 6566 |
| 317 | Ga0207695_10036014 | 3300025913 | Bacteria | 5355 |
| 318 | Ga0207695_10290848 | 3300025913 | Bacteria | 1526 |
| 319 | Ga0207695_10717304 | 3300025913 | Bacteria | 880 |
| 320 | Ga0207671_10005666 | 3300025914 | Bacteria | 11422 |
| 321 | Ga0207671_10166701 | 3300025914 | Bacteria | 1708 |
| 322 | Ga0207671_10642327 | 3300025914 | Bacteria | 845 |
| 323 | Ga0207660_10005477 | 3300025917 | Bacteria | 8245 |
| 324 | Ga0207660_10057471 | 3300025917 | Bacteria | 2786 |
| 325 | Ga0207657_10001379 | 3300025919 | Bacteria | 25926 |
| 326 | Ga0207657_10103554 | 3300025919 | Bacteria | 2359 |
| 327 | Ga0207657_10180884 | 3300025919 | Bacteria | 1704 |
| 328 | Ga0207649_10197204 | 3300025920 | Bacteria | 1419 |
| 329 | Ga0207652_10006036 | 3300025921 | Bacteria | 9808 |
| 330 | Ga0207652_10318294 | 3300025921 | Unclassified | 1405 |
| 331 | Ga0207652_10734571 | 3300025921 | Bacteria | 879 |
| 332 | Ga0207652_10792666 | 3300025921 | Bacteria | 842 |
| 333 | Ga0207694_10101326 | 3300025924 | Bacteria | 2282 |
| 334 | Ga0207694_10140283 | 3300025924 | Bacteria | 1943 |
| 335 | Ga0207659_10707032 | 3300025926 | Bacteria | 863 |
| 336 | Ga0207687_10403665 | 3300025927 | Bacteria | 1124 |
| 337 | Ga0207700_10028747 | 3300025928 | Bacteria | 3914 |
| 338 | Ga0207700_10290002 | 3300025928 | Bacteria | 1410 |
| 339 | Ga0207700_10330262 | 3300025928 | Bacteria | 1323 |
| 340 | Ga0207700_10686052 | 3300025928 | Bacteria | 914 |
| 341 | Ga0207664_10043714 | 3300025929 | Bacteria | 3506 |
| 342 | Ga0207664_10560046 | 3300025929 | Bacteria | 1026 |
| 343 | Ga0207664_10797237 | 3300025929 | Bacteria | 850 |
| 344 | Ga0207644_10043603 | 3300025931 | Bacteria | 3184 |
| 345 | Ga0207644_10293731 | 3300025931 | Bacteria | 1308 |
| 346 | Ga0207690_10001643 | 3300025932 | Bacteria | 13827 |
| 347 | Ga0207670_10287786 | 3300025936 | Bacteria | 1283 |
| 348 | Ga0207711_10052122 | 3300025941 | Bacteria | 3506 |
| 349 | Ga0207711_10235492 | 3300025941 | Bacteria | 1678 |
| 350 | Ga0207711_10259728 | 3300025941 | Bacteria | 1596 |
| 351 | Ga0207661_10120142 | 3300025944 | Bacteria | 2236 |
| 352 | Ga0207661_11138694 | 3300025944 | Unclassified | 718 |
| 353 | Ga0207679_10248143 | 3300025945 | Unclassified | 1512 |
| 354 | Ga0207667_10003594 | 3300025949 | Bacteria | 19145 |
| 355 | Ga0207667_10022346 | 3300025949 | Bacteria | 6990 |
| 356 | Ga0207667_10044399 | 3300025949 | Bacteria | 4710 |
| 357 | Ga0207667_10098682 | 3300025949 | Bacteria | 3014 |
| 358 | Ga0207667_10294111 | 3300025949 | Bacteria | 1659 |
| 359 | Ga0207667_10314432 | 3300025949 | Bacteria | 1600 |
| 360 | Ga0207667_10417980 | 3300025949 | Bacteria | 1364 |
| 361 | Ga0207667_10459381 | 3300025949 | Bacteria | 1293 |
| 362 | Ga0207667_10585464 | 3300025949 | Bacteria | 1126 |
| 363 | Ga0207667_10783660 | 3300025949 | Bacteria | 951 |
| 364 | Ga0207651_10201061 | 3300025960 | Bacteria | 1597 |
| 365 | Ga0207712_10978781 | 3300025961 | Bacteria | 750 |
| 366 | Ga0207640_10000011 | 3300025981 | Bacteria | 252283 |
| 367 | Ga0207640_10527193 | 3300025981 | Bacteria | 988 |
| 368 | Ga0207677_10119513 | 3300026023 | Bacteria | 1979 |
| 369 | Ga0207677_10217928 | 3300026023 | Bacteria | 1529 |
| 370 | Ga0207703_10027419 | 3300026035 | Bacteria | 4487 |
| 371 | Ga0207639_10000025 | 3300026041 | Bacteria | 207451 |
| 372 | Ga0207639_10054061 | 3300026041 | Bacteria | 3067 |
| 373 | Ga0207639_10092952 | 3300026041 | Bacteria | 2418 |
| 374 | Ga0207639_10441626 | 3300026041 | Bacteria | 1180 |
| 375 | Ga0207678_10034832 | 3300026067 | Bacteria | 4384 |
| 376 | Ga0207702_10030483 | 3300026078 | Bacteria | 4495 |
| 377 | Ga0207702_10049086 | 3300026078 | Bacteria | 3561 |
| 378 | Ga0207702_10087384 | 3300026078 | Bacteria | 2722 |
| 379 | Ga0207702_10207777 | 3300026078 | Bacteria | 1819 |
| 380 | Ga0207702_11034393 | 3300026078 | Bacteria | 815 |
| 381 | Ga0207641_10270505 | 3300026088 | Bacteria | 1594 |
| 382 | Ga0207648_11272500 | 3300026089 | Bacteria | 691 |
| 383 | Ga0207676_10010923 | 3300026095 | Bacteria | 6479 |
| 384 | Ga0207674_11119771 | 3300026116 | Bacteria | 757 |
| 385 | Ga0207698_10139613 | 3300026142 | Bacteria | 2085 |
| 386 | Ga0207698_10157970 | 3300026142 | Bacteria | 1979 |
| 387 | Ga0207698_10171080 | 3300026142 | Bacteria | 1913 |
| 388 | Ga0268266_10054155 | 3300028379 | Bacteria | 3447 |
| 389 | Ga0268266_11413851 | 3300028379 | Bacteria | 671 |
| 390 | Ga0268264_10878008 | 3300028381 | Bacteria | 899 |
| 391 | Ga0265323_10001186 | 3300028653 | Bacteria | 13265 |
| 392 | Ga0265338_10098863 | 3300028800 | Bacteria | 2386 |
| 393 | Ga0265338_10194214 | 3300028800 | Bacteria | 1536 |
| 394 | Ga0265332_10244653 | 3300031238 | Bacteria | 742 |
| 395 | Ga0265325_10196818 | 3300031241 | Bacteria | 932 |
| 396 | Ga0265325_10277842 | 3300031241 | Unclassified | 752 |
| 397 | Ga0265339_10034566 | 3300031249 | Bacteria | 2840 |
| 398 | Ga0265331_10024281 | 3300031250 | Bacteria | 3069 |
| 399 | Ga0265331_10116825 | 3300031250 | Bacteria | 1221 |
| 400 | Ga0265316_10295011 | 3300031344 | Bacteria | 1182 |
| 401 | Ga0265316_10311279 | 3300031344 | Bacteria | 1145 |
| 402 | Ga0265314_10026183 | 3300031711 | Bacteria | 4386 |
| 403 | Ga0265342_10021562 | 3300031712 | Bacteria | 4111 |
| 404 | Ga0307518_10100875 | 3300031838 | Bacteria | 2067 |
| 405 | Ga0307409_101465994 | 3300031995 | Bacteria | 709 |
| 406 | Ga0307411_10742165 | 3300032005 | Bacteria | 859 |
| 407 | Ga0307510_10029977 | 3300033180 | Bacteria | 6177 |
| 408 | Ga0373944_0197244 | 3300035089 | Bacteria | 727 |
| 409 | Ga0373954_0042445 | 3300035118 | Bacteria | 2121 |
| 410 | Ga0373943_0018087 | 3300035170 | Bacteria | 3234 |
| 411 | Ga0373946_0014420 | 3300035171 | Bacteria | 2981 |
| 412 | Ga0373924_0150212 | 3300035410 | Bacteria | 1019 |
| 413 | Ga0373935_0851061 | 3300035692 | Bacteria | 674 |
| 414 | Ga0373927_0004398 | 3300035695 | Bacteria | 9877 |
| 415 | Ga0373927_0160841 | 3300035695 | Bacteria | 1471 |
| 416 | Ga0373927_0393175 | 3300035695 | Bacteria | 915 |
| 417 | Ga0373933_0417692 | 3300035724 | Bacteria | 876 |
| 418 | Ga0373933_0717507 | 3300035724 | Bacteria | 658 |
| 419 | Ga0373947_0041913 | 3300035725 | Bacteria | 2732 |
| 420 | Ga0373947_0095549 | 3300035725 | Bacteria | 1860 |
| 421 | Ga0373947_0608256 | 3300035725 | Bacteria | 745 |
| 422 | Ga0373937_0348468 | 3300036401 | Bacteria | 1403 |
| 423 | Ga0373937_0807698 | 3300036401 | Bacteria | 886 |
| 424 | Ga0373937_1060252 | 3300036401 | Bacteria | 759 |
| 425 | Ga0373937_1109377 | 3300036401 | Bacteria | 740 |
| 426 | Ga0373925_0014038 | 3300037068 | Bacteria | 5799 |
| 427 | Ga0373925_0441605 | 3300037068 | Bacteria | 1065 |
| 428 | Ga0373925_0734242 | 3300037068 | Unclassified | 814 |
| 429 | Ga0373925_0746332 | 3300037068 | Bacteria | 807 |
| 430 | Ga0395899_0187046 | 3300037312 | Unclassified | 1451 |
| 431 | Ga0395898_0174168 | 3300037466 | Unclassified | 2057 |
| 432 | Ga0395898_0376561 | 3300037466 | Bacteria | 1354 |
| 433 | Ga0395898_1125444 | 3300037466 | Bacteria | 718 |
| 434 | Ga0395905_0047597 | 3300037471 | Bacteria | 4018 |
| 435 | Ga0395905_0077157 | 3300037471 | Bacteria | 3122 |
| 436 | Ga0436364_0051041 | 3300037853 | Bacteria | 969 |
| 437 | Ga0436364_0103499 | 3300037853 | Bacteria | 3196 |
| 438 | Ga0436364_0235071 | 3300037853 | Bacteria | 15101 |
| 439 | Ga0436364_0309018 | 3300037853 | Bacteria | 153512 |
| 440 | Ga0436364_0461614 | 3300037853 | Bacteria | 3425 |
| 441 | Ga0436364_0720089 | 3300037853 | Bacteria | 3978 |
| 442 | Ga0436364_0808515 | 3300037853 | Bacteria | 27053 |
| 443 | Ga0436364_0851560 | 3300037853 | Bacteria | 1100 |
| 444 | Ga0436364_0869275 | 3300037853 | Bacteria | 2574 |
| 445 | Ga0436364_0876356 | 3300037853 | Bacteria | 6427 |
| 446 | Ga0436364_1024913 | 3300037853 | Bacteria | 1139 |
| 447 | Ga0436364_1424251 | 3300037853 | Bacteria | 2857 |
| 448 | Ga0395901_0371642 | 3300038443 | Bacteria | 1473 |
| 449 | Ga0436365_0073938 | 3300039437 | Bacteria | 2719 |
| 450 | Ga0436365_0110820 | 3300039437 | Unclassified | 1072 |
| 451 | Ga0436365_0165408 | 3300039437 | Bacteria | 30957 |
| 452 | Ga0436365_1077991 | 3300039437 | Bacteria | 2488 |
| 453 | Ga0436365_1344226 | 3300039437 | Bacteria | 801 |
| 454 | Ga0436365_1620961 | 3300039437 | Bacteria | 1822 |
| 455 | Ga0436365_1822297 | 3300039437 | Bacteria | 695 |
| 456 | Ga0436365_1911883 | 3300039437 | Bacteria | 5768 |
| 457 | Ga0436360_0145639 | 3300039438 | Bacteria | 2940 |
| 458 | Ga0436360_0300036 | 3300039438 | Unclassified | 898 |
| 459 | Ga0436361_0986900 | 3300039447 | Bacteria | 1282 |
| 460 | Ga0436361_1094065 | 3300039447 | Bacteria | 1990 |
| 461 | Ga0436363_0614006 | 3300039450 | Unclassified | 1098 |
| 462 | Ga0436363_0818238 | 3300039450 | Unclassified | 790 |
| 463 | Ga0436363_0820413 | 3300039450 | Unclassified | 849 |
| 464 | Ga0436363_0896163 | 3300039450 | Bacteria | 5728 |
| 465 | Ga0436363_1046906 | 3300039450 | Bacteria | 3388 |
| 466 | Ga0436362_0283025 | 3300039453 | Bacteria | 4270 |
| 467 | Ga0436362_0386289 | 3300039453 | Bacteria | 1021 |
| 468 | Ga0436362_0474546 | 3300039453 | Bacteria | 1458 |
