F474809
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 680 | 332 | 680 | 73 |
Family's Representative Sequence
| Representative Sequence | 3300050492|nmdc:mga0yw44_647867_c1|nmdc:mga0yw44_647867_c1_266_490 |
| Length | 74 |
| Sequence | MAAQSVEIGFEGGQVVSVRLDEGELKNLRKQLEKGGWHDLQTDGGGYVTVYLGKVAFLRVGAGQSRVGFALESD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 4 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 5 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 6 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 37 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 41 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 48 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 50 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 51 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 52 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 54 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 55 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 56 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 57 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 58 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 59 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 60 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 61 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 62 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 63 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 64 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 65 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 66 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 67 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 72 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 73 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 74 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 75 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 77 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 103 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 104 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 105 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 106 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 107 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 108 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 168 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 169 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 170 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 171 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 172 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 173 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 174 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 175 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 176 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 177 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 178 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 179 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 180 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 181 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 182 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 183 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 184 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 185 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 186 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 187 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 188 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 189 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 190 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 191 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 192 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 193 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 194 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 195 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 196 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 197 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 198 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 199 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 200 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 201 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 202 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 203 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 204 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 205 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 206 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 207 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 266 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 267 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 268 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 269 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 270 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 271 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 272 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 273 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 274 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 275 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 276 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 277 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 278 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 279 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 280 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 281 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 282 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 283 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 284 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 285 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 286 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 287 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 288 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 289 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 290 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 305 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 317 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 319 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 321 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 327 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 328 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 329 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 330 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 331 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.12 |
| Metatranscriptomes | 0.88 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.03 |
| Nodule | 0 |
| Rhizoplane | 10.74 |
| Rhizosphere | 83.97 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.26 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1000728 | 3300001977 | Bacteria | 5066 |
| 2 | JGI24740J21852_10005676 | 3300001979 | Bacteria | 5254 |
| 3 | JGI24034J26672_10000167 | 3300002239 | Bacteria | 9222 |
| 4 | JGI24742J22300_10000390 | 3300002244 | Bacteria | 6507 |
| 5 | JGI24751J29686_10026666 | 3300002459 | Bacteria | 1199 |
| 6 | JGI25404J52841_10017023 | 3300003659 | Bacteria | 1576 |
| 7 | Ga0070683_100002929 | 3300005329 | Bacteria | 13677 |