| 469 | Ga0466966_0062296 | 3300044684 | Bacteria | 2352 |
| 470 | Ga0466963_0123571 | 3300044694 | Bacteria | 1783 |
| 471 | Ga0466963_0361048 | 3300044694 | Bacteria | 1023 |
| 472 | Ga0466957_0535629 | 3300044842 | Bacteria | 815 |
| 473 | Ga0466959_0293662 | 3300045049 | Bacteria | 1114 |
| 474 | Ga0466959_0537488 | 3300045049 | Unclassified | 789 |
| 475 | Ga0451576_0083747 | 3300045051 | Bacteria | 3317 |
| 476 | Ga0451576_0400612 | 3300045051 | Bacteria | 1439 |
| 477 | Ga0451576_1108959 | 3300045051 | Bacteria | 828 |
| 478 | Ga0466967_0173989 | 3300045976 | Bacteria | 2027 |
| 479 | Ga0466967_0322831 | 3300045976 | Bacteria | 1489 |
| 480 | Ga0495592_0073303 | 3300046454 | Bacteria | 2490 |
| 481 | Ga0495592_0387775 | 3300046454 | Bacteria | 887 |
| 482 | Ga0495603_0001767 | 3300046455 | Bacteria | 12736 |
| 483 | Ga0495603_0013033 | 3300046455 | Bacteria | 5026 |
| 484 | Ga0495603_0019518 | 3300046455 | Bacteria | 4103 |
| 485 | Ga0495629_0005634 | 3300046459 | Bacteria | 9354 |
| 486 | Ga0495629_0013549 | 3300046459 | Bacteria | 5882 |
| 487 | Ga0495651_0007913 | 3300046462 | Bacteria | 8143 |
| 488 | Ga0495651_0011853 | 3300046462 | Bacteria | 6704 |
| 489 | Ga0495651_0113300 | 3300046462 | Bacteria | 2002 |
| 490 | Ga0495651_0126402 | 3300046462 | Bacteria | 1872 |
| 491 | Ga0495651_0286765 | 3300046462 | Bacteria | 1110 |
| 492 | Ga0495653_0020438 | 3300046463 | Bacteria | 5368 |
| 493 | Ga0495653_0101347 | 3300046463 | Bacteria | 2086 |
| 494 | Ga0495650_0000022 | 3300046471 | Bacteria | 530747 |
| 495 | Ga0495580_0035996 | 3300046472 | Bacteria | 3557 |
| 496 | Ga0495580_0065684 | 3300046472 | Bacteria | 2541 |
| 497 | Ga0495580_0068384 | 3300046472 | Bacteria | 2484 |
| 498 | Ga0495580_0170964 | 3300046472 | Bacteria | 1503 |
| 499 | Ga0495580_0399955 | 3300046472 | Bacteria | 926 |
| 500 | Ga0495580_0534176 | 3300046472 | Bacteria | 780 |
| 501 | Ga0495582_0002862 | 3300046473 | Bacteria | 9656 |
| 502 | Ga0495639_0004884 | 3300046475 | Bacteria | 5751 |
| 503 | Ga0495662_0005537 | 3300046476 | Bacteria | 6314 |
| 504 | Ga0495662_0093504 | 3300046476 | Bacteria | 1467 |
| 505 | Ga0495664_0001397 | 3300046477 | Bacteria | 12769 |
| 506 | Ga0495664_0004911 | 3300046477 | Bacteria | 7316 |
| 507 | Ga0495664_0184776 | 3300046477 | Bacteria | 1264 |
| 508 | Ga0495584_0113080 | 3300046491 | Bacteria | 1374 |
| 509 | Ga0495585_0027729 | 3300046492 | Bacteria | 3231 |
| 510 | Ga0495594_0000297 | 3300046499 | Bacteria | 24372 |
| 511 | Ga0495594_0001779 | 3300046499 | Bacteria | 11189 |
| 512 | Ga0495594_0002650 | 3300046499 | Bacteria | 9312 |
| 513 | Ga0495594_0056916 | 3300046499 | Bacteria | 2159 |
| 514 | Ga0495583_0017996 | 3300046506 | Bacteria | 3735 |
| 515 | Ga0495606_0048364 | 3300046507 | Bacteria | 2798 |
| 516 | Ga0495606_0154904 | 3300046507 | Bacteria | 1342 |
| 517 | Ga0495608_0088622 | 3300046511 | Bacteria | 2003 |
| 518 | Ga0495616_0128829 | 3300046513 | Bacteria | 1161 |
| 519 | Ga0495618_0077791 | 3300046514 | Bacteria | 2114 |
| 520 | Ga0495628_0010170 | 3300046516 | Bacteria | 8002 |
| 521 | Ga0495628_0038349 | 3300046516 | Bacteria | 3835 |
| 522 | Ga0495630_0025955 | 3300046517 | Bacteria | 4336 |
| 523 | Ga0495630_0101494 | 3300046517 | Bacteria | 2176 |
| 524 | Ga0495630_0594047 | 3300046517 | Bacteria | 849 |
| 525 | Ga0495631_0177317 | 3300046518 | Unclassified | 913 |
| 526 | Ga0495644_0000092 | 3300046523 | Bacteria | 44328 |
| 527 | Ga0495663_0186888 | 3300046525 | Bacteria | 719 |
| 528 | Ga0495666_0000902 | 3300046526 | Bacteria | 13936 |
| 529 | Ga0495642_0258581 | 3300046528 | Bacteria | 761 |
| 530 | Ga0495652_0021122 | 3300046529 | Bacteria | 5787 |
| 531 | Ga0495652_0050053 | 3300046529 | Bacteria | 3574 |
| 532 | Ga0495652_0075456 | 3300046529 | Bacteria | 2800 |
| 533 | Ga0495665_0000995 | 3300046531 | Bacteria | 15038 |
| 534 | Ga0495640_0029687 | 3300046533 | Bacteria | 3922 |
| 535 | Ga0495640_0100482 | 3300046533 | Bacteria | 1899 |
| 536 | Ga0495586_0002103 | 3300046535 | Bacteria | 10826 |
| 537 | Ga0495586_0519907 | 3300046535 | Bacteria | 687 |
| 538 | Ga0495587_0007381 | 3300046536 | Bacteria | 7124 |
| 539 | Ga0495587_0039275 | 3300046536 | Bacteria | 2834 |
| 540 | Ga0495609_0012713 | 3300046538 | Bacteria | 3990 |
| 541 | Ga0495609_0017279 | 3300046538 | Bacteria | 3350 |
| 542 | Ga0495645_0006956 | 3300046543 | Bacteria | 7861 |
| 543 | Ga0495645_0008197 | 3300046543 | Bacteria | 7288 |
| 544 | Ga0495645_0030352 | 3300046543 | Bacteria | 3936 |
| 545 | Ga0495645_0158275 | 3300046543 | Bacteria | 1568 |
| 546 | Ga0495622_0040447 | 3300046557 | Bacteria | 2170 |
| 547 | Ga0495667_0039806 | 3300046559 | Bacteria | 3123 |
| 548 | Ga0495667_0381604 | 3300046559 | Bacteria | 889 |
| 549 | Ga0495656_0052314 | 3300046615 | Bacteria | 1751 |
| 550 | Ga0495668_0034923 | 3300046616 | Bacteria | 2819 |
| 551 | Ga0495668_0295206 | 3300046616 | Bacteria | 888 |
| 552 | Ga0495634_0001577 | 3300046642 | Bacteria | 20063 |
| 553 | Ga0495634_0658993 | 3300046642 | Bacteria | 604 |
| 554 | Ga0495611_0004376 | 3300046648 | Bacteria | 6119 |
| 555 | Ga0495625_0013471 | 3300046660 | Bacteria | 6570 |
| 556 | Ga0495625_0071321 | 3300046660 | Bacteria | 2438 |
| 557 | Ga0495635_0038522 | 3300046663 | Bacteria | 3309 |
| 558 | Ga0495635_0284303 | 3300046663 | Bacteria | 1111 |
| 559 | Ga0495661_0035936 | 3300046665 | Bacteria | 3106 |
| 560 | Ga0495588_0053920 | 3300046674 | Bacteria | 2074 |
| 561 | Ga0495599_0009354 | 3300046678 | Bacteria | 5986 |
| 562 | Ga0495599_0009921 | 3300046678 | Bacteria | 5828 |
| 563 | Ga0495623_0018407 | 3300046679 | Bacteria | 4512 |
| 564 | Ga0495623_0031310 | 3300046679 | Bacteria | 3420 |
| 565 | Ga0495623_0245996 | 3300046679 | Bacteria | 1008 |
| 566 | Ga0495646_0008599 | 3300046680 | Bacteria | 6485 |
| 567 | Ga0495646_0040607 | 3300046680 | Bacteria | 2864 |
| 568 | Ga0495669_0003958 | 3300046684 | Bacteria | 6096 |
| 569 | Ga0495613_0000761 | 3300046689 | Bacteria | 25225 |
| 570 | Ga0495613_0032323 | 3300046689 | Bacteria | 3886 |
| 571 | Ga0495613_0061755 | 3300046689 | Bacteria | 2743 |
| 572 | Ga0495624_0014348 | 3300046690 | Bacteria | 5380 |
| 573 | Ga0495624_0151191 | 3300046690 | Bacteria | 1420 |
| 574 | Ga0495670_0045419 | 3300046691 | Bacteria | 2193 |
| 575 | Ga0495649_0138288 | 3300046694 | Bacteria | 1283 |
| 576 | Ga0495600_0000609 | 3300046809 | Bacteria | 18474 |
| 577 | Ga0495600_0123019 | 3300046809 | Bacteria | 1687 |
| 578 | Ga0495600_0150287 | 3300046809 | Bacteria | 1508 |
| 579 | Ga0495581_0002974 | 3300047315 | Bacteria | 9703 |
| 580 | Ga0495581_0082824 | 3300047315 | Bacteria | 1858 |
| 581 | Ga0495581_0085239 | 3300047315 | Bacteria | 1831 |
| 582 | Ga0495604_0017533 | 3300047317 | Bacteria | 5734 |
| 583 | Ga0495604_0187325 | 3300047317 | Bacteria | 1444 |
| 584 | Ga0495636_0041817 | 3300047318 | Bacteria | 1903 |
| 585 | Ga0495636_0354616 | 3300047318 | Bacteria | 693 |
| 586 | Ga0495674_0009515 | 3300047319 | Bacteria | 9232 |
| 587 | Ga0495674_0034853 | 3300047319 | Bacteria | 4547 |
| 588 | Ga0495674_0078289 | 3300047319 | Bacteria | 2840 |
| 589 | Ga0495674_0121538 | 3300047319 | Bacteria | 2206 |
| 590 | Ga0495674_0127098 | 3300047319 | Bacteria | 2150 |
| 591 | Ga0495674_0346563 | 3300047319 | Bacteria | 1206 |
| 592 | Ga0495676_0001068 | 3300047321 | Bacteria | 23231 |
| 593 | Ga0495680_0312991 | 3300047322 | Bacteria | 1100 |
| 594 | Ga0495680_0511824 | 3300047322 | Bacteria | 813 |
| 595 | Ga0495675_0000836 | 3300047444 | Bacteria | 18808 |
| 596 | Ga0495675_0037454 | 3300047444 | Bacteria | 3089 |
| 597 | Ga0495675_0270133 | 3300047444 | Bacteria | 1016 |
| 598 | Ga0495673_0040361 | 3300047469 | Bacteria | 2109 |
| 599 | Ga0495684_0052075 | 3300047471 | Bacteria | 3123 |
| 600 | Ga0495684_0129281 | 3300047471 | Bacteria | 1898 |
| 601 | Ga0495684_0129292 | 3300047471 | Bacteria | 1898 |
| 602 | Ga0495684_0231346 | 3300047471 | Bacteria | 1352 |
| 603 | Ga0495686_0003025 | 3300047472 | Bacteria | 14929 |
| 604 | Ga0495686_0003149 | 3300047472 | Bacteria | 14557 |
| 605 | Ga0495686_0354508 | 3300047472 | Bacteria | 797 |
| 606 | Ga0495602_0265235 | 3300048088 | Bacteria | 1272 |
| 607 | Ga0495614_0006733 | 3300048089 | Bacteria | 5143 |
| 608 | Ga0495614_0060219 | 3300048089 | Bacteria | 1631 |
| 609 | Ga0496104_0258266 | 3300048907 | Bacteria | 1655 |
| 610 | Ga0496105_0414509 | 3300048908 | Bacteria | 1067 |
| 611 | Ga0496108_0439946 | 3300048911 | Bacteria | 1139 |
| 612 | Ga0496112_1360524 | 3300048915 | Bacteria | 625 |
| 613 | Ga0496113_0072700 | 3300048916 | Bacteria | 2618 |
| 614 | Ga0496114_0698019 | 3300048917 | Bacteria | 890 |
| 615 | Ga0496115_0047237 | 3300048918 | Bacteria | 3442 |
| 616 | Ga0496126_0000231 | 3300048929 | Bacteria | 120254 |
| 617 | Ga0496126_0006179 | 3300048929 | Bacteria | 13408 |
| 618 | Ga0495682_0119058 | 3300049460 | Bacteria | 946 |
| 619 | Ga0501297_013572 | 3300049520 | Bacteria | 957 |
| 620 | Ga0501299_031817 | 3300049522 | Bacteria | 1022 |
| 621 | Ga0501031_0007915 | 3300049568 | Bacteria | 6918 |
| 622 | Ga0501032_0062044 | 3300049569 | Bacteria | 2505 |
| 623 | Ga0501032_0594142 | 3300049569 | Unclassified | 704 |
| 624 | Ga0501033_0111213 | 3300049570 | Bacteria | 1993 |
| 625 | Ga0501033_0172446 | 3300049570 | Bacteria | 1553 |
| 626 | Ga0501034_0035637 | 3300049571 | Bacteria | 5043 |
| 627 | Ga0501036_0015802 | 3300049572 | Bacteria | 6305 |
| 628 | Ga0501037_0001492 | 3300049573 | Bacteria | 17101 |
| 629 | Ga0501037_0169814 | 3300049573 | Bacteria | 1551 |
| 630 | Ga0501038_0003506 | 3300049574 | Bacteria | 14603 |
| 631 | Ga0501038_0203625 | 3300049574 | Bacteria | 1587 |
| 632 | Ga0501039_0020927 | 3300049575 | Bacteria | 5016 |
| 633 | Ga0501043_0003763 | 3300049579 | Bacteria | 12473 |
| 634 | Ga0501046_0024228 | 3300049580 | Bacteria | 4982 |
| 635 | Ga0501047_0014625 | 3300049581 | Bacteria | 7467 |
| 636 | Ga0501047_0098157 | 3300049581 | Bacteria | 2808 |
| 637 | Ga0501047_0104789 | 3300049581 | Bacteria | 2708 |
| 638 | Ga0501047_0166193 | 3300049581 | Bacteria | 2077 |
| 639 | Ga0501048_0025324 | 3300049582 | Bacteria | 4324 |
| 640 | Ga0501048_0354577 | 3300049582 | Unclassified | 1046 |
| 641 | Ga0501067_0018174 | 3300049583 | Bacteria | 3893 |
| 642 | Ga0501068_0001328 | 3300049584 | Bacteria | 13111 |
| 643 | Ga0501068_0680203 | 3300049584 | Unclassified | 672 |
| 644 | Ga0501069_0002181 | 3300049585 | Bacteria | 9856 |
| 645 | Ga0501070_0035051 | 3300049586 | Bacteria | 4194 |
| 646 | Ga0501070_0119715 | 3300049586 | Bacteria | 2176 |
| 647 | Ga0501070_0199021 | 3300049586 | Bacteria | 1645 |
| 648 | Ga0501072_0000523 | 3300049588 | Bacteria | 27564 |
| 649 | Ga0501073_0000999 | 3300049589 | Bacteria | 20422 |
| 650 | Ga0501073_0032062 | 3300049589 | Bacteria | 3748 |
| 651 | Ga0501073_0103008 | 3300049589 | Bacteria | 1982 |
| 652 | Ga0501073_0714255 | 3300049589 | Unclassified | 691 |
| 653 | Ga0501074_0006388 | 3300049590 | Bacteria | 8509 |
| 654 | Ga0501077_0013202 | 3300049593 | Bacteria | 5176 |
| 655 | Ga0501079_0000555 | 3300049741 | Bacteria | 24463 |
| 656 | Ga0501080_0112917 | 3300049742 | Bacteria | 2518 |
| 657 | Ga0501083_0023532 | 3300049744 | Bacteria | 4270 |
| 658 | Ga0501265_016162 | 3300049762 | Bacteria | 965 |
| 659 | Ga0501270_025753 | 3300049767 | Bacteria | 934 |
| 660 | Ga0501274_013685 | 3300049771 | Bacteria | 781 |
| 661 | Ga0501035_0010538 | 3300049822 | Bacteria | 8566 |
| 662 | Ga0501035_0037545 | 3300049822 | Bacteria | 4386 |
| 663 | Ga0501044_0020162 | 3300049823 | Bacteria | 7115 |
| 664 | Ga0501044_0141892 | 3300049823 | Bacteria | 2390 |
| 665 | Ga0501044_0144312 | 3300049823 | Bacteria | 2367 |
| 666 | Ga0501044_0159271 | 3300049823 | Bacteria | 2235 |
| 667 | Ga0501045_0073298 | 3300049824 | Bacteria | 2521 |
| 668 | nmdc:mga05p37_589668_c1 | 3300050507 | Bacteria | 1257 |
| 669 | nmdc:mga05p37_963770_c1 | 3300050507 | Bacteria | 911 |
| 670 | nmdc:mga09592_311112_c1 | 3300050508 | Bacteria | 1365 |
| 671 | nmdc:mga0qj67_35717_c1 | 3300050509 | Bacteria | 3887 |
| 672 | nmdc:mga0n895_515833_c1 | 3300050512 | Bacteria | 1203 |
| 673 | nmdc:mga08x19_4575_c1 | 3300050514 | Bacteria | 8211 |
| 674 | Ga0495612_0028781 | 3300053078 | Bacteria | 2238 |
| 675 | Ga0500643_027477 | 3300053087 | Bacteria | 1769 |
| 676 | Ga0500651_0000003 | 3300053093 | Bacteria | 422045 |
| 677 | Ga0500638_171414 | 3300053162 | Bacteria | 945 |
| 678 | Ga0501084_0000282 | 3300054114 | Bacteria | 38465 |
| 679 | Ga0500661_002041 | 3300055283 | Bacteria | 3812 |
| 680 | Ga0501082_0001154 | 3300060353 | Bacteria | 23280 |
| 681 | Ga0501082_0071448 | 3300060353 | Bacteria | 2989 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025912 | Ga0207707_10202741 | Ga0207707_102027413 | 167 |
| 2 | 3300025921 | Ga0207652_10734571 | Ga0207652_107345712 | 182 |
| 3 | 3300025921 | Ga0207652_10792666 | Ga0207652_107926662 | 182 |
| 4 | 3300031712 | Ga0265342_10021562 | Ga0265342_100215625 | 182 |
| 5 | 3300031838 | Ga0307518_10100875 | Ga0307518_101008752 | 182 |
| 6 | 3300037466 | Ga0395898_0376561 | Ga0395898_0376561_598_1170 | 182 |
| 7 | 3300037471 | Ga0395905_0047597 | Ga0395905_0047597_3293_3856 | 182 |
| 8 | 3300037471 | Ga0395905_0077157 | Ga0395905_0077157_959_1522 | 182 |
| 9 | 3300039437 | Ga0436365_0110820 | Ga0436365_0110820_250_816 | 182 |
| 10 | 3300044684 | Ga0466966_0062296 | Ga0466966_0062296_592_1164 | 182 |
| 11 | 3300045049 | Ga0466959_0293662 | Ga0466959_0293662_16_588 | 182 |
| 12 | 3300046615 | Ga0495656_0052314 | Ga0495656_0052314_752_1309 | 182 |
| 13 | 3300005328 | Ga0070676_10174955 | Ga0070676_101749551 | 183 |
| 14 | 3300005329 | Ga0070683_100075606 | Ga0070683_1000756063 | 183 |
| 15 | 3300005329 | Ga0070683_100273040 | Ga0070683_1002730402 | 183 |
| 16 | 3300005329 | Ga0070683_100472851 | Ga0070683_1004728511 | 183 |
| 17 | 3300005329 | Ga0070683_100629711 | Ga0070683_1006297112 | 183 |
| 18 | 3300005330 | Ga0070690_100139199 | Ga0070690_1001391992 | 183 |
| 19 | 3300005330 | Ga0070690_100208434 | Ga0070690_1002084342 | 183 |
| 20 | 3300005336 | Ga0070680_100010403 | Ga0070680_1000104035 | 183 |
| 21 | 3300005336 | Ga0070680_100936871 | Ga0070680_1009368711 | 183 |
| 22 | 3300005338 | Ga0068868_100205202 | Ga0068868_1002052022 | 183 |
| 23 | 3300005338 | Ga0068868_100746846 | Ga0068868_1007468461 | 183 |
| 24 | 3300005339 | Ga0070660_100006653 | Ga0070660_1000066539 | 183 |
| 25 | 3300005339 | Ga0070660_100013782 | Ga0070660_1000137822 | 183 |
| 26 | 3300005340 | Ga0070689_100334128 | Ga0070689_1003341282 | 183 |
| 27 | 3300005341 | Ga0070691_10000315 | Ga0070691_100003156 | 183 |
| 28 | 3300005344 | Ga0070661_100114022 | Ga0070661_1001140222 | 183 |
| 29 | 3300005344 | Ga0070661_100123089 | Ga0070661_1001230893 | 183 |
| 30 | 3300005345 | Ga0070692_10188714 | Ga0070692_101887142 | 183 |
| 31 | 3300005353 | Ga0070669_100827793 | Ga0070669_1008277931 | 183 |
| 32 | 3300005355 | Ga0070671_100000477 | Ga0070671_10000047723 | 183 |
| 33 | 3300005364 | Ga0070673_100193516 | Ga0070673_1001935162 | 183 |
| 34 | 3300005365 | Ga0070688_100260009 | Ga0070688_1002600092 | 183 |
| 35 | 3300005366 | Ga0070659_100000655 | Ga0070659_10000065512 | 183 |
| 36 | 3300005366 | Ga0070659_100108813 | Ga0070659_1001088134 | 183 |
| 37 | 3300005435 | Ga0070714_100329343 | Ga0070714_1003293432 | 183 |
| 38 | 3300005436 | Ga0070713_100011774 | Ga0070713_1000117746 | 183 |
| 39 | 3300005436 | Ga0070713_100018726 | Ga0070713_1000187263 | 183 |
| 40 | 3300005436 | Ga0070713_100383110 | Ga0070713_1003831102 | 183 |
| 41 | 3300005439 | Ga0070711_100080226 | Ga0070711_1000802263 | 183 |
| 42 | 3300005439 | Ga0070711_100336915 | Ga0070711_1003369152 | 183 |
| 43 | 3300005439 | Ga0070711_100390231 | Ga0070711_1003902312 | 183 |
| 44 | 3300005445 | Ga0070708_100774496 | Ga0070708_1007744962 | 183 |
| 45 | 3300005456 | Ga0070678_100034618 | Ga0070678_1000346182 | 183 |
| 46 | 3300005458 | Ga0070681_10001891 | Ga0070681_100018916 | 183 |
| 47 | 3300005459 | Ga0068867_100452269 | Ga0068867_1004522692 | 183 |
| 48 | 3300005466 | Ga0070685_10465052 | Ga0070685_104650521 | 183 |
| 49 | 3300005530 | Ga0070679_100004611 | Ga0070679_10000461114 | 183 |
| 50 | 3300005530 | Ga0070679_100701429 | Ga0070679_1007014292 | 183 |
| 51 | 3300005535 | Ga0070684_100001706 | Ga0070684_1000017064 | 183 |
| 52 | 3300005535 | Ga0070684_100318420 | Ga0070684_1003184203 | 183 |
| 53 | 3300005535 | Ga0070684_100569298 | Ga0070684_1005692982 | 183 |
| 54 | 3300005539 | Ga0068853_100000049 | Ga0068853_10000004924 | 183 |
| 55 | 3300005539 | Ga0068853_100044563 | Ga0068853_1000445634 | 183 |
| 56 | 3300005539 | Ga0068853_100284336 | Ga0068853_1002843362 | 183 |
| 57 | 3300005539 | Ga0068853_100440945 | Ga0068853_1004409451 | 183 |
| 58 | 3300005547 | Ga0070693_100061726 | Ga0070693_1000617262 | 183 |
| 59 | 3300005548 | Ga0070665_100009987 | Ga0070665_1000099879 | 183 |
| 60 | 3300005548 | Ga0070665_100239030 | Ga0070665_1002390302 | 183 |
| 61 | 3300005548 | Ga0070665_100648585 | Ga0070665_1006485851 | 183 |
| 62 | 3300005548 | Ga0070665_100966263 | Ga0070665_1009662631 | 183 |
| 63 | 3300005563 | Ga0068855_100002363 | Ga0068855_10000236316 | 183 |
| 64 | 3300005563 | Ga0068855_100003302 | Ga0068855_10000330210 | 183 |
| 65 | 3300005563 | Ga0068855_100185561 | Ga0068855_1001855613 | 183 |
| 66 | 3300005563 | Ga0068855_100223948 | Ga0068855_1002239483 | 183 |
| 67 | 3300005563 | Ga0068855_100256143 | Ga0068855_1002561433 | 183 |
| 68 | 3300005563 | Ga0068855_100399559 | Ga0068855_1003995592 | 183 |
| 69 | 3300005563 | Ga0068855_100795890 | Ga0068855_1007958902 | 183 |
| 70 | 3300005564 | Ga0070664_100159379 | Ga0070664_1001593792 | 183 |
| 71 | 3300005564 | Ga0070664_100347654 | Ga0070664_1003476542 | 183 |
| 72 | 3300005577 | Ga0068857_100002278 | Ga0068857_10000227815 | 183 |
| 73 | 3300005577 | Ga0068857_100502601 | Ga0068857_1005026012 | 183 |
| 74 | 3300005577 | Ga0068857_101164580 | Ga0068857_1011645802 | 183 |
| 75 | 3300005578 | Ga0068854_100000129 | Ga0068854_10000012912 | 183 |
| 76 | 3300005614 | Ga0068856_100001516 | Ga0068856_10000151616 | 183 |
| 77 | 3300005614 | Ga0068856_100028230 | Ga0068856_1000282303 | 183 |
| 78 | 3300005614 | Ga0068856_100129987 | Ga0068856_1001299872 | 183 |
| 79 | 3300005615 | Ga0070702_100512888 | Ga0070702_1005128881 | 183 |