| 8 | Ga0070683_100004842 | 3300005329 | Bacteria | 11145 |
| 9 | Ga0070683_100015414 | 3300005329 | Bacteria | 6713 |
| 10 | Ga0070683_100271872 | 3300005329 | Bacteria | 1612 |
| 11 | Ga0070683_101206817 | 3300005329 | Bacteria | 727 |
| 12 | Ga0070690_100786082 | 3300005330 | Bacteria | 737 |
| 13 | Ga0070670_100129379 | 3300005331 | Bacteria | 2179 |
| 14 | Ga0070670_101590203 | 3300005331 | Unclassified | 601 |
| 15 | Ga0070670_102035597 | 3300005331 | Bacteria | 529 |
| 16 | Ga0068869_100333891 | 3300005334 | Unclassified | 1232 |
| 17 | Ga0070666_10010127 | 3300005335 | Bacteria | 5888 |
| 18 | Ga0070666_10023706 | 3300005335 | Bacteria | 3996 |
| 19 | Ga0070682_100000029 | 3300005337 | Bacteria | 183516 |
| 20 | Ga0070682_100000815 | 3300005337 | Bacteria | 18228 |
| 21 | Ga0068868_100004232 | 3300005338 | Bacteria | 10039 |
| 22 | Ga0068868_100043307 | 3300005338 | Bacteria | 3516 |
| 23 | Ga0068868_101612469 | 3300005338 | Bacteria | 610 |
| 24 | Ga0070691_10000069 | 3300005341 | Bacteria | 28638 |
| 25 | Ga0070691_10003720 | 3300005341 | Bacteria | 6890 |
| 26 | Ga0070661_100000161 | 3300005344 | Bacteria | 55183 |
| 27 | Ga0070692_11069626 | 3300005345 | Unclassified | 568 |
| 28 | Ga0070668_100018528 | 3300005347 | Bacteria | 5227 |
| 29 | Ga0070668_100295683 | 3300005347 | Bacteria | 1357 |
| 30 | Ga0070669_100486485 | 3300005353 | Bacteria | 1022 |
| 31 | Ga0070669_101134422 | 3300005353 | Bacteria | 674 |
| 32 | Ga0070675_100000153 | 3300005354 | Bacteria | 41558 |
| 33 | Ga0070671_100738930 | 3300005355 | Unclassified | 855 |
| 34 | Ga0070674_100000011 | 3300005356 | Bacteria | 134886 |
| 35 | Ga0070674_100000014 | 3300005356 | Bacteria | 100122 |
| 36 | Ga0070674_100106832 | 3300005356 | Bacteria | 2049 |
| 37 | Ga0070673_100019029 | 3300005364 | Bacteria | 4925 |
| 38 | Ga0070673_100365643 | 3300005364 | Bacteria | 1283 |
| 39 | Ga0070673_102259367 | 3300005364 | Bacteria | 517 |
| 40 | Ga0070688_100000453 | 3300005365 | Bacteria | 20787 |
| 41 | Ga0070688_100542171 | 3300005365 | Unclassified | 883 |
| 42 | Ga0070659_100009701 | 3300005366 | Bacteria | 7074 |
| 43 | Ga0070667_100001368 | 3300005367 | Bacteria | 21878 |
| 44 | Ga0070667_100102281 | 3300005367 | Bacteria | 2476 |
| 45 | Ga0070714_100008340 | 3300005435 | Bacteria | 8083 |
| 46 | Ga0070713_100000076 | 3300005436 | Bacteria | 61668 |
| 47 | Ga0070710_10770198 | 3300005437 | Bacteria | 685 |
| 48 | Ga0070711_100546033 | 3300005439 | Bacteria | 961 |
| 49 | Ga0070700_100038140 | 3300005441 | Bacteria | 2927 |
| 50 | Ga0070700_100450694 | 3300005441 | Bacteria | 979 |
| 51 | Ga0070694_100536825 | 3300005444 | Bacteria | 935 |
| 52 | Ga0070663_100012594 | 3300005455 | Bacteria | 5358 |
| 53 | Ga0070678_100355966 | 3300005456 | Unclassified | 1260 |
| 54 | Ga0070678_100408611 | 3300005456 | Unclassified | 1181 |
| 55 | Ga0070662_100000008 | 3300005457 | Bacteria | 168754 |
| 56 | Ga0070681_10043861 | 3300005458 | Bacteria | 4477 |
| 57 | Ga0070681_10463432 | 3300005458 | Bacteria | 1180 |
| 58 | Ga0068867_100000247 | 3300005459 | Bacteria | 35692 |
| 59 | Ga0070685_10000203 | 3300005466 | Bacteria | 39835 |
| 60 | Ga0070679_100000651 | 3300005530 | Bacteria | 29562 |
| 61 | Ga0070679_100114971 | 3300005530 | Bacteria | 2676 |
| 62 | Ga0070684_100022662 | 3300005535 | Bacteria | 5241 |
| 63 | Ga0070684_100022755 | 3300005535 | Bacteria | 5232 |
| 64 | Ga0070684_100033478 | 3300005535 | Bacteria | 4388 |
| 65 | Ga0070684_100061999 | 3300005535 | Bacteria | 3275 |
| 66 | Ga0070684_100117307 | 3300005535 | Bacteria | 2392 |
| 67 | Ga0070684_100541613 | 3300005535 | Bacteria | 1080 |
| 68 | Ga0068853_100810114 | 3300005539 | Bacteria | 897 |
| 69 | Ga0070686_101552802 | 3300005544 | Bacteria | 559 |
| 70 | Ga0070695_100763658 | 3300005545 | Bacteria | 772 |
| 71 | Ga0070695_101345322 | 3300005545 | Unclassified | 591 |
| 72 | Ga0070696_100880147 | 3300005546 | Bacteria | 742 |
| 73 | Ga0070693_100000398 | 3300005547 | Bacteria | 19763 |
| 74 | Ga0070693_100815604 | 3300005547 | Bacteria | 693 |
| 75 | Ga0070665_100000870 | 3300005548 | Bacteria | 39061 |
| 76 | Ga0070665_100002483 | 3300005548 | Bacteria | 20309 |
| 77 | Ga0070665_100022800 | 3300005548 | Bacteria | 6303 |
| 78 | Ga0070665_100047809 | 3300005548 | Bacteria | 4294 |
| 79 | Ga0070665_101688485 | 3300005548 | Bacteria | 641 |
| 80 | Ga0070704_100596651 | 3300005549 | Bacteria | 970 |
| 81 | Ga0068855_100149600 | 3300005563 | Bacteria | 2655 |
| 82 | Ga0068855_100356527 | 3300005563 | Bacteria | 1610 |
| 83 | Ga0070664_100093697 | 3300005564 | Bacteria | 2603 |
| 84 | Ga0068857_100501548 | 3300005577 | Bacteria | 1139 |
| 85 | Ga0068857_102371919 | 3300005577 | Bacteria | 521 |
| 86 | Ga0068854_100000115 | 3300005578 | Bacteria | 55089 |
| 87 | Ga0068856_100000057 | 3300005614 | Bacteria | 102045 |
| 88 | Ga0068856_100010700 | 3300005614 | Bacteria | 8912 |
| 89 | Ga0068856_100020527 | 3300005614 | Bacteria | 6417 |
| 90 | Ga0068856_101478997 | 3300005614 | Bacteria | 693 |
| 91 | Ga0070702_100002851 | 3300005615 | Bacteria | 7585 |
| 92 | Ga0068852_100000058 | 3300005616 | Bacteria | 75312 |
| 93 | Ga0068859_101172030 | 3300005617 | Bacteria | 846 |
| 94 | Ga0068864_100000044 | 3300005618 | Bacteria | 157919 |
| 95 | Ga0068866_10000002 | 3300005718 | Bacteria | 394090 |
| 96 | Ga0068866_10000219 | 3300005718 | Bacteria | 27162 |
| 97 | Ga0068866_10104165 | 3300005718 | Bacteria | 1571 |
| 98 | Ga0068851_10001867 | 3300005834 | Bacteria | 9251 |
| 99 | Ga0068851_10022934 | 3300005834 | Bacteria | 3047 |
| 100 | Ga0068870_10115813 | 3300005840 | Bacteria | 1537 |
| 101 | Ga0068863_100000042 | 3300005841 | Bacteria | 154459 |
| 102 | Ga0068863_100003904 | 3300005841 | Bacteria | 14726 |
| 103 | Ga0068858_100000086 | 3300005842 | Bacteria | 96201 |
| 104 | Ga0068858_100000155 | 3300005842 | Bacteria | 72794 |
| 105 | Ga0068860_100010275 | 3300005843 | Bacteria | 9264 |
| 106 | Ga0068860_100194561 | 3300005843 | Bacteria | 1963 |
| 107 | Ga0068860_102556009 | 3300005843 | Bacteria | 530 |
| 108 | Ga0068862_100010337 | 3300005844 | Bacteria | 7701 |
| 109 | Ga0068862_100742992 | 3300005844 | Bacteria | 954 |
| 110 | Ga0081455_10100357 | 3300005937 | Bacteria | 2326 |
| 111 | Ga0081540_1000546 | 3300005983 | Bacteria | 36470 |
| 112 | Ga0081540_1021526 | 3300005983 | Bacteria | 3834 |
| 113 | Ga0081539_10001100 | 3300005985 | Bacteria | 49090 |
| 114 | Ga0081539_10489412 | 3300005985 | Bacteria | 509 |
| 115 | Ga0075365_10309978 | 3300006038 | Bacteria | 1111 |
| 116 | Ga0070715_10000015 | 3300006163 | Bacteria | 152816 |
| 117 | Ga0070715_10085070 | 3300006163 | Bacteria | 1444 |
| 118 | Ga0070715_10208143 | 3300006163 | Bacteria | 998 |
| 119 | Ga0070716_100681297 | 3300006173 | Unclassified | 783 |
| 120 | Ga0070716_101110091 | 3300006173 | Bacteria | 631 |
| 121 | Ga0070712_100001300 | 3300006175 | Bacteria | 15100 |
| 122 | Ga0070712_100224422 | 3300006175 | Bacteria | 1489 |
| 123 | Ga0097621_100734357 | 3300006237 | Bacteria | 911 |
| 124 | Ga0068871_100576412 | 3300006358 | Bacteria | 1021 |
| 125 | Ga0075430_100077761 | 3300006846 | Bacteria | 2781 |
| 126 | Ga0075433_10000663 | 3300006852 | Bacteria | 23254 |
| 127 | Ga0075433_10003490 | 3300006852 | Bacteria | 12148 |
| 128 | Ga0068865_100000020 | 3300006881 | Bacteria | 104487 |
| 129 | Ga0068865_100258678 | 3300006881 | Bacteria | 1377 |
| 130 | Ga0097620_101172093 | 3300006931 | Bacteria | 846 |
| 131 | Ga0075435_100768870 | 3300007076 | Bacteria | 838 |
| 132 | Ga0105240_10694108 | 3300009093 | Unclassified | 1112 |
| 133 | Ga0105245_10000053 | 3300009098 | Bacteria | 125678 |
| 134 | Ga0105245_10000159 | 3300009098 | Bacteria | 63630 |
| 135 | Ga0105245_10001015 | 3300009098 | Bacteria | 25483 |
| 136 | Ga0105245_10002749 | 3300009098 | Bacteria | 15821 |
| 137 | Ga0105247_10000993 | 3300009101 | Bacteria | 21414 |
| 138 | Ga0105247_10104372 | 3300009101 | Bacteria | 1816 |
| 139 | Ga0114129_10743544 | 3300009147 | Bacteria | 1256 |
| 140 | Ga0105243_10004998 | 3300009148 | Bacteria | 10392 |
| 141 | Ga0105243_10221148 | 3300009148 | Bacteria | 1674 |
| 142 | Ga0105241_10590912 | 3300009174 | Bacteria | 1002 |
| 143 | Ga0105241_11710066 | 3300009174 | Bacteria | 611 |
| 144 | Ga0105242_10000017 | 3300009176 | Bacteria | 122190 |
| 145 | Ga0105242_10002766 | 3300009176 | Bacteria | 13729 |
| 146 | Ga0105242_10008605 | 3300009176 | Bacteria | 7837 |
| 147 | Ga0105242_10238304 | 3300009176 | Bacteria | 1634 |
| 148 | Ga0105242_10250629 | 3300009176 | Bacteria | 1595 |
| 149 | Ga0105248_10000022 | 3300009177 | Bacteria | 275935 |
| 150 | Ga0105238_10000299 | 3300009551 | Bacteria | 54293 |
| 151 | Ga0105238_10652846 | 3300009551 | Bacteria | 1062 |
| 152 | Ga0105249_10000085 | 3300009553 | Bacteria | 133497 |
| 153 | Ga0105249_10000841 | 3300009553 | Bacteria | 27506 |
| 154 | Ga0105249_10189958 | 3300009553 | Unclassified | 2004 |
| 155 | Ga0105239_10050654 | 3300010375 | Bacteria | 4554 |
| 156 | Ga0105239_10423863 | 3300010375 | Unclassified | 1508 |
| 157 | Ga0105239_10645854 | 3300010375 | Bacteria | 1208 |
| 158 | Ga0105239_10659490 | 3300010375 | Bacteria | 1195 |
| 159 | Ga0105239_10889786 | 3300010375 | Bacteria | 1022 |
| 160 | Ga0105239_11936167 | 3300010375 | Bacteria | 684 |
| 161 | Ga0105239_13631877 | 3300010375 | Unclassified | 501 |
| 162 | Ga0105246_11428851 | 3300011119 | Bacteria | 647 |
| 163 | Ga0157373_10496552 | 3300013100 | Bacteria | 881 |
| 164 | Ga0157371_10004276 | 3300013102 | Bacteria | 12531 |
| 165 | Ga0157370_10006328 | 3300013104 | Bacteria | 13080 |
| 166 | Ga0157370_10187874 | 3300013104 | Bacteria | 1918 |
| 167 | Ga0157374_10074388 | 3300013296 | Bacteria | 3208 |
| 168 | Ga0157374_10297473 | 3300013296 | Bacteria | 1596 |
| 169 | Ga0157378_10092044 | 3300013297 | Bacteria | 2758 |
| 170 | Ga0157378_10386968 | 3300013297 | Bacteria | 1375 |
| 171 | Ga0163162_10078269 | 3300013306 | Bacteria | 3372 |
| 172 | Ga0163162_10166902 | 3300013306 | Bacteria | 2325 |
| 173 | Ga0157372_10000616 | 3300013307 | Bacteria | 38850 |
| 174 | Ga0157372_12564454 | 3300013307 | Bacteria | 585 |
| 175 | Ga0157375_10008882 | 3300013308 | Bacteria | 8794 |
| 176 | Ga0157375_10302567 | 3300013308 | Unclassified | 1763 |
| 177 | Ga0157375_10573648 | 3300013308 | Bacteria | 1289 |
| 178 | Ga0157375_10664790 | 3300013308 | Bacteria | 1197 |
| 179 | Ga0157375_11937808 | 3300013308 | Bacteria | 700 |
| 180 | Ga0157375_11956333 | 3300013308 | Unclassified | 696 |
| 181 | Ga0157375_13618746 | 3300013308 | Bacteria | 514 |
| 182 | Ga0163163_10164392 | 3300014325 | Bacteria | 2265 |
| 183 | Ga0163163_10761392 | 3300014325 | Bacteria | 1032 |
| 184 | Ga0163163_10975566 | 3300014325 | Bacteria | 911 |
| 185 | Ga0163163_11125753 | 3300014325 | Bacteria | 848 |
| 186 | Ga0157380_10000024 | 3300014326 | Bacteria | 110947 |
| 187 | Ga0157380_10000080 | 3300014326 | Bacteria | 53731 |
| 188 | Ga0157380_10514808 | 3300014326 | Archaea | 1166 |
| 189 | Ga0157379_10055979 | 3300014968 | Bacteria | 3525 |
| 190 | Ga0157379_10121840 | 3300014968 | Bacteria | 2346 |
| 191 | Ga0157379_10125057 | 3300014968 | Bacteria | 2314 |
| 192 | Ga0157376_10035064 | 3300014969 | Bacteria | 4056 |
| 193 | Ga0163161_10009328 | 3300017792 | Bacteria | 6790 |
| 194 | Ga0197907_11298225 | 3300020069 | Unclassified | 767 |
| 195 | Ga0206356_11661110 | 3300020070 | Bacteria | 3396 |
| 196 | Ga0206352_10935449 | 3300020078 | Bacteria | 1513 |
| 197 | Ga0206354_11092466 | 3300020081 | Bacteria | 1363 |
| 198 | Ga0206353_11601057 | 3300020082 | Bacteria | 1801 |
| 199 | Ga0224712_10163623 | 3300022467 | Bacteria | 994 |
| 200 | Ga0207656_10000354 | 3300025321 | Bacteria | 15472 |
| 201 | Ga0207656_10004306 | 3300025321 | Bacteria | 4960 |
| 202 | Ga0207653_10216855 | 3300025885 | Bacteria | 725 |
| 203 | Ga0207682_10000228 | 3300025893 | Bacteria | 25297 |
| 204 | Ga0207692_10531534 | 3300025898 | Bacteria | 749 |
| 205 | Ga0207692_10784804 | 3300025898 | Bacteria | 622 |
| 206 | Ga0207642_10000001 | 3300025899 | Bacteria | 714030 |
| 207 | Ga0207642_10000003 | 3300025899 | Bacteria | 650651 |
| 208 | Ga0207642_10000094 | 3300025899 | Bacteria | 23395 |
| 209 | Ga0207642_10026554 | 3300025899 | Bacteria | 2359 |
| 210 | Ga0207710_10000151 | 3300025900 | Bacteria | 77424 |
| 211 | Ga0207710_10112969 | 3300025900 | Bacteria | 1291 |
| 212 | Ga0207680_10048971 | 3300025903 | Bacteria | 2513 |
| 213 | Ga0207680_10272508 | 3300025903 | Bacteria | 1174 |
| 214 | Ga0207685_10000001 | 3300025905 | Bacteria | 604473 |
| 215 | Ga0207643_10134307 | 3300025908 | Bacteria | 1474 |
| 216 | Ga0207705_10091476 | 3300025909 | Bacteria | 2228 |
| 217 | Ga0207705_10974544 | 3300025909 | Bacteria | 656 |
| 218 | Ga0207654_10270279 | 3300025911 | Bacteria | 1146 |
| 219 | Ga0207654_11125583 | 3300025911 | Bacteria | 572 |
| 220 | Ga0207707_10018135 | 3300025912 | Bacteria | 6134 |
| 221 | Ga0207707_10065523 | 3300025912 | Bacteria | 3164 |
| 222 | Ga0207695_10714554 | 3300025913 | Bacteria | 882 |
| 223 | Ga0207693_10000859 | 3300025915 | Bacteria | 27121 |
| 224 | Ga0207693_10299747 | 3300025915 | Bacteria | 1259 |
| 225 | Ga0207663_10121651 | 3300025916 | Bacteria | 1788 |
| 226 | Ga0207660_10650918 | 3300025917 | Bacteria | 859 |
| 227 | Ga0207649_10000024 | 3300025920 | Bacteria | 183104 |
| 228 | Ga0207649_10328326 | 3300025920 | Bacteria | 1126 |
| 229 | Ga0207652_10000150 | 3300025921 | Bacteria | 75189 |
| 230 | Ga0207652_10015731 | 3300025921 | Bacteria | 6162 |
| 231 | Ga0207681_10360413 | 3300025923 | Bacteria | 1166 |
| 232 | Ga0207681_10902401 | 3300025923 | Bacteria | 740 |
| 233 | Ga0207694_10000035 | 3300025924 | Bacteria | 195870 |
| 234 | Ga0207694_10818072 | 3300025924 | Bacteria | 787 |
| 235 | Ga0207694_11024536 | 3300025924 | Bacteria | 699 |
| 236 | Ga0207650_10829818 | 3300025925 | Bacteria | 784 |
| 237 | Ga0207659_10000043 | 3300025926 | Bacteria | 90795 |
| 238 | Ga0207659_10852866 | 3300025926 | Bacteria | 783 |
| 239 | Ga0207687_10000011 | 3300025927 | Bacteria | 388349 |
| 240 | Ga0207687_10000021 | 3300025927 | Bacteria | 226396 |
| 241 | Ga0207687_10000350 | 3300025927 | Bacteria | 30682 |
| 242 | Ga0207687_10000716 | 3300025927 | Bacteria | 22524 |
| 243 | Ga0207687_11238758 | 3300025927 | Unclassified | 641 |
| 244 | Ga0207700_10000009 | 3300025928 | Bacteria | 314953 |
| 245 | Ga0207664_10056834 | 3300025929 | Bacteria | 3109 |
| 246 | Ga0207664_10081702 | 3300025929 | Bacteria | 2631 |
| 247 | Ga0207690_10006983 | 3300025932 | Bacteria | 6695 |
| 248 | Ga0207706_10000016 | 3300025933 | Bacteria | 170697 |
| 249 | Ga0207706_11416642 | 3300025933 | Bacteria | 570 |