| 80 | 3300005616 | Ga0068852_100160780 | Ga0068852_1001607802 | 183 |
| 81 | 3300005616 | Ga0068852_101040222 | Ga0068852_1010402221 | 183 |
| 82 | 3300005617 | Ga0068859_100093590 | Ga0068859_1000935905 | 183 |
| 83 | 3300005617 | Ga0068859_100224671 | Ga0068859_1002246712 | 183 |
| 84 | 3300005617 | Ga0068859_100254633 | Ga0068859_1002546332 | 183 |
| 85 | 3300005618 | Ga0068864_100019848 | Ga0068864_1000198484 | 183 |
| 86 | 3300005618 | Ga0068864_100482762 | Ga0068864_1004827622 | 183 |
| 87 | 3300005841 | Ga0068863_100006748 | Ga0068863_1000067487 | 183 |
| 88 | 3300005841 | Ga0068863_100047401 | Ga0068863_1000474012 | 183 |
| 89 | 3300005841 | Ga0068863_100403112 | Ga0068863_1004031122 | 183 |
| 90 | 3300005842 | Ga0068858_100058294 | Ga0068858_1000582943 | 183 |
| 91 | 3300005842 | Ga0068858_100514573 | Ga0068858_1005145732 | 183 |
| 92 | 3300005842 | Ga0068858_101238021 | Ga0068858_1012380211 | 183 |
| 93 | 3300005843 | Ga0068860_101220584 | Ga0068860_1012205842 | 183 |
| 94 | 3300006028 | Ga0070717_10666067 | Ga0070717_106660672 | 183 |
| 95 | 3300006175 | Ga0070712_100636746 | Ga0070712_1006367461 | 183 |
| 96 | 3300006237 | Ga0097621_100032311 | Ga0097621_1000323115 | 183 |
| 97 | 3300006237 | Ga0097621_100151535 | Ga0097621_1001515353 | 183 |
| 98 | 3300006237 | Ga0097621_100449231 | Ga0097621_1004492312 | 183 |
| 99 | 3300006237 | Ga0097621_100749838 | Ga0097621_1007498382 | 183 |
| 100 | 3300006358 | Ga0068871_100353158 | Ga0068871_1003531582 | 183 |
| 101 | 3300006358 | Ga0068871_100404852 | Ga0068871_1004048522 | 183 |
| 102 | 3300006358 | Ga0068871_100551843 | Ga0068871_1005518431 | 183 |
| 103 | 3300006358 | Ga0068871_101351619 | Ga0068871_1013516191 | 183 |
| 104 | 3300006844 | Ga0075428_100544883 | Ga0075428_1005448833 | 183 |
| 105 | 3300006881 | Ga0068865_100069588 | Ga0068865_1000695882 | 183 |
| 106 | 3300006881 | Ga0068865_100167555 | Ga0068865_1001675552 | 183 |
| 107 | 3300006931 | Ga0097620_100093588 | Ga0097620_1000935885 | 183 |
| 108 | 3300006931 | Ga0097620_100224674 | Ga0097620_1002246742 | 183 |
| 109 | 3300006931 | Ga0097620_100254631 | Ga0097620_1002546313 | 183 |
| 110 | 3300009093 | Ga0105240_10000001 | Ga0105240_100000011868 | 183 |
| 111 | 3300009093 | Ga0105240_10000202 | Ga0105240_1000020228 | 183 |
| 112 | 3300009093 | Ga0105240_10001456 | Ga0105240_1000145614 | 183 |
| 113 | 3300009093 | Ga0105240_10003229 | Ga0105240_1000322917 | 183 |
| 114 | 3300009093 | Ga0105240_10003634 | Ga0105240_1000363413 | 183 |
| 115 | 3300009093 | Ga0105240_10060633 | Ga0105240_100606336 | 183 |
| 116 | 3300009093 | Ga0105240_10797941 | Ga0105240_107979412 | 183 |
| 117 | 3300009093 | Ga0105240_11277877 | Ga0105240_112778771 | 183 |
| 118 | 3300009098 | Ga0105245_10035817 | Ga0105245_100358175 | 183 |
| 119 | 3300009098 | Ga0105245_10133758 | Ga0105245_101337583 | 183 |
| 120 | 3300009098 | Ga0105245_10152130 | Ga0105245_101521303 | 183 |
| 121 | 3300009098 | Ga0105245_10607858 | Ga0105245_106078581 | 183 |
| 122 | 3300009101 | Ga0105247_10632894 | Ga0105247_106328942 | 183 |
| 123 | 3300009148 | Ga0105243_10151796 | Ga0105243_101517963 | 183 |
| 124 | 3300009148 | Ga0105243_11229649 | Ga0105243_112296491 | 183 |
| 125 | 3300009174 | Ga0105241_10004691 | Ga0105241_100046914 | 183 |
| 126 | 3300009174 | Ga0105241_10085959 | Ga0105241_100859593 | 183 |
| 127 | 3300009174 | Ga0105241_10932599 | Ga0105241_109325991 | 183 |
| 128 | 3300009176 | Ga0105242_10294345 | Ga0105242_102943452 | 183 |
| 129 | 3300009176 | Ga0105242_10588675 | Ga0105242_105886752 | 183 |
| 130 | 3300009177 | Ga0105248_10023774 | Ga0105248_100237745 | 183 |
| 131 | 3300009177 | Ga0105248_10209075 | Ga0105248_102090754 | 183 |
| 132 | 3300009177 | Ga0105248_10381993 | Ga0105248_103819932 | 183 |
| 133 | 3300009545 | Ga0105237_11171410 | Ga0105237_111714101 | 183 |
| 134 | 3300009551 | Ga0105238_10001077 | Ga0105238_1000107715 | 183 |
| 135 | 3300009551 | Ga0105238_10022724 | Ga0105238_100227245 | 183 |
| 136 | 3300009551 | Ga0105238_10030128 | Ga0105238_100301283 | 183 |
| 137 | 3300009551 | Ga0105238_10039587 | Ga0105238_100395876 | 183 |
| 138 | 3300010375 | Ga0105239_10006418 | Ga0105239_1000641814 | 183 |
| 139 | 3300010375 | Ga0105239_10050366 | Ga0105239_100503665 | 183 |
| 140 | 3300013104 | Ga0157370_10003670 | Ga0157370_100036703 | 183 |
| 141 | 3300013104 | Ga0157370_10004975 | Ga0157370_1000497513 | 183 |
| 142 | 3300013104 | Ga0157370_10005288 | Ga0157370_100052884 | 183 |
| 143 | 3300013104 | Ga0157370_10012130 | Ga0157370_100121306 | 183 |
| 144 | 3300013104 | Ga0157370_10014494 | Ga0157370_100144947 | 183 |
| 145 | 3300013104 | Ga0157370_10213363 | Ga0157370_102133632 | 183 |
| 146 | 3300013104 | Ga0157370_10365503 | Ga0157370_103655031 | 183 |
| 147 | 3300013105 | Ga0157369_10003568 | Ga0157369_100035685 | 183 |
| 148 | 3300013105 | Ga0157369_10024819 | Ga0157369_100248195 | 183 |
| 149 | 3300013105 | Ga0157369_10045825 | Ga0157369_100458252 | 183 |
| 150 | 3300013105 | Ga0157369_10123957 | Ga0157369_101239574 | 183 |
| 151 | 3300013105 | Ga0157369_11038839 | Ga0157369_110388391 | 183 |
| 152 | 3300013105 | Ga0157369_11070589 | Ga0157369_110705892 | 183 |
| 153 | 3300013296 | Ga0157374_10027356 | Ga0157374_100273566 | 183 |
| 154 | 3300013296 | Ga0157374_10043075 | Ga0157374_100430752 | 183 |
| 155 | 3300013296 | Ga0157374_10362595 | Ga0157374_103625952 | 183 |
| 156 | 3300013296 | Ga0157374_10931736 | Ga0157374_109317362 | 183 |
| 157 | 3300013297 | Ga0157378_10056049 | Ga0157378_100560494 | 183 |
| 158 | 3300013297 | Ga0157378_10798524 | Ga0157378_107985242 | 183 |
| 159 | 3300013306 | Ga0163162_10006711 | Ga0163162_1000671113 | 183 |
| 160 | 3300013306 | Ga0163162_10162833 | Ga0163162_101628332 | 183 |
| 161 | 3300013306 | Ga0163162_10598451 | Ga0163162_105984512 | 183 |
| 162 | 3300013306 | Ga0163162_10725929 | Ga0163162_107259291 | 183 |
| 163 | 3300013307 | Ga0157372_10005248 | Ga0157372_100052485 | 183 |
| 164 | 3300013307 | Ga0157372_10031848 | Ga0157372_100318482 | 183 |
| 165 | 3300013307 | Ga0157372_10053364 | Ga0157372_100533642 | 183 |
| 166 | 3300013307 | Ga0157372_10192784 | Ga0157372_101927843 | 183 |
| 167 | 3300013307 | Ga0157372_10320841 | Ga0157372_103208411 | 183 |
| 168 | 3300013307 | Ga0157372_10488364 | Ga0157372_104883642 | 183 |
| 169 | 3300013308 | Ga0157375_10129517 | Ga0157375_101295173 | 183 |
| 170 | 3300013308 | Ga0157375_10630202 | Ga0157375_106302022 | 183 |
| 171 | 3300013308 | Ga0157375_10754248 | Ga0157375_107542482 | 183 |
| 172 | 3300013308 | Ga0157375_10896473 | Ga0157375_108964732 | 183 |
| 173 | 3300013308 | Ga0157375_11403802 | Ga0157375_114038021 | 183 |
| 174 | 3300013308 | Ga0157375_12132339 | Ga0157375_121323391 | 183 |
| 175 | 3300014325 | Ga0163163_10046741 | Ga0163163_100467414 | 183 |
| 176 | 3300014325 | Ga0163163_10181596 | Ga0163163_101815963 | 183 |
| 177 | 3300014325 | Ga0163163_10198281 | Ga0163163_101982813 | 183 |
| 178 | 3300014325 | Ga0163163_10363906 | Ga0163163_103639062 | 183 |
| 179 | 3300014325 | Ga0163163_10681478 | Ga0163163_106814782 | 183 |
| 180 | 3300014325 | Ga0163163_10792795 | Ga0163163_107927951 | 183 |
| 181 | 3300014745 | Ga0157377_10056138 | Ga0157377_100561383 | 183 |
| 182 | 3300014745 | Ga0157377_10430056 | Ga0157377_104300562 | 183 |
| 183 | 3300014968 | Ga0157379_10019282 | Ga0157379_100192823 | 183 |
| 184 | 3300014968 | Ga0157379_10156477 | Ga0157379_101564772 | 183 |
| 185 | 3300014968 | Ga0157379_10162722 | Ga0157379_101627222 | 183 |
| 186 | 3300014968 | Ga0157379_10322252 | Ga0157379_103222521 | 183 |
| 187 | 3300014968 | Ga0157379_10904693 | Ga0157379_109046931 | 183 |
| 188 | 3300014969 | Ga0157376_10009804 | Ga0157376_100098042 | 183 |
| 189 | 3300014969 | Ga0157376_10017134 | Ga0157376_100171345 | 183 |
| 190 | 3300014969 | Ga0157376_10048023 | Ga0157376_100480234 | 183 |
| 191 | 3300014969 | Ga0157376_10155870 | Ga0157376_101558703 | 183 |
| 192 | 3300014969 | Ga0157376_10248908 | Ga0157376_102489082 | 183 |
| 193 | 3300014969 | Ga0157376_10694341 | Ga0157376_106943412 | 183 |
| 194 | 3300014969 | Ga0157376_11314253 | Ga0157376_113142531 | 183 |
| 195 | 3300014969 | Ga0157376_11758705 | Ga0157376_117587051 | 183 |
| 196 | 3300025898 | Ga0207692_10326202 | Ga0207692_103262021 | 183 |
| 197 | 3300025904 | Ga0207647_10006083 | Ga0207647_100060832 | 183 |
| 198 | 3300025913 | Ga0207695_10000001 | Ga0207695_100000011871 | 183 |
| 199 | 3300025913 | Ga0207695_10001149 | Ga0207695_1000114917 | 183 |
| 200 | 3300025913 | Ga0207695_10023536 | Ga0207695_100235367 | 183 |
| 201 | 3300025914 | Ga0207671_10642327 | Ga0207671_106423272 | 183 |
| 202 | 3300025919 | Ga0207657_10001379 | Ga0207657_1000137921 | 183 |
| 203 | 3300025921 | Ga0207652_10006036 | Ga0207652_1000603610 | 183 |
| 204 | 3300025924 | Ga0207694_10140283 | Ga0207694_101402832 | 183 |
| 205 | 3300025927 | Ga0207687_10403665 | Ga0207687_104036652 | 183 |
| 206 | 3300025928 | Ga0207700_10028747 | Ga0207700_100287474 | 183 |
| 207 | 3300025931 | Ga0207644_10043603 | Ga0207644_100436032 | 183 |
| 208 | 3300025931 | Ga0207644_10293731 | Ga0207644_102937311 | 183 |
| 209 | 3300025932 | Ga0207690_10001643 | Ga0207690_1000164314 | 183 |
| 210 | 3300025936 | Ga0207670_10287786 | Ga0207670_102877862 | 183 |
| 211 | 3300025941 | Ga0207711_10052122 | Ga0207711_100521223 | 183 |
| 212 | 3300025949 | Ga0207667_10003594 | Ga0207667_1000359416 | 183 |
| 213 | 3300025949 | Ga0207667_10022346 | Ga0207667_100223462 | 183 |
| 214 | 3300025949 | Ga0207667_10417980 | Ga0207667_104179802 | 183 |
| 215 | 3300025960 | Ga0207651_10201061 | Ga0207651_102010613 | 183 |
| 216 | 3300025981 | Ga0207640_10000011 | Ga0207640_10000011103 | 183 |
| 217 | 3300025981 | Ga0207640_10527193 | Ga0207640_105271932 | 183 |
| 218 | 3300026023 | Ga0207677_10217928 | Ga0207677_102179282 | 183 |
| 219 | 3300026041 | Ga0207639_10000025 | Ga0207639_100000252 | 183 |
| 220 | 3300026078 | Ga0207702_10030483 | Ga0207702_100304833 | 183 |
| 221 | 3300026088 | Ga0207641_10270505 | Ga0207641_102705053 | 183 |
| 222 | 3300026089 | Ga0207648_11272500 | Ga0207648_112725001 | 183 |
| 223 | 3300026095 | Ga0207676_10010923 | Ga0207676_100109235 | 183 |
| 224 | 3300026116 | Ga0207674_11119771 | Ga0207674_111197711 | 183 |
| 225 | 3300028379 | Ga0268266_10054155 | Ga0268266_100541553 | 183 |
| 226 | 3300033180 | Ga0307510_10029977 | Ga0307510_100299773 | 183 |
| 227 | 3300035692 | Ga0373935_0851061 | Ga0373935_0851061_44_619 | 183 |
| 228 | 3300037068 | Ga0373925_0746332 | Ga0373925_0746332_214_789 | 183 |
| 229 | 3300039437 | Ga0436365_1344226 | Ga0436365_1344226_139_708 | 183 |
| 230 | 3300044694 | Ga0466963_0123571 | Ga0466963_0123571_398_994 | 183 |
| 231 | 3300045051 | Ga0451576_0400612 | Ga0451576_0400612_576_1145 | 183 |
| 232 | 3300045976 | Ga0466967_0173989 | Ga0466967_0173989_599_1195 | 183 |
| 233 | 3300046454 | Ga0495592_0073303 | Ga0495592_0073303_1235_1810 | 183 |
| 234 | 3300046455 | Ga0495603_0001767 | Ga0495603_0001767_9309_9884 | 183 |
| 235 | 3300046455 | Ga0495603_0013033 | Ga0495603_0013033_354_929 | 183 |
| 236 | 3300046455 | Ga0495603_0019518 | Ga0495603_0019518_1025_1600 | 183 |
| 237 | 3300046459 | Ga0495629_0005634 | Ga0495629_0005634_2297_2872 | 183 |
| 238 | 3300046459 | Ga0495629_0013549 | Ga0495629_0013549_1440_2015 | 183 |
| 239 | 3300046462 | Ga0495651_0007913 | Ga0495651_0007913_1037_1612 | 183 |
| 240 | 3300046462 | Ga0495651_0113300 | Ga0495651_0113300_756_1331 | 183 |
| 241 | 3300046463 | Ga0495653_0020438 | Ga0495653_0020438_2950_3525 | 183 |
| 242 | 3300046471 | Ga0495650_0000022 | Ga0495650_0000022_515160_515732 | 183 |
| 243 | 3300046472 | Ga0495580_0035996 | Ga0495580_0035996_1371_1946 | 183 |
| 244 | 3300046472 | Ga0495580_0068384 | Ga0495580_0068384_1148_1723 | 183 |
| 245 | 3300046473 | Ga0495582_0002862 | Ga0495582_0002862_5444_6019 | 183 |
| 246 | 3300046475 | Ga0495639_0004884 | Ga0495639_0004884_3770_4345 | 183 |
| 247 | 3300046476 | Ga0495662_0005537 | Ga0495662_0005537_2108_2683 | 183 |
| 248 | 3300046477 | Ga0495664_0001397 | Ga0495664_0001397_8797_9372 | 183 |
| 249 | 3300046491 | Ga0495584_0113080 | Ga0495584_0113080_561_1136 | 183 |
| 250 | 3300046492 | Ga0495585_0027729 | Ga0495585_0027729_1939_2514 | 183 |
| 251 | 3300046499 | Ga0495594_0000297 | Ga0495594_0000297_9622_10197 | 183 |
| 252 | 3300046499 | Ga0495594_0001779 | Ga0495594_0001779_6787_7362 | 183 |
| 253 | 3300046499 | Ga0495594_0002650 | Ga0495594_0002650_1103_1678 | 183 |
| 254 | 3300046506 | Ga0495583_0017996 | Ga0495583_0017996_1602_2177 | 183 |
| 255 | 3300046507 | Ga0495606_0048364 | Ga0495606_0048364_372_947 | 183 |
| 256 | 3300046507 | Ga0495606_0154904 | Ga0495606_0154904_706_1278 | 183 |
| 257 | 3300046513 | Ga0495616_0128829 | Ga0495616_0128829_190_765 | 183 |
| 258 | 3300046516 | Ga0495628_0010170 | Ga0495628_0010170_2640_3215 | 183 |
| 259 | 3300046517 | Ga0495630_0025955 | Ga0495630_0025955_3419_3994 | 183 |
| 260 | 3300046518 | Ga0495631_0177317 | Ga0495631_0177317_98_673 | 183 |
| 261 | 3300046523 | Ga0495644_0000092 | Ga0495644_0000092_23722_24297 | 183 |
| 262 | 3300046525 | Ga0495663_0186888 | Ga0495663_0186888_81_656 | 183 |
| 263 | 3300046526 | Ga0495666_0000902 | Ga0495666_0000902_9424_9999 | 183 |
| 264 | 3300046528 | Ga0495642_0258581 | Ga0495642_0258581_30_605 | 183 |
| 265 | 3300046529 | Ga0495652_0021122 | Ga0495652_0021122_1594_2169 | 183 |
| 266 | 3300046529 | Ga0495652_0075456 | Ga0495652_0075456_1708_2283 | 183 |
| 267 | 3300046531 | Ga0495665_0000995 | Ga0495665_0000995_673_1245 | 183 |
| 268 | 3300046533 | Ga0495640_0100482 | Ga0495640_0100482_173_748 | 183 |
| 269 | 3300046535 | Ga0495586_0002103 | Ga0495586_0002103_941_1513 | 183 |
| 270 | 3300046536 | Ga0495587_0039275 | Ga0495587_0039275_2212_2787 | 183 |
| 271 | 3300046538 | Ga0495609_0012713 | Ga0495609_0012713_2943_3518 | 183 |
| 272 | 3300046538 | Ga0495609_0017279 | Ga0495609_0017279_2694_3269 | 183 |
| 273 | 3300046543 | Ga0495645_0008197 | Ga0495645_0008197_1024_1599 | 183 |
| 274 | 3300046543 | Ga0495645_0030352 | Ga0495645_0030352_648_1223 | 183 |
| 275 | 3300046543 | Ga0495645_0158275 | Ga0495645_0158275_895_1470 | 183 |
| 276 | 3300046557 | Ga0495622_0040447 | Ga0495622_0040447_1048_1623 | 183 |
| 277 | 3300046559 | Ga0495667_0039806 | Ga0495667_0039806_648_1223 | 183 |
| 278 | 3300046616 | Ga0495668_0034923 | Ga0495668_0034923_953_1528 | 183 |
| 279 | 3300046616 | Ga0495668_0295206 | Ga0495668_0295206_127_696 | 183 |
| 280 | 3300046642 | Ga0495634_0001577 | Ga0495634_0001577_13955_14527 | 183 |
| 281 | 3300046648 | Ga0495611_0004376 | Ga0495611_0004376_65_640 | 183 |
| 282 | 3300046660 | Ga0495625_0013471 | Ga0495625_0013471_3115_3690 | 183 |
| 283 | 3300046660 | Ga0495625_0071321 | Ga0495625_0071321_567_1142 | 183 |
| 284 | 3300046665 | Ga0495661_0035936 | Ga0495661_0035936_1461_2033 | 183 |
| 285 | 3300046674 | Ga0495588_0053920 | Ga0495588_0053920_372_947 | 183 |
| 286 | 3300046678 | Ga0495599_0009354 | Ga0495599_0009354_4085_4660 | 183 |
| 287 | 3300046679 | Ga0495623_0031310 | Ga0495623_0031310_2483_3058 | 183 |
| 288 | 3300046680 | Ga0495646_0008599 | Ga0495646_0008599_5221_5796 | 183 |
| 289 | 3300046684 | Ga0495669_0003958 | Ga0495669_0003958_2716_3291 | 183 |
| 290 | 3300046689 | Ga0495613_0000761 | Ga0495613_0000761_13029_13604 | 183 |
| 291 | 3300046689 | Ga0495613_0032323 | Ga0495613_0032323_2173_2748 | 183 |
| 292 | 3300046690 | Ga0495624_0014348 | Ga0495624_0014348_1919_2494 | 183 |
| 293 | 3300046691 | Ga0495670_0045419 | Ga0495670_0045419_1389_1964 | 183 |
| 294 | 3300046694 | Ga0495649_0138288 | Ga0495649_0138288_247_816 | 183 |
| 295 | 3300046809 | Ga0495600_0000609 | Ga0495600_0000609_3638_4213 | 183 |
| 296 | 3300046809 | Ga0495600_0123019 | Ga0495600_0123019_246_821 | 183 |
| 297 | 3300047315 | Ga0495581_0002974 | Ga0495581_0002974_2430_3005 | 183 |
| 298 | 3300047315 | Ga0495581_0082824 | Ga0495581_0082824_1023_1598 | 183 |
| 299 | 3300047318 | Ga0495636_0041817 | Ga0495636_0041817_917_1492 | 183 |
| 300 | 3300047319 | Ga0495674_0034853 | Ga0495674_0034853_3909_4484 | 183 |
| 301 | 3300047321 | Ga0495676_0001068 | Ga0495676_0001068_15520_16095 | 183 |
| 302 | 3300047444 | Ga0495675_0000836 | Ga0495675_0000836_15115_15690 | 183 |
| 303 | 3300047469 | Ga0495673_0040361 | Ga0495673_0040361_114_689 | 183 |
| 304 | 3300047471 | Ga0495684_0129281 | Ga0495684_0129281_811_1386 | 183 |
| 305 | 3300047472 | Ga0495686_0003025 | Ga0495686_0003025_3361_3936 | 183 |
| 306 | 3300047472 | Ga0495686_0003149 | Ga0495686_0003149_2148_2747 | 183 |
| 307 | 3300047472 | Ga0495686_0354508 | Ga0495686_0354508_203_778 | 183 |
| 308 | 3300048088 | Ga0495602_0265235 | Ga0495602_0265235_647_1222 | 183 |
| 309 | 3300048089 | Ga0495614_0006733 | Ga0495614_0006733_3953_4528 | 183 |
| 310 | 3300048089 | Ga0495614_0060219 | Ga0495614_0060219_1038_1613 | 183 |
| 311 | 3300048908 | Ga0496105_0414509 | Ga0496105_0414509_363_938 | 183 |
| 312 | 3300048911 | Ga0496108_0439946 | Ga0496108_0439946_362_937 | 183 |
| 313 | 3300048917 | Ga0496114_0698019 | Ga0496114_0698019_272_844 | 183 |
| 314 | 3300048929 | Ga0496126_0000231 | Ga0496126_0000231_40832_41407 | 183 |
| 315 | 3300048929 | Ga0496126_0006179 | Ga0496126_0006179_5619_6194 | 183 |
| 316 | 3300049460 | Ga0495682_0119058 | Ga0495682_0119058_322_891 | 183 |
| 317 | 3300053087 | Ga0500643_027477 | Ga0500643_027477_578_1150 | 183 |
| 318 | 3300053093 | Ga0500651_0000003 | Ga0500651_0000003_301589_302161 | 183 |
| 319 | 3300053162 | Ga0500638_171414 | Ga0500638_171414_38_610 | 183 |
| 320 | 3300055283 | Ga0500661_002041 | Ga0500661_002041_2411_2983 | 183 |
| 321 | 3300005366 | Ga0070659_100510914 | Ga0070659_1005109141 | 184 |
| 322 | 3300005539 | Ga0068853_100060899 | Ga0068853_1000608994 | 184 |
| 323 | 3300005563 | Ga0068855_100125421 | Ga0068855_1001254213 | 184 |
| 324 | 3300005563 | Ga0068855_100665896 | Ga0068855_1006658962 | 184 |
| 325 | 3300005564 | Ga0070664_100195127 | Ga0070664_1001951272 | 184 |
| 326 | 3300005614 | Ga0068856_100050129 | Ga0068856_1000501293 | 184 |
| 327 | 3300005614 | Ga0068856_100057591 | Ga0068856_1000575913 | 184 |
| 328 | 3300006237 | Ga0097621_100539288 | Ga0097621_1005392882 | 184 |
| 329 | 3300006880 | Ga0075429_100145959 | Ga0075429_1001459593 | 184 |
| 330 | 3300006914 | Ga0075436_100022470 | Ga0075436_1000224701 | 184 |