| 250 | Ga0207686_10000016 | 3300025934 | Bacteria | 198779 |
| 251 | Ga0207686_10000029 | 3300025934 | Bacteria | 160239 |
| 252 | Ga0207686_10000549 | 3300025934 | Bacteria | 24232 |
| 253 | Ga0207686_10015756 | 3300025934 | Bacteria | 4235 |
| 254 | Ga0207686_10070529 | 3300025934 | Bacteria | 2246 |
| 255 | Ga0207686_11086241 | 3300025934 | Unclassified | 652 |
| 256 | Ga0207709_10162874 | 3300025935 | Bacteria | 1557 |
| 257 | Ga0207709_10390025 | 3300025935 | Bacteria | 1062 |
| 258 | Ga0207670_10129878 | 3300025936 | Bacteria | 1844 |
| 259 | Ga0207669_10000007 | 3300025937 | Bacteria | 169904 |
| 260 | Ga0207669_10000027 | 3300025937 | Bacteria | 91216 |
| 261 | Ga0207669_10213635 | 3300025937 | Bacteria | 1410 |
| 262 | Ga0207704_10000004 | 3300025938 | Bacteria | 239295 |
| 263 | Ga0207704_10294588 | 3300025938 | Unclassified | 1240 |
| 264 | Ga0207704_10323007 | 3300025938 | Bacteria | 1191 |
| 265 | Ga0207665_10966109 | 3300025939 | Bacteria | 677 |
| 266 | Ga0207665_11229300 | 3300025939 | Bacteria | 598 |
| 267 | Ga0207711_10000019 | 3300025941 | Bacteria | 412779 |
| 268 | Ga0207689_10666123 | 3300025942 | Unclassified | 877 |
| 269 | Ga0207661_10000142 | 3300025944 | Bacteria | 45456 |
| 270 | Ga0207661_10001987 | 3300025944 | Bacteria | 14072 |
| 271 | Ga0207661_10003394 | 3300025944 | Bacteria | 11055 |
| 272 | Ga0207661_10035924 | 3300025944 | Bacteria | 3865 |
| 273 | Ga0207661_10142891 | 3300025944 | Bacteria | 2061 |
| 274 | Ga0207661_10499527 | 3300025944 | Bacteria | 1111 |
| 275 | Ga0207661_10935637 | 3300025944 | Bacteria | 798 |
| 276 | Ga0207679_10010691 | 3300025945 | Bacteria | 5918 |
| 277 | Ga0207667_10360611 | 3300025949 | Bacteria | 1482 |
| 278 | Ga0207667_10380532 | 3300025949 | Bacteria | 1438 |
| 279 | Ga0207651_10029595 | 3300025960 | Bacteria | 3472 |
| 280 | Ga0207712_10000033 | 3300025961 | Bacteria | 209336 |
| 281 | Ga0207712_10009331 | 3300025961 | Bacteria | 6208 |
| 282 | Ga0207712_11318127 | 3300025961 | Bacteria | 645 |
| 283 | Ga0207668_10099829 | 3300025972 | Bacteria | 2154 |
| 284 | Ga0207640_10000059 | 3300025981 | Bacteria | 90901 |
| 285 | Ga0207640_10001105 | 3300025981 | Bacteria | 14885 |
| 286 | Ga0207658_10001768 | 3300025986 | Bacteria | 16221 |
| 287 | Ga0207658_10117944 | 3300025986 | Bacteria | 2110 |
| 288 | Ga0207677_10004273 | 3300026023 | Bacteria | 7643 |
| 289 | Ga0207677_10039439 | 3300026023 | Bacteria | 3105 |
| 290 | Ga0207703_10000072 | 3300026035 | Bacteria | 120727 |
| 291 | Ga0207703_10000266 | 3300026035 | Bacteria | 58337 |
| 292 | Ga0207639_10003854 | 3300026041 | Bacteria | 10101 |
| 293 | Ga0207639_10773149 | 3300026041 | Bacteria | 894 |
| 294 | Ga0207639_11523494 | 3300026041 | Bacteria | 627 |
| 295 | Ga0207678_10074841 | 3300026067 | Bacteria | 2901 |
| 296 | Ga0207678_10334069 | 3300026067 | Bacteria | 1305 |
| 297 | Ga0207708_10100994 | 3300026075 | Bacteria | 2233 |
| 298 | Ga0207708_10183890 | 3300026075 | Bacteria | 1660 |
| 299 | Ga0207702_10000027 | 3300026078 | Bacteria | 183792 |
| 300 | Ga0207702_10007605 | 3300026078 | Bacteria | 9224 |
| 301 | Ga0207702_10014910 | 3300026078 | Bacteria | 6446 |
| 302 | Ga0207641_10000231 | 3300026088 | Bacteria | 72245 |
| 303 | Ga0207641_10002660 | 3300026088 | Bacteria | 16331 |
| 304 | Ga0207641_11890617 | 3300026088 | Bacteria | 598 |
| 305 | Ga0207648_10000230 | 3300026089 | Bacteria | 59713 |
| 306 | Ga0207676_10000043 | 3300026095 | Bacteria | 161948 |
| 307 | Ga0207674_10541945 | 3300026116 | Bacteria | 1124 |
| 308 | Ga0207674_12189789 | 3300026116 | Unclassified | 516 |
| 309 | Ga0207675_100546644 | 3300026118 | Unclassified | 1157 |
| 310 | Ga0207683_10010360 | 3300026121 | Bacteria | 7953 |
| 311 | Ga0207683_10121638 | 3300026121 | Bacteria | 2344 |
| 312 | Ga0207683_10421762 | 3300026121 | Unclassified | 1229 |
| 313 | Ga0207683_11479912 | 3300026121 | Bacteria | 627 |
| 314 | Ga0207698_10000002 | 3300026142 | Bacteria | 404991 |
| 315 | Ga0207698_10483913 | 3300026142 | Bacteria | 1201 |
| 316 | Ga0268266_10000076 | 3300028379 | Bacteria | 217644 |
| 317 | Ga0268266_10000664 | 3300028379 | Bacteria | 46506 |
| 318 | Ga0268266_10004334 | 3300028379 | Bacteria | 13637 |
| 319 | Ga0268266_10194892 | 3300028379 | Bacteria | 1851 |
| 320 | Ga0268266_10530272 | 3300028379 | Unclassified | 1126 |
| 321 | Ga0268265_10054427 | 3300028380 | Bacteria | 3036 |
| 322 | Ga0268264_10070092 | 3300028381 | Bacteria | 2967 |
| 323 | Ga0268264_10882427 | 3300028381 | Unclassified | 897 |
| 324 | Ga0265337_1000004 | 3300028556 | Bacteria | 106708 |
| 325 | Ga0265326_10000091 | 3300028558 | Bacteria | 47039 |
| 326 | Ga0265319_1000029 | 3300028563 | Bacteria | 131291 |
| 327 | Ga0265319_1053753 | 3300028563 | Bacteria | 1322 |
| 328 | Ga0265322_10000006 | 3300028654 | Bacteria | 231685 |
| 329 | Ga0265322_10200866 | 3300028654 | Bacteria | 571 |
| 330 | Ga0265336_10012904 | 3300028666 | Bacteria | 2798 |
| 331 | Ga0265336_10055192 | 3300028666 | Bacteria | 1195 |
| 332 | Ga0265338_10000179 | 3300028800 | Bacteria | 117995 |
| 333 | Ga0265338_10129959 | 3300028800 | Bacteria | 1991 |
| 334 | Ga0265324_10000185 | 3300029957 | Bacteria | 47817 |
| 335 | Ga0265324_10041275 | 3300029957 | Bacteria | 1597 |
| 336 | Ga0265332_10134902 | 3300031238 | Bacteria | 1035 |
| 337 | Ga0265328_10005073 | 3300031239 | Bacteria | 5671 |
| 338 | Ga0265320_10000001 | 3300031240 | Bacteria | 847191 |
| 339 | Ga0265325_10011215 | 3300031241 | Bacteria | 5154 |
| 340 | Ga0265329_10010765 | 3300031242 | Bacteria | 3346 |
| 341 | Ga0265339_10051548 | 3300031249 | Bacteria | 2245 |
| 342 | Ga0265331_10001249 | 3300031250 | Bacteria | 19056 |
| 343 | Ga0265327_10000003 | 3300031251 | Bacteria | 852750 |
| 344 | Ga0265316_10016212 | 3300031344 | Bacteria | 6472 |
| 345 | Ga0265313_10114404 | 3300031595 | Bacteria | 1183 |
| 346 | Ga0265313_10291529 | 3300031595 | Bacteria | 657 |
| 347 | Ga0316575_10290042 | 3300031665 | Bacteria | 691 |
| 348 | Ga0265314_10000535 | 3300031711 | Bacteria | 49105 |
| 349 | Ga0265342_10213099 | 3300031712 | Unclassified | 1044 |
| 350 | Ga0307416_100953691 | 3300032002 | Bacteria | 960 |
| 351 | Ga0307415_100180956 | 3300032126 | Bacteria | 1654 |
| 352 | Ga0316583_10123813 | 3300032133 | Bacteria | 901 |
| 353 | Ga0373956_0576642 | 3300035119 | Bacteria | 537 |
| 354 | Ga0373933_0065959 | 3300035724 | Bacteria | 2193 |
| 355 | Ga0373937_0041924 | 3300036401 | Bacteria | 4177 |
| 356 | Ga0451791_1480066 | 3300041451 | Bacteria | 650 |
| 357 | Ga0451800_0234848 | 3300041459 | Bacteria | 1253 |
| 358 | Ga0451800_0979465 | 3300041459 | Bacteria | 892 |
| 359 | Ga0451802_0624704 | 3300041460 | Bacteria | 561 |
| 360 | Ga0451807_1911921 | 3300041486 | Bacteria | 646 |
| 361 | Ga0451807_2679065 | 3300041486 | Bacteria | 790 |
| 362 | Ga0451835_0616804 | 3300041492 | Bacteria | 534 |
| 363 | Ga0451839_0881515 | 3300041496 | Bacteria | 599 |
| 364 | Ga0451845_0341957 | 3300041501 | Bacteria | 1222 |
| 365 | Ga0451853_0013456 | 3300041512 | Unclassified | 568 |
| 366 | Ga0451853_0215495 | 3300041512 | Bacteria | 562 |
| 367 | Ga0451853_0674116 | 3300041512 | Bacteria | 5453 |
| 368 | Ga0451853_2031101 | 3300041512 | Bacteria | 1408 |
| 369 | Ga0466965_0486456 | 3300044683 | Bacteria | 691 |
| 370 | Ga0466963_0000124 | 3300044694 | Bacteria | 28905 |