| 331 | 3300006914 | Ga0075436_100193223 | Ga0075436_1001932231 | 184 |
| 332 | 3300009545 | Ga0105237_10265226 | Ga0105237_102652262 | 184 |
| 333 | 3300009545 | Ga0105237_11086574 | Ga0105237_110865742 | 184 |
| 334 | 3300009551 | Ga0105238_10106338 | Ga0105238_101063383 | 184 |
| 335 | 3300010375 | Ga0105239_10998064 | Ga0105239_109980641 | 184 |
| 336 | 3300013100 | Ga0157373_10061222 | Ga0157373_100612222 | 184 |
| 337 | 3300013102 | Ga0157371_10060357 | Ga0157371_100603574 | 184 |
| 338 | 3300013104 | Ga0157370_10407921 | Ga0157370_104079212 | 184 |
| 339 | 3300013104 | Ga0157370_10641143 | Ga0157370_106411431 | 184 |
| 340 | 3300013105 | Ga0157369_10045430 | Ga0157369_100454307 | 184 |
| 341 | 3300013105 | Ga0157369_10511240 | Ga0157369_105112402 | 184 |
| 342 | 3300013296 | Ga0157374_10012560 | Ga0157374_100125604 | 184 |
| 343 | 3300013296 | Ga0157374_10037335 | Ga0157374_100373356 | 184 |
| 344 | 3300013307 | Ga0157372_10606170 | Ga0157372_106061702 | 184 |
| 345 | 3300025904 | Ga0207647_10248006 | Ga0207647_102480062 | 184 |
| 346 | 3300025909 | Ga0207705_10476271 | Ga0207705_104762712 | 184 |
| 347 | 3300025913 | Ga0207695_10036014 | Ga0207695_100360143 | 184 |
| 348 | 3300025914 | Ga0207671_10166701 | Ga0207671_101667012 | 184 |
| 349 | 3300025919 | Ga0207657_10180884 | Ga0207657_101808842 | 184 |
| 350 | 3300025920 | Ga0207649_10197204 | Ga0207649_101972042 | 184 |
| 351 | 3300025928 | Ga0207700_10686052 | Ga0207700_106860522 | 184 |
| 352 | 3300025929 | Ga0207664_10043714 | Ga0207664_100437143 | 184 |
| 353 | 3300025945 | Ga0207679_10248143 | Ga0207679_102481431 | 184 |
| 354 | 3300025949 | Ga0207667_10098682 | Ga0207667_100986823 | 184 |
| 355 | 3300025949 | Ga0207667_10783660 | Ga0207667_107836601 | 184 |
| 356 | 3300026041 | Ga0207639_10054061 | Ga0207639_100540612 | 184 |
| 357 | 3300026078 | Ga0207702_10087384 | Ga0207702_100873843 | 184 |
| 358 | 3300026142 | Ga0207698_10171080 | Ga0207698_101710802 | 184 |
| 359 | 3300031995 | Ga0307409_101465994 | Ga0307409_1014659941 | 184 |
| 360 | 3300032005 | Ga0307411_10742165 | Ga0307411_107421651 | 184 |
| 361 | 3300035725 | Ga0373947_0041913 | Ga0373947_0041913_1142_1720 | 184 |
| 362 | 3300039450 | Ga0436363_0614006 | Ga0436363_0614006_431_1012 | 184 |
| 363 | 3300039450 | Ga0436363_1046906 | Ga0436363_1046906_2487_3188 | 184 |
| 364 | 3300046663 | Ga0495635_0284303 | Ga0495635_0284303_514_1068 | 184 |
| 365 | 3300048916 | Ga0496113_0072700 | Ga0496113_0072700_1276_1842 | 184 |
| 366 | 3300048918 | Ga0496115_0047237 | Ga0496115_0047237_1888_2454 | 184 |
| 367 | 3300049520 | Ga0501297_013572 | Ga0501297_013572_245_820 | 184 |
| 368 | 3300049522 | Ga0501299_031817 | Ga0501299_031817_356_931 | 184 |
| 369 | 3300049584 | Ga0501068_0680203 | Ga0501068_0680203_74_634 | 184 |
| 370 | 3300049762 | Ga0501265_016162 | Ga0501265_016162_115_690 | 184 |
| 371 | 3300049767 | Ga0501270_025753 | Ga0501270_025753_130_705 | 184 |
| 372 | 3300049771 | Ga0501274_013685 | Ga0501274_013685_22_597 | 184 |
| 373 | 3300050508 | nmdc:mga09592_311112_c1 | nmdc:mga09592_311112_c1_68_622 | 184 |
| 374 | 3300050509 | nmdc:mga0qj67_35717_c1 | nmdc:mga0qj67_35717_c1_226_780 | 184 |
| 375 | 3300005364 | Ga0070673_100133956 | Ga0070673_1001339563 | 185 |
| 376 | 3300005437 | Ga0070710_10513243 | Ga0070710_105132432 | 185 |
| 377 | 3300005438 | Ga0070701_10240910 | Ga0070701_102409101 | 185 |
| 378 | 3300005617 | Ga0068859_100705441 | Ga0068859_1007054411 | 185 |
| 379 | 3300005618 | Ga0068864_101176682 | Ga0068864_1011766822 | 185 |
| 380 | 3300005842 | Ga0068858_100039179 | Ga0068858_1000391795 | 185 |
| 381 | 3300005843 | Ga0068860_101049113 | Ga0068860_1010491132 | 185 |
| 382 | 3300006931 | Ga0097620_100705451 | Ga0097620_1007054512 | 185 |
| 383 | 3300009093 | Ga0105240_10001466 | Ga0105240_1000146621 | 185 |
| 384 | 3300009093 | Ga0105240_10091023 | Ga0105240_100910233 | 185 |
| 385 | 3300009093 | Ga0105240_10299723 | Ga0105240_102997233 | 185 |
| 386 | 3300009176 | Ga0105242_10523237 | Ga0105242_105232372 | 185 |
| 387 | 3300009177 | Ga0105248_10344935 | Ga0105248_103449352 | 185 |
| 388 | 3300009545 | Ga0105237_11069243 | Ga0105237_110692432 | 185 |
| 389 | 3300009551 | Ga0105238_10839624 | Ga0105238_108396241 | 185 |
| 390 | 3300009553 | Ga0105249_10847414 | Ga0105249_108474141 | 185 |
| 391 | 3300010375 | Ga0105239_10034686 | Ga0105239_100346862 | 185 |
| 392 | 3300013306 | Ga0163162_10740275 | Ga0163162_107402751 | 185 |
| 393 | 3300014326 | Ga0157380_10869106 | Ga0157380_108691061 | 185 |
| 394 | 3300017792 | Ga0163161_10193680 | Ga0163161_101936802 | 185 |
| 395 | 3300021358 | Ga0213873_10034584 | Ga0213873_100345842 | 185 |
| 396 | 3300021384 | Ga0213876_10146786 | Ga0213876_101467862 | 185 |
| 397 | 3300025903 | Ga0207680_10254469 | Ga0207680_102544692 | 185 |
| 398 | 3300025906 | Ga0207699_10057421 | Ga0207699_100574213 | 185 |
| 399 | 3300025913 | Ga0207695_10007220 | Ga0207695_100072205 | 185 |
| 400 | 3300025913 | Ga0207695_10025828 | Ga0207695_100258285 | 185 |
| 401 | 3300025913 | Ga0207695_10290848 | Ga0207695_102908483 | 185 |
| 402 | 3300025941 | Ga0207711_10235492 | Ga0207711_102354921 | 185 |
| 403 | 3300025961 | Ga0207712_10978781 | Ga0207712_109787812 | 185 |
| 404 | 3300026035 | Ga0207703_10027419 | Ga0207703_100274195 | 185 |
| 405 | 3300026041 | Ga0207639_10092952 | Ga0207639_100929522 | 185 |
| 406 | 3300026078 | Ga0207702_11034393 | Ga0207702_110343932 | 185 |
| 407 | 3300028379 | Ga0268266_11413851 | Ga0268266_114138512 | 185 |
| 408 | 3300028381 | Ga0268264_10878008 | Ga0268264_108780081 | 185 |
| 409 | 3300028800 | Ga0265338_10098863 | Ga0265338_100988631 | 185 |
| 410 | 3300031238 | Ga0265332_10244653 | Ga0265332_102446531 | 185 |
| 411 | 3300035170 | Ga0373943_0018087 | Ga0373943_0018087_1676_2239 | 185 |
| 412 | 3300035171 | Ga0373946_0014420 | Ga0373946_0014420_2370_2933 | 185 |
| 413 | 3300035725 | Ga0373947_0095549 | Ga0373947_0095549_330_893 | 185 |
| 414 | 3300035725 | Ga0373947_0608256 | Ga0373947_0608256_133_696 | 185 |
| 415 | 3300036401 | Ga0373937_1060252 | Ga0373937_1060252_115_678 | 185 |
| 416 | 3300039437 | Ga0436365_1620961 | Ga0436365_1620961_1020_1580 | 185 |
| 417 | 3300039447 | Ga0436361_0986900 | Ga0436361_0986900_129_689 | 185 |
| 418 | 3300039450 | Ga0436363_0818238 | Ga0436363_0818238_37_597 | 185 |
| 419 | 3300039453 | Ga0436362_0474546 | Ga0436362_0474546_556_1116 | 185 |
| 420 | 3300046472 | Ga0495580_0065684 | Ga0495580_0065684_29_592 | 185 |
| 421 | 3300046499 | Ga0495594_0056916 | Ga0495594_0056916_348_911 | 185 |
| 422 | 3300047318 | Ga0495636_0354616 | Ga0495636_0354616_88_657 | 185 |
| 423 | 3300047319 | Ga0495674_0121538 | Ga0495674_0121538_1174_1737 | 185 |
| 424 | 3300049568 | Ga0501031_0007915 | Ga0501031_0007915_3011_3568 | 185 |
| 425 | 3300049569 | Ga0501032_0062044 | Ga0501032_0062044_1476_2033 | 185 |
| 426 | 3300049570 | Ga0501033_0111213 | Ga0501033_0111213_735_1292 | 185 |
| 427 | 3300049571 | Ga0501034_0035637 | Ga0501034_0035637_4127_4684 | 185 |
| 428 | 3300049572 | Ga0501036_0015802 | Ga0501036_0015802_1494_2051 | 185 |
| 429 | 3300049573 | Ga0501037_0001492 | Ga0501037_0001492_13910_14467 | 185 |
| 430 | 3300049574 | Ga0501038_0003506 | Ga0501038_0003506_5445_6002 | 185 |
| 431 | 3300049575 | Ga0501039_0020927 | Ga0501039_0020927_23_580 | 185 |
| 432 | 3300049579 | Ga0501043_0003763 | Ga0501043_0003763_3513_4070 | 185 |
| 433 | 3300049580 | Ga0501046_0024228 | Ga0501046_0024228_2310_2867 | 185 |
| 434 | 3300049581 | Ga0501047_0014625 | Ga0501047_0014625_607_1164 | 185 |
| 435 | 3300049582 | Ga0501048_0025324 | Ga0501048_0025324_2620_3177 | 185 |
| 436 | 3300049583 | Ga0501067_0018174 | Ga0501067_0018174_702_1259 | 185 |
| 437 | 3300049584 | Ga0501068_0001328 | Ga0501068_0001328_6432_6989 | 185 |
| 438 | 3300049585 | Ga0501069_0002181 | Ga0501069_0002181_1979_2536 | 185 |
| 439 | 3300049586 | Ga0501070_0199021 | Ga0501070_0199021_387_944 | 185 |
| 440 | 3300049588 | Ga0501072_0000523 | Ga0501072_0000523_21435_21992 | 185 |
| 441 | 3300049589 | Ga0501073_0000999 | Ga0501073_0000999_3499_4056 | 185 |
| 442 | 3300049590 | Ga0501074_0006388 | Ga0501074_0006388_620_1177 | 185 |
| 443 | 3300049593 | Ga0501077_0013202 | Ga0501077_0013202_112_669 | 185 |
| 444 | 3300049741 | Ga0501079_0000555 | Ga0501079_0000555_15389_15946 | 185 |
| 445 | 3300049742 | Ga0501080_0112917 | Ga0501080_0112917_387_944 | 185 |
| 446 | 3300049744 | Ga0501083_0023532 | Ga0501083_0023532_702_1259 | 185 |
| 447 | 3300049822 | Ga0501035_0037545 | Ga0501035_0037545_1195_1752 | 185 |
| 448 | 3300049823 | Ga0501044_0141892 | Ga0501044_0141892_259_816 | 185 |
| 449 | 3300049824 | Ga0501045_0073298 | Ga0501045_0073298_1198_1755 | 185 |
| 450 | 3300053078 | Ga0495612_0028781 | Ga0495612_0028781_433_996 | 185 |
| 451 | 3300054114 | Ga0501084_0000282 | Ga0501084_0000282_23039_23596 | 185 |
| 452 | 3300060353 | Ga0501082_0001154 | Ga0501082_0001154_14870_15427 | 185 |
| 453 | 3300005327 | Ga0070658_10069958 | Ga0070658_100699584 | 186 |
| 454 | 3300005327 | Ga0070658_10262991 | Ga0070658_102629913 | 186 |