| 371 | Ga0466963_0010933 | 3300044694 | Bacteria | 5514 |
| 372 | Ga0466963_0028080 | 3300044694 | Bacteria | 3609 |
| 373 | Ga0466957_0008475 | 3300044842 | Bacteria | 5848 |
| 374 | Ga0466960_0582468 | 3300044901 | Bacteria | 663 |
| 375 | Ga0466958_0061588 | 3300045836 | Bacteria | 2286 |
| 376 | Ga0466967_0000008 | 3300045976 | Bacteria | 127135 |
| 377 | Ga0466967_0038536 | 3300045976 | Bacteria | 4100 |
| 378 | Ga0466967_0155107 | 3300045976 | Bacteria | 2144 |
| 379 | Ga0495592_0000521 | 3300046454 | Bacteria | 27805 |
| 380 | Ga0495592_0064755 | 3300046454 | Bacteria | 2678 |
| 381 | Ga0495592_0118314 | 3300046454 | Bacteria | 1867 |
| 382 | Ga0495592_0176354 | 3300046454 | Bacteria | 1459 |
| 383 | Ga0495592_0326099 | 3300046454 | Unclassified | 991 |
| 384 | Ga0495603_0000045 | 3300046455 | Bacteria | 53543 |
| 385 | Ga0495603_0000622 | 3300046455 | Bacteria | 19869 |
| 386 | Ga0495603_0004750 | 3300046455 | Bacteria | 8110 |
| 387 | Ga0495629_0001361 | 3300046459 | Bacteria | 19270 |
| 388 | Ga0495629_0001391 | 3300046459 | Bacteria | 19098 |
| 389 | Ga0495629_0150945 | 3300046459 | Bacteria | 1615 |
| 390 | Ga0495629_0158193 | 3300046459 | Bacteria | 1574 |
| 391 | Ga0495629_0361790 | 3300046459 | Bacteria | 989 |
| 392 | Ga0495638_0005536 | 3300046460 | Bacteria | 9366 |
| 393 | Ga0495641_0000001 | 3300046461 | Bacteria | 485224 |
| 394 | Ga0495641_0022741 | 3300046461 | Bacteria | 3131 |
| 395 | Ga0495641_0178994 | 3300046461 | Bacteria | 949 |
| 396 | Ga0495651_0991179 | 3300046462 | Unclassified | 510 |
| 397 | Ga0495653_0072155 | 3300046463 | Bacteria | 2579 |
| 398 | Ga0495653_0160018 | 3300046463 | Bacteria | 1564 |
| 399 | Ga0495653_0217667 | 3300046463 | Bacteria | 1286 |
| 400 | Ga0495653_0607979 | 3300046463 | Bacteria | 671 |
| 401 | Ga0495582_0000022 | 3300046473 | Bacteria | 83315 |
| 402 | Ga0495639_0030389 | 3300046475 | Bacteria | 2401 |
| 403 | Ga0495662_0000137 | 3300046476 | Bacteria | 28083 |
| 404 | Ga0495662_0009206 | 3300046476 | Bacteria | 4845 |
| 405 | Ga0495664_0117990 | 3300046477 | Bacteria | 1604 |
| 406 | Ga0495594_0000276 | 3300046499 | Bacteria | 25314 |
| 407 | Ga0495606_0000045 | 3300046507 | Bacteria | 212105 |
| 408 | Ga0495608_0100950 | 3300046511 | Bacteria | 1860 |
| 409 | Ga0495608_0287385 | 3300046511 | Bacteria | 1020 |
| 410 | Ga0495608_0919183 | 3300046511 | Bacteria | 511 |
| 411 | Ga0495610_0112349 | 3300046512 | Bacteria | 1205 |
| 412 | Ga0495618_0001468 | 3300046514 | Bacteria | 15801 |
| 413 | Ga0495618_0503988 | 3300046514 | Bacteria | 729 |
| 414 | Ga0495618_0858040 | 3300046514 | Bacteria | 526 |
| 415 | Ga0495618_0902817 | 3300046514 | Unclassified | 510 |
| 416 | Ga0495620_0001840 | 3300046515 | Bacteria | 12507 |
| 417 | Ga0495628_0000858 | 3300046516 | Bacteria | 28086 |
| 418 | Ga0495628_0026019 | 3300046516 | Bacteria | 4777 |
| 419 | Ga0495628_0061540 | 3300046516 | Bacteria | 2944 |
| 420 | Ga0495628_0064761 | 3300046516 | Bacteria | 2861 |
| 421 | Ga0495628_0201839 | 3300046516 | Bacteria | 1498 |
| 422 | Ga0495630_0000037 | 3300046517 | Bacteria | 114404 |
| 423 | Ga0495630_0020101 | 3300046517 | Bacteria | 4918 |
| 424 | Ga0495630_0070337 | 3300046517 | Bacteria | 2633 |
| 425 | Ga0495630_0558988 | 3300046517 | Bacteria | 877 |
| 426 | Ga0495630_0739763 | 3300046517 | Bacteria | 752 |
| 427 | Ga0495630_0873466 | 3300046517 | Bacteria | 685 |
| 428 | Ga0495637_0209606 | 3300046520 | Bacteria | 713 |
| 429 | Ga0495663_0209496 | 3300046525 | Unclassified | 682 |
| 430 | Ga0495652_0000086 | 3300046529 | Bacteria | 99373 |
| 431 | Ga0495652_0060323 | 3300046529 | Bacteria | 3206 |
| 432 | Ga0495640_0021952 | 3300046533 | Bacteria | 4675 |
| 433 | Ga0495640_0151885 | 3300046533 | Unclassified | 1488 |
| 434 | Ga0495586_0007201 | 3300046535 | Bacteria | 5933 |
| 435 | Ga0495586_0598951 | 3300046535 | Bacteria | 637 |
| 436 | Ga0495587_0001022 | 3300046536 | Bacteria | 18410 |
| 437 | Ga0495587_0054135 | 3300046536 | Bacteria | 2365 |
| 438 | Ga0495587_0356779 | 3300046536 | Bacteria | 814 |
| 439 | Ga0495587_0541880 | 3300046536 | Bacteria | 642 |
| 440 | Ga0495598_0003687 | 3300046537 | Bacteria | 3273 |
| 441 | Ga0495621_0011410 | 3300046539 | Bacteria | 2747 |
| 442 | Ga0495597_0211600 | 3300046542 | Bacteria | 773 |
| 443 | Ga0495645_0024357 | 3300046543 | Bacteria | 4391 |
| 444 | Ga0495645_0355832 | 3300046543 | Bacteria | 942 |
| 445 | Ga0495622_0000690 | 3300046557 | Bacteria | 19165 |
| 446 | Ga0495633_0006532 | 3300046558 | Bacteria | 6890 |
| 447 | Ga0495667_0000044 | 3300046559 | Bacteria | 121910 |
| 448 | Ga0495667_0098396 | 3300046559 | Unclassified | 1894 |
| 449 | Ga0495668_0107861 | 3300046616 | Bacteria | 1523 |
| 450 | Ga0495634_0001471 | 3300046642 | Bacteria | 20875 |
| 451 | Ga0495634_0004564 | 3300046642 | Bacteria | 10814 |
| 452 | Ga0495634_0068337 | 3300046642 | Bacteria | 2348 |
| 453 | Ga0495634_0090023 | 3300046642 | Bacteria | 1994 |
| 454 | Ga0495634_0141968 | 3300046642 | Bacteria | 1524 |
| 455 | Ga0495634_0449690 | 3300046642 | Unclassified | 760 |
| 456 | Ga0495625_0001659 | 3300046660 | Bacteria | 26100 |
| 457 | Ga0495635_0000063 | 3300046663 | Bacteria | 65304 |
| 458 | Ga0495635_0042554 | 3300046663 | Bacteria | 3136 |
| 459 | Ga0495635_0067371 | 3300046663 | Bacteria | 2456 |
| 460 | Ga0495635_0242685 | 3300046663 | Unclassified | 1215 |
| 461 | Ga0495588_0000179 | 3300046674 | Bacteria | 77030 |
| 462 | Ga0495657_0014113 | 3300046675 | Bacteria | 5871 |
| 463 | Ga0495599_0006457 | 3300046678 | Bacteria | 7074 |
| 464 | Ga0495599_0119765 | 3300046678 | Bacteria | 1637 |
| 465 | Ga0495599_0133382 | 3300046678 | Bacteria | 1542 |
| 466 | Ga0495646_0421904 | 3300046680 | Unclassified | 691 |
| 467 | Ga0495647_0003248 | 3300046681 | Bacteria | 5203 |
| 468 | Ga0495647_0008323 | 3300046681 | Bacteria | 3485 |
| 469 | Ga0495647_0172528 | 3300046681 | Bacteria | 937 |
| 470 | Ga0495647_0307576 | 3300046681 | Bacteria | 715 |
| 471 | Ga0495647_0477971 | 3300046681 | Unclassified | 578 |
| 472 | Ga0495647_0631895 | 3300046681 | Bacteria | 504 |
| 473 | Ga0495658_0000008 | 3300046683 | Bacteria | 115426 |
| 474 | Ga0495658_0098296 | 3300046683 | Bacteria | 1743 |
| 475 | Ga0495669_0000651 | 3300046684 | Bacteria | 15129 |
| 476 | Ga0495669_0015561 | 3300046684 | Bacteria | 3258 |
| 477 | Ga0495613_0000298 | 3300046689 | Bacteria | 44864 |
| 478 | Ga0495613_0000369 | 3300046689 | Bacteria | 39198 |
| 479 | Ga0495613_0481736 | 3300046689 | Bacteria | 837 |
| 480 | Ga0495624_0002296 | 3300046690 | Bacteria | 14562 |
| 481 | Ga0495624_0251287 | 3300046690 | Unclassified | 1069 |
| 482 | Ga0495670_0007059 | 3300046691 | Bacteria | 5530 |
| 483 | Ga0495600_0035731 | 3300046809 | Bacteria | 3229 |
| 484 | Ga0495600_0097188 | 3300046809 | Unclassified | 1920 |
| 485 | Ga0495600_0119424 | 3300046809 | Bacteria | 1715 |
| 486 | Ga0495600_0147749 | 3300046809 | Bacteria | 1523 |
| 487 | Ga0495600_0358097 | 3300046809 | Bacteria | 913 |
| 488 | Ga0495600_0401893 | 3300046809 | Bacteria | 852 |
| 489 | Ga0495604_0000850 | 3300047317 | Bacteria | 25489 |
| 490 | Ga0495604_0050587 | 3300047317 | Bacteria | 3226 |
| 491 | Ga0495604_0235900 | 3300047317 | Unclassified | 1253 |
| 492 | Ga0495604_0974513 | 3300047317 | Bacteria | 526 |
| 493 | Ga0495674_1180442 | 3300047319 | Bacteria | 579 |
| 494 | Ga0495672_0083207 | 3300047320 | Bacteria | 1778 |
| 495 | Ga0495676_0000652 | 3300047321 | Bacteria | 28858 |
| 496 | Ga0495676_0007512 | 3300047321 | Bacteria | 9996 |
| 497 | Ga0495676_0131933 | 3300047321 | Bacteria | 1802 |
| 498 | Ga0495676_0388046 | 3300047321 | Bacteria | 928 |
| 499 | Ga0495676_0636780 | 3300047321 | Bacteria | 693 |
| 500 | Ga0495680_0000215 | 3300047322 | Bacteria | 63049 |
| 501 | Ga0495680_0002422 | 3300047322 | Bacteria | 19086 |
| 502 | Ga0495680_0036038 | 3300047322 | Bacteria | 3977 |
| 503 | Ga0495680_0059144 | 3300047322 | Bacteria | 2960 |
| 504 | Ga0495680_0635733 | 3300047322 | Bacteria | 711 |
| 505 | Ga0495675_0015728 | 3300047444 | Bacteria | 4784 |
| 506 | Ga0495679_009212 | 3300047446 | Bacteria | 3966 |
| 507 | Ga0495685_017740 | 3300047447 | Bacteria | 2439 |
| 508 | Ga0495684_0828614 | 3300047471 | Bacteria | 602 |
| 509 | Ga0495593_0010922 | 3300047673 | Bacteria | 5230 |
| 510 | Ga0495593_0302308 | 3300047673 | Bacteria | 800 |
| 511 | Ga0495593_0560629 | 3300047673 | Bacteria | 573 |
| 512 | Ga0495602_0000010 | 3300048088 | Bacteria | 212121 |
| 513 | Ga0495602_0000188 | 3300048088 | Bacteria | 58305 |
| 514 | Ga0495602_0163145 | 3300048088 | Bacteria | 1738 |
| 515 | Ga0495602_0411448 | 3300048088 | Bacteria | 962 |
| 516 | Ga0495602_0466744 | 3300048088 | Unclassified | 888 |
| 517 | Ga0496100_0000003 | 3300048903 | Bacteria | 360802 |
| 518 | Ga0496100_0000063 | 3300048903 | Bacteria | 60957 |
| 519 | Ga0496101_0000003 | 3300048904 | Bacteria | 406565 |
| 520 | Ga0496101_0000012 | 3300048904 | Bacteria | 268127 |
| 521 | Ga0496101_0932423 | 3300048904 | Bacteria | 683 |
| 522 | Ga0496102_0000965 | 3300048905 | Bacteria | 27059 |
| 523 | Ga0496102_0041849 | 3300048905 | Bacteria | 4150 |
| 524 | Ga0496102_1353218 | 3300048905 | Bacteria | 631 |
| 525 | Ga0496103_0000627 | 3300048906 | Bacteria | 27075 |
| 526 | Ga0496103_0012939 | 3300048906 | Bacteria | 4950 |
| 527 | Ga0496103_0042724 | 3300048906 | Bacteria | 2790 |
| 528 | Ga0496104_0000002 | 3300048907 | Bacteria | 686017 |
| 529 | Ga0496104_0000666 | 3300048907 | Bacteria | 29447 |
| 530 | Ga0496104_0264888 | 3300048907 | Bacteria | 1631 |
| 531 | Ga0496104_1644383 | 3300048907 | Bacteria | 545 |
| 532 | Ga0496105_0000001 | 3300048908 | Bacteria | 1328178 |
| 533 | Ga0496105_0004549 | 3300048908 | Bacteria | 10446 |
| 534 | Ga0496105_0022756 | 3300048908 | Bacteria | 5078 |
| 535 | Ga0496105_0454399 | 3300048908 | Bacteria | 1011 |
| 536 | Ga0496106_0000015 | 3300048909 | Bacteria | 187570 |
| 537 | Ga0496106_0000020 | 3300048909 | Bacteria | 169168 |
| 538 | Ga0496106_0000160 | 3300048909 | Bacteria | 48936 |
| 539 | Ga0496107_0000008 | 3300048910 | Bacteria | 251874 |
| 540 | Ga0496107_0000014 | 3300048910 | Bacteria | 176738 |
| 541 | Ga0496108_0000002 | 3300048911 | Bacteria | 700890 |
| 542 | Ga0496108_0001295 | 3300048911 | Bacteria | 19647 |
| 543 | Ga0496108_0001400 | 3300048911 | Bacteria | 18998 |
| 544 | Ga0496108_0010707 | 3300048911 | Bacteria | 7442 |
| 545 | Ga0496108_1748952 | 3300048911 | Bacteria | 510 |
| 546 | Ga0496109_0000001 | 3300048912 | Bacteria | 700852 |
| 547 | Ga0496109_0000035 | 3300048912 | Bacteria | 159744 |
| 548 | Ga0496109_0000246 | 3300048912 | Bacteria | 52127 |
| 549 | Ga0496109_0000888 | 3300048912 | Bacteria | 25009 |
| 550 | Ga0496109_0042252 | 3300048912 | Bacteria | 4129 |
| 551 | Ga0496109_0662593 | 3300048912 | Bacteria | 981 |
| 552 | Ga0496109_1290188 | 3300048912 | Bacteria | 666 |
| 553 | Ga0496110_0002971 | 3300048913 | Bacteria | 12859 |
| 554 | Ga0496110_0018894 | 3300048913 | Bacteria | 5791 |
| 555 | Ga0496110_0143574 | 3300048913 | Bacteria | 2158 |
| 556 | Ga0496110_0233155 | 3300048913 | Bacteria | 1674 |
| 557 | Ga0496110_1128874 | 3300048913 | Bacteria | 692 |
| 558 | Ga0496110_1902771 | 3300048913 | Bacteria | 505 |
| 559 | Ga0496111_0000022 | 3300048914 | Bacteria | 66777 |
| 560 | Ga0496111_0009354 | 3300048914 | Bacteria | 6535 |
| 561 | Ga0496111_0031644 | 3300048914 | Bacteria | 3770 |
| 562 | Ga0496111_0140500 | 3300048914 | Bacteria | 1789 |
| 563 | Ga0496111_0281843 | 3300048914 | Bacteria | 1233 |
| 564 | Ga0496112_0000003 | 3300048915 | Bacteria | 660147 |
| 565 | Ga0496112_0006530 | 3300048915 | Bacteria | 10256 |
| 566 | Ga0496112_0103593 | 3300048915 | Bacteria | 2816 |
| 567 | Ga0496112_0429113 | 3300048915 | Bacteria | 1260 |
| 568 | Ga0496112_1270242 | 3300048915 | Bacteria | 652 |
| 569 | Ga0496113_0000093 | 3300048916 | Bacteria | 38914 |
| 570 | Ga0496113_0017949 | 3300048916 | Bacteria | 4920 |
| 571 | Ga0496113_0058250 | 3300048916 | Bacteria | 2906 |
| 572 | Ga0496113_0067331 | 3300048916 | Unclassified | 2715 |
| 573 | Ga0496113_0083986 | 3300048916 | Bacteria | 2444 |
| 574 | Ga0496113_0157168 | 3300048916 | Bacteria | 1796 |
| 575 | Ga0496113_0807510 | 3300048916 | Bacteria | 745 |
| 576 | Ga0496114_0000010 | 3300048917 | Bacteria | 363396 |
| 577 | Ga0496114_0030582 | 3300048917 | Bacteria | 4431 |
| 578 | Ga0496114_0287108 | 3300048917 | Bacteria | 1451 |
| 579 | Ga0496114_0589689 | 3300048917 | Bacteria | 980 |
| 580 | Ga0496114_1091197 | 3300048917 | Unclassified | 683 |
| 581 | Ga0496115_0000004 | 3300048918 | Bacteria | 319734 |
| 582 | Ga0496115_0019408 | 3300048918 | Bacteria | 5230 |
| 583 | Ga0496115_0239479 | 3300048918 | Bacteria | 1495 |
| 584 | Ga0496116_0000014 | 3300048919 | Bacteria | 569049 |
| 585 | Ga0496117_0003519 | 3300048920 | Bacteria | 18132 |
| 586 | Ga0496117_0200471 | 3300048920 | Bacteria | 1128 |
| 587 | Ga0496117_0389083 | 3300048920 | Unclassified | 707 |
| 588 | Ga0496118_0002996 | 3300048921 | Bacteria | 21807 |
| 589 | Ga0496118_0244582 | 3300048921 | Bacteria | 1024 |
| 590 | Ga0496118_0325901 | 3300048921 | Unclassified | 831 |
| 591 | Ga0496118_0629171 | 3300048921 | Bacteria | 508 |
| 592 | Ga0496119_0019537 | 3300048922 | Bacteria | 4985 |
| 593 | Ga0496119_0083811 | 3300048922 | Bacteria | 1829 |
| 594 | Ga0496119_0125950 | 3300048922 | Bacteria | 1401 |
| 595 | Ga0496119_0281096 | 3300048922 | Bacteria | 827 |
| 596 | Ga0496120_0009355 | 3300048923 | Bacteria | 6964 |
| 597 | Ga0496120_0049030 | 3300048923 | Bacteria | 2426 |
| 598 | Ga0496121_0215119 | 3300048924 | Bacteria | 1358 |
| 599 | Ga0496121_0368833 | 3300048924 | Unclassified | 950 |
| 600 | Ga0496124_0279512 | 3300048927 | Bacteria | 1218 |
| 601 | Ga0496125_0039010 | 3300048928 | Bacteria | 4099 |
| 602 | Ga0496125_0047605 | 3300048928 | Bacteria | 3583 |
| 603 | Ga0496126_0018873 | 3300048929 | Bacteria | 6814 |
| 604 | Ga0496126_0601407 | 3300048929 | Bacteria | 866 |
| 605 | Ga0496126_0859192 | 3300048929 | Bacteria | 691 |
| 606 | Ga0495678_166368 | 3300049459 | Bacteria | 701 |
| 607 | Ga0501032_0319805 | 3300049569 | Bacteria | 1002 |
| 608 | Ga0501034_0228395 | 3300049571 | Bacteria | 1811 |
| 609 | Ga0501036_0733159 | 3300049572 | Unclassified | 816 |
| 610 | Ga0501038_1139173 | 3300049574 | Unclassified | 568 |
| 611 | Ga0501039_0434263 | 3300049575 | Unclassified | 1031 |
| 612 | Ga0501040_0430317 | 3300049576 | Bacteria | 949 |
| 613 | Ga0501040_1331422 | 3300049576 | Bacteria | 521 |
| 614 | Ga0501041_0805023 | 3300049577 | Bacteria | 603 |
| 615 | Ga0501042_0012267 | 3300049578 | Bacteria | 5800 |
| 616 | Ga0501042_0271107 | 3300049578 | Bacteria | 1225 |
| 617 | Ga0501042_0442095 | 3300049578 | Bacteria | 943 |
| 618 | Ga0501043_0316082 | 3300049579 | Bacteria | 1191 |
| 619 | Ga0501047_0006224 | 3300049581 | Bacteria | 11220 |
| 620 | Ga0501047_0838454 | 3300049581 | Bacteria | 733 |
| 621 | Ga0501047_1230257 | 3300049581 | Bacteria | 562 |
| 622 | Ga0501048_0190513 | 3300049582 | Bacteria | 1453 |
| 623 | Ga0501067_0286369 | 3300049583 | Bacteria | 917 |
| 624 | Ga0501068_0132544 | 3300049584 | Bacteria | 1559 |
| 625 | Ga0501069_0842684 | 3300049585 | Bacteria | 556 |
| 626 | Ga0501070_0016424 | 3300049586 | Bacteria | 6220 |
| 627 | Ga0501070_0082163 | 3300049586 | Bacteria | 2666 |
| 628 | Ga0501070_0420345 | 3300049586 | Bacteria | 1080 |
| 629 | Ga0501071_0088414 | 3300049587 | Bacteria | 2273 |
| 630 | Ga0501072_0104844 | 3300049588 | Bacteria | 2248 |
| 631 | Ga0501072_0147757 | 3300049588 | Bacteria | 1874 |
| 632 | Ga0501073_0166437 | 3300049589 | Bacteria | 1527 |
| 633 | Ga0501076_0046430 | 3300049592 | Bacteria | 3432 |
| 634 | Ga0501076_1623212 | 3300049592 | Bacteria | 530 |
| 635 | Ga0501079_0031923 | 3300049741 | Bacteria | 4047 |
| 636 | Ga0501079_0390869 | 3300049741 | Bacteria | 1091 |
| 637 | Ga0501080_0071013 | 3300049742 | Bacteria | 3238 |
| 638 | Ga0501081_0381156 | 3300049743 | Bacteria | 1042 |
| 639 | Ga0501081_1414562 | 3300049743 | Bacteria | 528 |
| 640 | Ga0501083_0031277 | 3300049744 | Bacteria | 3653 |
| 641 | Ga0501083_0533817 | 3300049744 | Bacteria | 763 |
| 642 | Ga0501044_0164207 | 3300049823 | Bacteria | 2195 |
| 643 | Ga0501044_0610442 | 3300049823 | Bacteria | 983 |
| 644 | Ga0501045_1411418 | 3300049824 | Unclassified | 506 |
| 645 | nmdc:mga0yw44_647867_c1 | 3300050492 | Bacteria | 718 |
| 646 | nmdc:mga05p37_1603939_c1 | 3300050507 | Bacteria | 641 |
| 647 | nmdc:mga0qj67_67177_c1 | 3300050509 | Bacteria | 2856 |
| 648 | nmdc:mga0rr50_462661_c1 | 3300050513 | Bacteria | 1076 |
| 649 | nmdc:mga0a205_155_c1 | 3300050515 | Bacteria | 44726 |
| 650 | nmdc:mga0a205_9_c2 | 3300050515 | Bacteria | 69167 |
| 651 | Ga0495601_0000012 | 3300053077 | Bacteria | 227853 |
| 652 | Ga0495601_0000169 | 3300053077 | Bacteria | 35095 |
| 653 | Ga0495601_0012989 | 3300053077 | Bacteria | 5002 |
| 654 | Ga0495601_0023415 | 3300053077 | Bacteria | 3794 |
| 655 | Ga0495601_0103639 | 3300053077 | Bacteria | 1839 |
| 656 | Ga0495601_0397119 | 3300053077 | Bacteria | 894 |
| 657 | Ga0495612_0001003 | 3300053078 | Bacteria | 11610 |
| 658 | Ga0495612_0017880 | 3300053078 | Bacteria | 2837 |
| 659 | Ga0495612_0039082 | 3300053078 | Bacteria | 1929 |
| 660 | Ga0495612_0076366 | 3300053078 | Bacteria | 1403 |
| 661 | Ga0495655_0000003 | 3300053083 | Bacteria | 303053 |
| 662 | Ga0495595_0001241 | 3300053084 | Bacteria | 9932 |
| 663 | Ga0495595_0375146 | 3300053084 | Unclassified | 719 |
| 664 | Ga0495619_0000018 | 3300053085 | Bacteria | 209943 |
| 665 | Ga0495619_0000408 | 3300053085 | Bacteria | 29246 |
| 666 | Ga0495619_0000758 | 3300053085 | Bacteria | 21054 |
| 667 | Ga0495619_0007151 | 3300053085 | Bacteria | 7068 |
| 668 | Ga0495619_0011996 | 3300053085 | Bacteria | 5459 |
| 669 | Ga0495619_0040276 | 3300053085 | Bacteria | 3054 |
| 670 | Ga0495619_0070764 | 3300053085 | Bacteria | 2333 |
| 671 | Ga0495619_0346693 | 3300053085 | Bacteria | 1027 |
| 672 | Ga0500595_044499 | 3300053119 | Bacteria | 1406 |
| 673 | Ga0500595_059425 | 3300053119 | Bacteria | 1159 |
| 674 | Ga0500614_000374 | 3300053123 | Bacteria | 11670 |
| 675 | Ga0500628_000002 | 3300053129 | Bacteria | 357687 |
| 676 | Ga0500568_0077023 | 3300053139 | Bacteria | 1269 |
| 677 | Ga0501084_0572153 | 3300054114 | Bacteria | 955 |
| 678 | Ga0501082_0308157 | 3300060353 | Bacteria | 1379 |
| 679 | Ga0501082_0841855 | 3300060353 | Bacteria | 802 |
| 680 | Ga0530510_1028374 | 3300061734 | Unclassified | 631 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005353 | Ga0070669_100486485 | Ga0070669_1004864852 | 69 |
| 2 | 3300005356 | Ga0070674_100000011 | Ga0070674_1000000114 | 69 |
| 3 | 3300005456 | Ga0070678_100355966 | Ga0070678_1003559662 | 69 |
| 4 | 3300005547 | Ga0070693_100815604 | Ga0070693_1008156041 | 69 |
| 5 | 3300005718 | Ga0068866_10000002 | Ga0068866_1000000252 | 69 |
| 6 | 3300005841 | Ga0068863_100000042 | Ga0068863_10000004243 | 69 |
| 7 | 3300005842 | Ga0068858_100000086 | Ga0068858_10000008613 | 69 |
| 8 | 3300005843 | Ga0068860_100010275 | Ga0068860_1000102753 | 69 |
| 9 | 3300005983 | Ga0081540_1021526 | Ga0081540_10215264 | 69 |
| 10 | 3300006163 | Ga0070715_10000015 | Ga0070715_10000015115 | 69 |
| 11 | 3300006173 | Ga0070716_100681297 | Ga0070716_1006812972 | 69 |
| 12 | 3300009098 | Ga0105245_10000053 | Ga0105245_10000053115 | 69 |
| 13 | 3300009176 | Ga0105242_10250629 | Ga0105242_102506292 | 69 |
| 14 | 3300009551 | Ga0105238_10000299 | Ga0105238_1000029924 | 69 |
| 15 | 3300010375 | Ga0105239_10659490 | Ga0105239_106594903 | 69 |
| 16 | 3300010375 | Ga0105239_10889786 | Ga0105239_108897862 | 69 |
| 17 | 3300014326 | Ga0157380_10000080 | Ga0157380_1000008016 | 69 |
| 18 | 3300025899 | Ga0207642_10000001 | Ga0207642_10000001556 | 69 |
| 19 | 3300025899 | Ga0207642_10000003 | Ga0207642_10000003556 | 69 |
| 20 | 3300025905 | Ga0207685_10000001 | Ga0207685_10000001311 | 69 |
| 21 | 3300025923 | Ga0207681_10360413 | Ga0207681_103604132 | 69 |
| 22 | 3300025924 | Ga0207694_10000035 | Ga0207694_10000035159 | 69 |
| 23 | 3300025927 | Ga0207687_10000021 | Ga0207687_10000021154 | 69 |
| 24 | 3300025934 | Ga0207686_10070529 | Ga0207686_100705293 | 69 |
| 25 | 3300025937 | Ga0207669_10000027 | Ga0207669_100000274 | 69 |
| 26 | 3300025939 | Ga0207665_11229300 | Ga0207665_112293002 | 69 |
| 27 | 3300026035 | Ga0207703_10000072 | Ga0207703_1000007283 | 69 |
| 28 | 3300026088 | Ga0207641_10000231 | Ga0207641_1000023143 | 69 |
| 29 | 3300026121 | Ga0207683_10121638 | Ga0207683_101216384 | 69 |
| 30 | 3300026121 | Ga0207683_11479912 | Ga0207683_114799122 | 69 |
| 31 | 3300046454 | Ga0495592_0000521 | Ga0495592_0000521_14747_14959 | 69 |
| 32 | 3300046455 | Ga0495603_0004750 | Ga0495603_0004750_7275_7484 | 69 |
| 33 | 3300046459 | Ga0495629_0150945 | Ga0495629_0150945_705_914 | 69 |
| 34 | 3300046463 | Ga0495653_0217667 | Ga0495653_0217667_187_399 | 69 |
| 35 | 3300046463 | Ga0495653_0607979 | Ga0495653_0607979_302_511 | 69 |
| 36 | 3300046511 | Ga0495608_0100950 | Ga0495608_0100950_159_368 | 69 |
| 37 | 3300046514 | Ga0495618_0503988 | Ga0495618_0503988_90_299 | 69 |
| 38 | 3300046516 | Ga0495628_0201839 | Ga0495628_0201839_849_1058 | 69 |
| 39 | 3300046533 | Ga0495640_0151885 | Ga0495640_0151885_544_753 | 69 |
| 40 | 3300046536 | Ga0495587_0356779 | Ga0495587_0356779_412_621 | 69 |
| 41 | 3300046559 | Ga0495667_0098396 | Ga0495667_0098396_506_715 | 69 |
| 42 | 3300046642 | Ga0495634_0001471 | Ga0495634_0001471_18891_19100 | 69 |
| 43 | 3300046675 | Ga0495657_0014113 | Ga0495657_0014113_2714_2926 | 69 |
| 44 | 3300046681 | Ga0495647_0477971 | Ga0495647_0477971_13_222 | 69 |
| 45 | 3300046689 | Ga0495613_0000369 | Ga0495613_0000369_35974_36186 | 69 |
| 46 | 3300046809 | Ga0495600_0401893 | Ga0495600_0401893_44_253 | 69 |
| 47 | 3300048907 | Ga0496104_0000666 | Ga0496104_0000666_66_275 | 69 |
| 48 | 3300048908 | Ga0496105_0004549 | Ga0496105_0004549_3233_3442 | 69 |
| 49 | 3300048909 | Ga0496106_0000160 | Ga0496106_0000160_22685_22894 | 69 |