| 455 | 3300005329 | Ga0070683_100000011 | Ga0070683_10000001129 | 186 |
| 456 | 3300005329 | Ga0070683_100080046 | Ga0070683_1000800463 | 186 |
| 457 | 3300005329 | Ga0070683_100084660 | Ga0070683_1000846603 | 186 |
| 458 | 3300005336 | Ga0070680_100543607 | Ga0070680_1005436071 | 186 |
| 459 | 3300005339 | Ga0070660_100084760 | Ga0070660_1000847602 | 186 |
| 460 | 3300005355 | Ga0070671_100480845 | Ga0070671_1004808452 | 186 |
| 461 | 3300005367 | Ga0070667_101413976 | Ga0070667_1014139761 | 186 |
| 462 | 3300005434 | Ga0070709_10242284 | Ga0070709_102422842 | 186 |
| 463 | 3300005436 | Ga0070713_100104505 | Ga0070713_1001045052 | 186 |
| 464 | 3300005436 | Ga0070713_100184902 | Ga0070713_1001849023 | 186 |
| 465 | 3300005458 | Ga0070681_10121574 | Ga0070681_101215743 | 186 |
| 466 | 3300005458 | Ga0070681_10215261 | Ga0070681_102152613 | 186 |
| 467 | 3300005458 | Ga0070681_10480069 | Ga0070681_104800691 | 186 |
| 468 | 3300005467 | Ga0070706_100273609 | Ga0070706_1002736092 | 186 |
| 469 | 3300005467 | Ga0070706_100645130 | Ga0070706_1006451302 | 186 |
| 470 | 3300005518 | Ga0070699_100223003 | Ga0070699_1002230032 | 186 |
| 471 | 3300005530 | Ga0070679_100314098 | Ga0070679_1003140982 | 186 |
| 472 | 3300005535 | Ga0070684_100000001 | Ga0070684_100000001229 | 186 |
| 473 | 3300005535 | Ga0070684_100255017 | Ga0070684_1002550171 | 186 |
| 474 | 3300005536 | Ga0070697_100086077 | Ga0070697_1000860772 | 186 |
| 475 | 3300005539 | Ga0068853_100296303 | Ga0068853_1002963032 | 186 |
| 476 | 3300005563 | Ga0068855_100002895 | Ga0068855_1000028954 | 186 |
| 477 | 3300005563 | Ga0068855_100054809 | Ga0068855_1000548092 | 186 |
| 478 | 3300005563 | Ga0068855_100078450 | Ga0068855_1000784504 | 186 |
| 479 | 3300005614 | Ga0068856_100902062 | Ga0068856_1009020622 | 186 |
| 480 | 3300005616 | Ga0068852_100002225 | Ga0068852_10000222513 | 186 |
| 481 | 3300005616 | Ga0068852_100885137 | Ga0068852_1008851372 | 186 |
| 482 | 3300005616 | Ga0068852_101099263 | Ga0068852_1010992632 | 186 |
| 483 | 3300005617 | Ga0068859_100349276 | Ga0068859_1003492761 | 186 |
| 484 | 3300005841 | Ga0068863_101282984 | Ga0068863_1012829842 | 186 |
| 485 | 3300005983 | Ga0081540_1141879 | Ga0081540_11418791 | 186 |
| 486 | 3300006028 | Ga0070717_10064577 | Ga0070717_100645772 | 186 |
| 487 | 3300006175 | Ga0070712_100563424 | Ga0070712_1005634241 | 186 |
| 488 | 3300006844 | Ga0075428_100744378 | Ga0075428_1007443781 | 186 |
| 489 | 3300006914 | Ga0075436_100012886 | Ga0075436_1000128865 | 186 |
| 490 | 3300006931 | Ga0097620_100349232 | Ga0097620_1003492322 | 186 |
| 491 | 3300009093 | Ga0105240_10033834 | Ga0105240_100338343 | 186 |
| 492 | 3300009093 | Ga0105240_10045233 | Ga0105240_100452335 | 186 |
| 493 | 3300009093 | Ga0105240_10153005 | Ga0105240_101530054 | 186 |
| 494 | 3300009093 | Ga0105240_10300226 | Ga0105240_103002262 | 186 |
| 495 | 3300009093 | Ga0105240_10730300 | Ga0105240_107303002 | 186 |
| 496 | 3300009147 | Ga0114129_10688031 | Ga0114129_106880312 | 186 |
| 497 | 3300009177 | Ga0105248_10047585 | Ga0105248_100475852 | 186 |
| 498 | 3300009545 | Ga0105237_10062276 | Ga0105237_100622763 | 186 |
| 499 | 3300009551 | Ga0105238_10054576 | Ga0105238_100545762 | 186 |
| 500 | 3300009551 | Ga0105238_10146453 | Ga0105238_101464532 | 186 |
| 501 | 3300009551 | Ga0105238_10447302 | Ga0105238_104473021 | 186 |
| 502 | 3300010375 | Ga0105239_10075890 | Ga0105239_100758903 | 186 |
| 503 | 3300013102 | Ga0157371_10544180 | Ga0157371_105441801 | 186 |
| 504 | 3300013104 | Ga0157370_10002989 | Ga0157370_1000298913 | 186 |
| 505 | 3300013104 | Ga0157370_10233827 | Ga0157370_102338272 | 186 |
| 506 | 3300013104 | Ga0157370_10326086 | Ga0157370_103260862 | 186 |
| 507 | 3300013105 | Ga0157369_10402438 | Ga0157369_104024382 | 186 |
| 508 | 3300013105 | Ga0157369_10469865 | Ga0157369_104698653 | 186 |
| 509 | 3300013297 | Ga0157378_11764960 | Ga0157378_117649601 | 186 |
| 510 | 3300013307 | Ga0157372_10069139 | Ga0157372_100691393 | 186 |
| 511 | 3300013307 | Ga0157372_10204851 | Ga0157372_102048513 | 186 |
| 512 | 3300021377 | Ga0213874_10040201 | Ga0213874_100402013 | 186 |
| 513 | 3300021384 | Ga0213876_10009021 | Ga0213876_100090214 | 186 |
| 514 | 3300021384 | Ga0213876_10127561 | Ga0213876_101275612 | 186 |
| 515 | 3300021388 | Ga0213875_10003299 | Ga0213875_100032993 | 186 |
| 516 | 3300021388 | Ga0213875_10025228 | Ga0213875_100252283 | 186 |
| 517 | 3300021388 | Ga0213875_10093524 | Ga0213875_100935242 | 186 |
| 518 | 3300021388 | Ga0213875_10223391 | Ga0213875_102233912 | 186 |
| 519 | 3300021388 | Ga0213875_10377130 | Ga0213875_103771301 | 186 |
| 520 | 3300025909 | Ga0207705_10041534 | Ga0207705_100415344 | 186 |
| 521 | 3300025909 | Ga0207705_10083813 | Ga0207705_100838134 | 186 |
| 522 | 3300025909 | Ga0207705_10265714 | Ga0207705_102657142 | 186 |
| 523 | 3300025910 | Ga0207684_10433823 | Ga0207684_104338232 | 186 |
| 524 | 3300025910 | Ga0207684_10531568 | Ga0207684_105315682 | 186 |
| 525 | 3300025912 | Ga0207707_10163031 | Ga0207707_101630312 | 186 |
| 526 | 3300025912 | Ga0207707_10328821 | Ga0207707_103288212 | 186 |
| 527 | 3300025913 | Ga0207695_10003468 | Ga0207695_1000346820 | 186 |
| 528 | 3300025913 | Ga0207695_10717304 | Ga0207695_107173041 | 186 |
| 529 | 3300025914 | Ga0207671_10005666 | Ga0207671_100056663 | 186 |
| 530 | 3300025917 | Ga0207660_10005477 | Ga0207660_100054774 | 186 |
| 531 | 3300025917 | Ga0207660_10057471 | Ga0207660_100574713 | 186 |
| 532 | 3300025919 | Ga0207657_10103554 | Ga0207657_101035542 | 186 |
| 533 | 3300025921 | Ga0207652_10318294 | Ga0207652_103182942 | 186 |
| 534 | 3300025924 | Ga0207694_10101326 | Ga0207694_101013263 | 186 |
| 535 | 3300025926 | Ga0207659_10707032 | Ga0207659_107070322 | 186 |
| 536 | 3300025928 | Ga0207700_10290002 | Ga0207700_102900021 | 186 |
| 537 | 3300025928 | Ga0207700_10330262 | Ga0207700_103302622 | 186 |
| 538 | 3300025929 | Ga0207664_10560046 | Ga0207664_105600462 | 186 |
| 539 | 3300025929 | Ga0207664_10797237 | Ga0207664_107972372 | 186 |
| 540 | 3300025941 | Ga0207711_10259728 | Ga0207711_102597282 | 186 |
| 541 | 3300025944 | Ga0207661_10120142 | Ga0207661_101201423 | 186 |
| 542 | 3300025944 | Ga0207661_11138694 | Ga0207661_111386941 | 186 |
| 543 | 3300025949 | Ga0207667_10044399 | Ga0207667_100443994 | 186 |
| 544 | 3300025949 | Ga0207667_10294111 | Ga0207667_102941112 | 186 |
| 545 | 3300025949 | Ga0207667_10314432 | Ga0207667_103144323 | 186 |
| 546 | 3300025949 | Ga0207667_10459381 | Ga0207667_104593812 | 186 |
| 547 | 3300025949 | Ga0207667_10585464 | Ga0207667_105854642 | 186 |
| 548 | 3300026023 | Ga0207677_10119513 | Ga0207677_101195133 | 186 |
| 549 | 3300026041 | Ga0207639_10441626 | Ga0207639_104416262 | 186 |
| 550 | 3300026067 | Ga0207678_10034832 | Ga0207678_100348323 | 186 |
| 551 | 3300026078 | Ga0207702_10049086 | Ga0207702_100490864 | 186 |
| 552 | 3300026078 | Ga0207702_10207777 | Ga0207702_102077773 | 186 |
| 553 | 3300026142 | Ga0207698_10139613 | Ga0207698_101396132 | 186 |
| 554 | 3300026142 | Ga0207698_10157970 | Ga0207698_101579703 | 186 |
| 555 | 3300028653 | Ga0265323_10001186 | Ga0265323_100011868 | 186 |
| 556 | 3300028800 | Ga0265338_10194214 | Ga0265338_101942142 | 186 |
| 557 | 3300031241 | Ga0265325_10196818 | Ga0265325_101968181 | 186 |
| 558 | 3300031241 | Ga0265325_10277842 | Ga0265325_102778421 | 186 |
| 559 | 3300031249 | Ga0265339_10034566 | Ga0265339_100345662 | 186 |
| 560 | 3300031250 | Ga0265331_10024281 | Ga0265331_100242813 | 186 |
| 561 | 3300031250 | Ga0265331_10116825 | Ga0265331_101168252 | 186 |
| 562 | 3300031344 | Ga0265316_10295011 | Ga0265316_102950112 | 186 |
| 563 | 3300031344 | Ga0265316_10311279 | Ga0265316_103112792 | 186 |
| 564 | 3300031711 | Ga0265314_10026183 | Ga0265314_100261834 | 186 |
| 565 | 3300035089 | Ga0373944_0197244 | Ga0373944_0197244_75_638 | 186 |
| 566 | 3300035118 | Ga0373954_0042445 | Ga0373954_0042445_647_1210 | 186 |
| 567 | 3300035410 | Ga0373924_0150212 | Ga0373924_0150212_407_970 | 186 |
| 568 | 3300035695 | Ga0373927_0004398 | Ga0373927_0004398_5913_6476 | 186 |
| 569 | 3300035695 | Ga0373927_0160841 | Ga0373927_0160841_521_1084 | 186 |
| 570 | 3300035695 | Ga0373927_0393175 | Ga0373927_0393175_297_863 | 186 |
| 571 | 3300035724 | Ga0373933_0417692 | Ga0373933_0417692_87_653 | 186 |
| 572 | 3300035724 | Ga0373933_0717507 | Ga0373933_0717507_64_624 | 186 |
| 573 | 3300036401 | Ga0373937_0348468 | Ga0373937_0348468_263_829 | 186 |
| 574 | 3300036401 | Ga0373937_0807698 | Ga0373937_0807698_33_614 | 186 |
| 575 | 3300036401 | Ga0373937_1109377 | Ga0373937_1109377_105_668 | 186 |
| 576 | 3300037068 | Ga0373925_0014038 | Ga0373925_0014038_3289_3852 | 186 |
| 577 | 3300037068 | Ga0373925_0441605 | Ga0373925_0441605_316_879 | 186 |
| 578 | 3300037068 | Ga0373925_0734242 | Ga0373925_0734242_19_600 | 186 |
| 579 | 3300037312 | Ga0395899_0187046 | Ga0395899_0187046_457_1038 | 186 |
| 580 | 3300037466 | Ga0395898_0174168 | Ga0395898_0174168_1319_1900 | 186 |
| 581 | 3300037466 | Ga0395898_1125444 | Ga0395898_1125444_46_627 | 186 |
| 582 | 3300037853 | Ga0436364_0051041 | Ga0436364_0051041_375_950 | 186 |