| 50 | 3300048911 | Ga0496108_0000002 | Ga0496108_0000002_68543_68752 | 69 |
| 51 | 3300048912 | Ga0496109_0000001 | Ga0496109_0000001_68505_68714 | 69 |
| 52 | 3300048928 | Ga0496125_0047605 | Ga0496125_0047605_1902_2111 | 69 |
| 53 | 3300049743 | Ga0501081_0381156 | Ga0501081_0381156_430_639 | 69 |
| 54 | 3300005329 | Ga0070683_100271872 | Ga0070683_1002718721 | 71 |
| 55 | 3300005337 | Ga0070682_100000815 | Ga0070682_1000008158 | 71 |
| 56 | 3300005338 | Ga0068868_100004232 | Ga0068868_10000423212 | 71 |
| 57 | 3300005344 | Ga0070661_100000161 | Ga0070661_1000001619 | 71 |
| 58 | 3300005347 | Ga0070668_100295683 | Ga0070668_1002956833 | 71 |
| 59 | 3300005364 | Ga0070673_100365643 | Ga0070673_1003656433 | 71 |
| 60 | 3300005365 | Ga0070688_100000453 | Ga0070688_10000045320 | 71 |
| 61 | 3300005441 | Ga0070700_100450694 | Ga0070700_1004506943 | 71 |
| 62 | 3300005564 | Ga0070664_100093697 | Ga0070664_1000936972 | 71 |
| 63 | 3300005578 | Ga0068854_100000115 | Ga0068854_10000011547 | 71 |
| 64 | 3300005834 | Ga0068851_10001867 | Ga0068851_100018677 | 71 |
| 65 | 3300005840 | Ga0068870_10115813 | Ga0068870_101158133 | 71 |
| 66 | 3300006163 | Ga0070715_10085070 | Ga0070715_100850702 | 71 |
| 67 | 3300006163 | Ga0070715_10208143 | Ga0070715_102081432 | 71 |
| 68 | 3300009098 | Ga0105245_10002749 | Ga0105245_1000274917 | 71 |
| 69 | 3300009148 | Ga0105243_10004998 | Ga0105243_100049989 | 71 |
| 70 | 3300009174 | Ga0105241_10590912 | Ga0105241_105909123 | 71 |
| 71 | 3300010375 | Ga0105239_10050654 | Ga0105239_100506548 | 71 |
| 72 | 3300013306 | Ga0163162_10078269 | Ga0163162_100782694 | 71 |
| 73 | 3300013307 | Ga0157372_10000616 | Ga0157372_1000061617 | 71 |
| 74 | 3300013308 | Ga0157375_10008882 | Ga0157375_100088825 | 71 |
| 75 | 3300013308 | Ga0157375_11956333 | Ga0157375_119563332 | 71 |
| 76 | 3300017792 | Ga0163161_10009328 | Ga0163161_100093284 | 71 |
| 77 | 3300020081 | Ga0206354_11092466 | Ga0206354_110924663 | 71 |
| 78 | 3300020082 | Ga0206353_11601057 | Ga0206353_116010573 | 71 |
| 79 | 3300025321 | Ga0207656_10000354 | Ga0207656_1000035413 | 71 |
| 80 | 3300025908 | Ga0207643_10134307 | Ga0207643_101343073 | 71 |
| 81 | 3300025909 | Ga0207705_10974544 | Ga0207705_109745442 | 71 |
| 82 | 3300025911 | Ga0207654_10270279 | Ga0207654_102702793 | 71 |
| 83 | 3300025920 | Ga0207649_10000024 | Ga0207649_1000002455 | 71 |
| 84 | 3300025927 | Ga0207687_10000350 | Ga0207687_1000035019 | 71 |
| 85 | 3300025935 | Ga0207709_10390025 | Ga0207709_103900252 | 71 |
| 86 | 3300025944 | Ga0207661_10035924 | Ga0207661_100359244 | 71 |
| 87 | 3300025945 | Ga0207679_10010691 | Ga0207679_100106917 | 71 |
| 88 | 3300025972 | Ga0207668_10099829 | Ga0207668_100998293 | 71 |
| 89 | 3300025981 | Ga0207640_10000059 | Ga0207640_1000005943 | 71 |
| 90 | 3300026023 | Ga0207677_10004273 | Ga0207677_100042733 | 71 |
| 91 | 3300026067 | Ga0207678_10334069 | Ga0207678_103340693 | 71 |
| 92 | 3300026075 | Ga0207708_10183890 | Ga0207708_101838901 | 71 |
| 93 | 3300041460 | Ga0451802_0624704 | Ga0451802_0624704_57_272 | 71 |
| 94 | 3300041486 | Ga0451807_1911921 | Ga0451807_1911921_74_289 | 71 |
| 95 | 3300041496 | Ga0451839_0881515 | Ga0451839_0881515_251_466 | 71 |
| 96 | 3300041501 | Ga0451845_0341957 | Ga0451845_0341957_573_788 | 71 |
| 97 | 3300041512 | Ga0451853_2031101 | Ga0451853_2031101_422_637 | 71 |
| 98 | 3300048913 | Ga0496110_0002971 | Ga0496110_0002971_5140_5355 | 71 |
| 99 | 3300048914 | Ga0496111_0000022 | Ga0496111_0000022_10555_10770 | 71 |
| 100 | 3300048915 | Ga0496112_0006530 | Ga0496112_0006530_5185_5400 | 71 |
| 101 | 3300048916 | Ga0496113_0000093 | Ga0496113_0000093_21558_21773 | 71 |
| 102 | 3300049578 | Ga0501042_0271107 | Ga0501042_0271107_189_404 | 71 |
| 103 | 3300053085 | Ga0495619_0000018 | Ga0495619_0000018_150499_150714 | 71 |
| 104 | 3300005331 | Ga0070670_100129379 | Ga0070670_1001293791 | 72 |
| 105 | 3300005366 | Ga0070659_100009701 | Ga0070659_1000097014 | 72 |
| 106 | 3300005436 | Ga0070713_100000076 | Ga0070713_10000007635 | 72 |
| 107 | 3300009176 | Ga0105242_10238304 | Ga0105242_102383044 | 72 |
| 108 | 3300013100 | Ga0157373_10496552 | Ga0157373_104965522 | 72 |
| 109 | 3300025928 | Ga0207700_10000009 | Ga0207700_10000009218 | 72 |
| 110 | 3300025932 | Ga0207690_10006983 | Ga0207690_100069833 | 72 |
| 111 | 3300025934 | Ga0207686_11086241 | Ga0207686_110862411 | 72 |
| 112 | 3300041512 | Ga0451853_0215495 | Ga0451853_0215495_57_275 | 72 |
| 113 | 3300044694 | Ga0466963_0010933 | Ga0466963_0010933_1821_2039 | 72 |
| 114 | 3300044694 | Ga0466963_0028080 | Ga0466963_0028080_1386_1604 | 72 |
| 115 | 3300045976 | Ga0466967_0155107 | Ga0466967_0155107_1088_1306 | 72 |
| 116 | 3300046461 | Ga0495641_0022741 | Ga0495641_0022741_435_653 | 72 |
| 117 | 3300046674 | Ga0495588_0000179 | Ga0495588_0000179_2540_2758 | 72 |
| 118 | 3300046689 | Ga0495613_0000298 | Ga0495613_0000298_44556_44774 | 72 |
| 119 | 3300046809 | Ga0495600_0097188 | Ga0495600_0097188_894_1112 | 72 |
| 120 | 3300046809 | Ga0495600_0147749 | Ga0495600_0147749_121_339 | 72 |
| 121 | 3300047317 | Ga0495604_0000850 | Ga0495604_0000850_19281_19499 | 72 |
| 122 | 3300047319 | Ga0495674_1180442 | Ga0495674_1180442_284_502 | 72 |
| 123 | 3300047321 | Ga0495676_0388046 | Ga0495676_0388046_345_566 | 72 |
| 124 | 3300048088 | Ga0495602_0000010 | Ga0495602_0000010_187451_187669 | 72 |
| 125 | 3300048907 | Ga0496104_0264888 | Ga0496104_0264888_1261_1479 | 72 |
| 126 | 3300048912 | Ga0496109_0662593 | Ga0496109_0662593_554_772 | 72 |
| 127 | 3300048916 | Ga0496113_0067331 | Ga0496113_0067331_285_503 | 72 |
| 128 | 3300053077 | Ga0495601_0000012 | Ga0495601_0000012_185731_185949 | 72 |
| 129 | 3300053084 | Ga0495595_0001241 | Ga0495595_0001241_4602_4820 | 72 |
| 130 | 3300001979 | JGI24740J21852_10005676 | JGI24740J21852_100056767 | 73 |
| 131 | 3300003659 | JGI25404J52841_10017023 | JGI25404J52841_100170231 | 73 |
| 132 | 3300005329 | Ga0070683_100002929 | Ga0070683_10000292913 | 73 |
| 133 | 3300005329 | Ga0070683_101206817 | Ga0070683_1012068172 | 73 |
| 134 | 3300005331 | Ga0070670_101590203 | Ga0070670_1015902031 | 73 |
| 135 | 3300005335 | Ga0070666_10010127 | Ga0070666_100101276 | 73 |
| 136 | 3300005335 | Ga0070666_10023706 | Ga0070666_100237062 | 73 |
| 137 | 3300005341 | Ga0070691_10000069 | Ga0070691_1000006913 | 73 |
| 138 | 3300005347 | Ga0070668_100018528 | Ga0070668_1000185288 | 73 |
| 139 | 3300005353 | Ga0070669_101134422 | Ga0070669_1011344222 | 73 |
| 140 | 3300005354 | Ga0070675_100000153 | Ga0070675_10000015323 | 73 |
| 141 | 3300005355 | Ga0070671_100738930 | Ga0070671_1007389302 | 73 |
| 142 | 3300005367 | Ga0070667_100001368 | Ga0070667_1000013689 | 73 |
| 143 | 3300005367 | Ga0070667_100102281 | Ga0070667_1001022814 | 73 |
| 144 | 3300005435 | Ga0070714_100008340 | Ga0070714_1000083402 | 73 |
| 145 | 3300005437 | Ga0070710_10770198 | Ga0070710_107701982 | 73 |
| 146 | 3300005455 | Ga0070663_100012594 | Ga0070663_1000125943 | 73 |
| 147 | 3300005458 | Ga0070681_10463432 | Ga0070681_104634323 | 73 |
| 148 | 3300005466 | Ga0070685_10000203 | Ga0070685_1000020324 | 73 |
| 149 | 3300005530 | Ga0070679_100114971 | Ga0070679_1001149713 | 73 |
| 150 | 3300005535 | Ga0070684_100033478 | Ga0070684_1000334784 | 73 |
| 151 | 3300005535 | Ga0070684_100061999 | Ga0070684_1000619992