| 583 | 3300037853 | Ga0436364_0103499 | Ga0436364_0103499_849_1424 | 186 |
| 584 | 3300037853 | Ga0436364_0235071 | Ga0436364_0235071_3771_4352 | 186 |
| 585 | 3300037853 | Ga0436364_0309018 | Ga0436364_0309018_77125_77706 | 186 |
| 586 | 3300037853 | Ga0436364_0461614 | Ga0436364_0461614_1785_2360 | 186 |
| 587 | 3300037853 | Ga0436364_0720089 | Ga0436364_0720089_131_694 | 186 |
| 588 | 3300037853 | Ga0436364_0808515 | Ga0436364_0808515_24420_24980 | 186 |
| 589 | 3300037853 | Ga0436364_0851560 | Ga0436364_0851560_200_772 | 186 |
| 590 | 3300037853 | Ga0436364_0869275 | Ga0436364_0869275_1422_1997 | 186 |
| 591 | 3300037853 | Ga0436364_0876356 | Ga0436364_0876356_1538_2113 | 186 |
| 592 | 3300037853 | Ga0436364_1024913 | Ga0436364_1024913_154_717 | 186 |
| 593 | 3300037853 | Ga0436364_1424251 | Ga0436364_1424251_1219_1806 | 186 |
| 594 | 3300038443 | Ga0395901_0371642 | Ga0395901_0371642_175_756 | 186 |
| 595 | 3300039437 | Ga0436365_0073938 | Ga0436365_0073938_1046_1630 | 186 |
| 596 | 3300039437 | Ga0436365_0165408 | Ga0436365_0165408_18903_19475 | 186 |
| 597 | 3300039437 | Ga0436365_1077991 | Ga0436365_1077991_653_1240 | 186 |
| 598 | 3300039437 | Ga0436365_1822297 | Ga0436365_1822297_62_634 | 186 |
| 599 | 3300039437 | Ga0436365_1911883 | Ga0436365_1911883_4207_4785 | 186 |
| 600 | 3300039438 | Ga0436360_0145639 | Ga0436360_0145639_926_1498 | 186 |
| 601 | 3300039438 | Ga0436360_0300036 | Ga0436360_0300036_108_683 | 186 |
| 602 | 3300039447 | Ga0436361_1094065 | Ga0436361_1094065_1057_1629 | 186 |
| 603 | 3300039450 | Ga0436363_0820413 | Ga0436363_0820413_105_674 | 186 |
| 604 | 3300039450 | Ga0436363_0896163 | Ga0436363_0896163_4187_4759 | 186 |
| 605 | 3300039453 | Ga0436362_0283025 | Ga0436362_0283025_925_1497 | 186 |
| 606 | 3300039453 | Ga0436362_0386289 | Ga0436362_0386289_415_1005 | 186 |
| 607 | 3300044694 | Ga0466963_0361048 | Ga0466963_0361048_215_784 | 186 |
| 608 | 3300044842 | Ga0466957_0535629 | Ga0466957_0535629_118_693 | 186 |
| 609 | 3300045049 | Ga0466959_0537488 | Ga0466959_0537488_149_721 | 186 |
| 610 | 3300045051 | Ga0451576_0083747 | Ga0451576_0083747_951_1514 | 186 |
| 611 | 3300045051 | Ga0451576_1108959 | Ga0451576_1108959_103_666 | 186 |
| 612 | 3300045976 | Ga0466967_0322831 | Ga0466967_0322831_492_1061 | 186 |
| 613 | 3300046454 | Ga0495592_0387775 | Ga0495592_0387775_66_629 | 186 |
| 614 | 3300046462 | Ga0495651_0011853 | Ga0495651_0011853_2715_3278 | 186 |
| 615 | 3300046462 | Ga0495651_0126402 | Ga0495651_0126402_127_690 | 186 |
| 616 | 3300046462 | Ga0495651_0286765 | Ga0495651_0286765_396_962 | 186 |
| 617 | 3300046463 | Ga0495653_0101347 | Ga0495653_0101347_1439_2002 | 186 |
| 618 | 3300046472 | Ga0495580_0170964 | Ga0495580_0170964_415_978 | 186 |
| 619 | 3300046472 | Ga0495580_0399955 | Ga0495580_0399955_54_617 | 186 |
| 620 | 3300046472 | Ga0495580_0534176 | Ga0495580_0534176_157_720 | 186 |
| 621 | 3300046476 | Ga0495662_0093504 | Ga0495662_0093504_856_1419 | 186 |
| 622 | 3300046477 | Ga0495664_0004911 | Ga0495664_0004911_4827_5390 | 186 |
| 623 | 3300046477 | Ga0495664_0184776 | Ga0495664_0184776_129_692 | 186 |
| 624 | 3300046511 | Ga0495608_0088622 | Ga0495608_0088622_671_1234 | 186 |
| 625 | 3300046514 | Ga0495618_0077791 | Ga0495618_0077791_131_694 | 186 |
| 626 | 3300046516 | Ga0495628_0038349 | Ga0495628_0038349_3014_3577 | 186 |
| 627 | 3300046517 | Ga0495630_0101494 | Ga0495630_0101494_591_1154 | 186 |
| 628 | 3300046517 | Ga0495630_0594047 | Ga0495630_0594047_256_819 | 186 |
| 629 | 3300046529 | Ga0495652_0050053 | Ga0495652_0050053_1015_1578 | 186 |
| 630 | 3300046533 | Ga0495640_0029687 | Ga0495640_0029687_3077_3640 | 186 |
| 631 | 3300046535 | Ga0495586_0519907 | Ga0495586_0519907_12_575 | 186 |
| 632 | 3300046536 | Ga0495587_0007381 | Ga0495587_0007381_6300_6863 | 186 |
| 633 | 3300046543 | Ga0495645_0006956 | Ga0495645_0006956_1246_1809 | 186 |
| 634 | 3300046559 | Ga0495667_0381604 | Ga0495667_0381604_50_613 | 186 |
| 635 | 3300046642 | Ga0495634_0658993 | Ga0495634_0658993_30_593 | 186 |
| 636 | 3300046663 | Ga0495635_0038522 | Ga0495635_0038522_78_641 | 186 |
| 637 | 3300046678 | Ga0495599_0009921 | Ga0495599_0009921_1379_1942 | 186 |
| 638 | 3300046679 | Ga0495623_0018407 | Ga0495623_0018407_1983_2546 | 186 |
| 639 | 3300046679 | Ga0495623_0245996 | Ga0495623_0245996_428_991 | 186 |
| 640 | 3300046680 | Ga0495646_0040607 | Ga0495646_0040607_312_875 | 186 |
| 641 | 3300046689 | Ga0495613_0061755 | Ga0495613_0061755_1796_2359 | 186 |
| 642 | 3300046690 | Ga0495624_0151191 | Ga0495624_0151191_810_1376 | 186 |
| 643 | 3300046809 | Ga0495600_0150287 | Ga0495600_0150287_40_603 | 186 |
| 644 | 3300047315 | Ga0495581_0085239 | Ga0495581_0085239_69_632 | 186 |
| 645 | 3300047317 | Ga0495604_0017533 | Ga0495604_0017533_1536_2099 | 186 |
| 646 | 3300047317 | Ga0495604_0187325 | Ga0495604_0187325_664_1227 | 186 |
| 647 | 3300047319 | Ga0495674_0009515 | Ga0495674_0009515_5723_6286 | 186 |
| 648 | 3300047319 | Ga0495674_0078289 | Ga0495674_0078289_2228_2791 | 186 |
| 649 | 3300047319 | Ga0495674_0127098 | Ga0495674_0127098_1314_1877 | 186 |
| 650 | 3300047319 | Ga0495674_0346563 | Ga0495674_0346563_617_1180 | 186 |
| 651 | 3300047322 | Ga0495680_0312991 | Ga0495680_0312991_337_900 | 186 |
| 652 | 3300047322 | Ga0495680_0511824 | Ga0495680_0511824_49_612 | 186 |
| 653 | 3300047444 | Ga0495675_0037454 | Ga0495675_0037454_1200_1763 | 186 |
| 654 | 3300047444 | Ga0495675_0270133 | Ga0495675_0270133_287_850 | 186 |
| 655 | 3300047471 | Ga0495684_0052075 | Ga0495684_0052075_719_1282 | 186 |
| 656 | 3300047471 | Ga0495684_0129292 | Ga0495684_0129292_984_1547 | 186 |
| 657 | 3300047471 | Ga0495684_0231346 | Ga0495684_0231346_204_767 | 186 |
| 658 | 3300048907 | Ga0496104_0258266 | Ga0496104_0258266_784_1365 | 186 |
| 659 | 3300048915 | Ga0496112_1360524 | Ga0496112_1360524_33_596 | 186 |
| 660 | 3300049569 | Ga0501032_0594142 | Ga0501032_0594142_46_618 | 186 |
| 661 | 3300049570 | Ga0501033_0172446 | Ga0501033_0172446_124_705 | 186 |
| 662 | 3300049573 | Ga0501037_0169814 | Ga0501037_0169814_759_1340 | 186 |
| 663 | 3300049574 | Ga0501038_0203625 | Ga0501038_0203625_589_1170 | 186 |
| 664 | 3300049581 | Ga0501047_0098157 | Ga0501047_0098157_875_1447 | 186 |
| 665 | 3300049581 | Ga0501047_0104789 | Ga0501047_0104789_352_933 | 186 |
| 666 | 3300049581 | Ga0501047_0166193 | Ga0501047_0166193_745_1317 | 186 |
| 667 | 3300049582 | Ga0501048_0354577 | Ga0501048_0354577_259_840 | 186 |
| 668 | 3300049586 | Ga0501070_0035051 | Ga0501070_0035051_1056_1637 | 186 |
| 669 | 3300049586 | Ga0501070_0119715 | Ga0501070_0119715_907_1479 | 186 |
| 670 | 3300049589 | Ga0501073_0032062 | Ga0501073_0032062_2178_2768 | 186 |
| 671 | 3300049589 | Ga0501073_0103008 | Ga0501073_0103008_349_930 | 186 |
| 672 | 3300049589 | Ga0501073_0714255 | Ga0501073_0714255_50_622 | 186 |
| 673 | 3300049822 | Ga0501035_0010538 | Ga0501035_0010538_7899_8480 | 186 |
| 674 | 3300049823 | Ga0501044_0020162 | Ga0501044_0020162_5701_6273 | 186 |
| 675 | 3300049823 | Ga0501044_0144312 | Ga0501044_0144312_1076_1657 | 186 |
| 676 | 3300049823 | Ga0501044_0159271 | Ga0501044_0159271_782_1354 | 186 |
| 677 | 3300050507 | nmdc:mga05p37_589668_c1 | nmdc:mga05p37_589668_c1_117_683 | 186 |
| 678 | 3300050507 | nmdc:mga05p37_963770_c1 | nmdc:mga05p37_963770_c1_108_674 | 186 |
| 679 | 3300050512 | nmdc:mga0n895_515833_c1 | nmdc:mga0n895_515833_c1_190_753 | 186 |
| 680 | 3300050514 | nmdc:mga08x19_4575_c1 | nmdc:mga08x19_4575_c1_255_818 | 186 |
| 681 | 3300060353 | Ga0501082_0071448 | Ga0501082_0071448_400_990 | 186 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4p81-assembly1.cif.gz_C | structure of ancestral pyrr protein (ancorangepyrr) | 0.9758 | 5 | 180 |
| 4p81-assembly1.cif.gz_B | structure of ancestral pyrr protein (ancorangepyrr) | 0.9749 | 5 | 180 |
| 4p81-assembly1.cif.gz_A | structure of ancestral pyrr protein (ancorangepyrr) | 0.9746 | 7 | 180 |
| 4p83-assembly1.cif.gz_A | structure of engineered pyrr protein (purple pyrr) | 0.9744 | 7 | 178 |
| 4p81-assembly1.cif.gz_D | structure of ancestral pyrr protein (ancorangepyrr) | 0.973 | 5 | 180 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4p83D00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9668 | 7 | 180 | 3.40.50.2020 |
| 4p83D00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9558 | 7 | 180 | 3.40.50.2020 |
| af_P9WHK3_1_193_3.40.50.2020 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.8605 | 1 | 178 | 3.40.50.2020 |
| 1vdmG00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.8517 | 12 | 155 | 3.40.50.2020 |
| 4zfnB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.8392 | 12 | 157 | 3.40.50.2020 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-U2TCS4-F1-model_v4 | Pyrimidine operon regulatory protein/uracil phosphoribosyltransferase PyrR domain protein | 0.986 | 95 | 180 |
GO:0016757
|
| AF-A0A645JJQ7-F1-model_v4 | Bifunctional protein PyrR | 0.9856 | 97 | 180 |
|
| AF-A0A6L6C5Y7-F1-model_v4 | deleted | 0.9821 | 97 | 183 |
|
| AF-X8AUL1-F1-model_v4 | deleted | 0.9815 | 96 | 178 |
|
| AF-J9HBG7-F1-model_v4 | deleted | 0.9767 | 96 | 183 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar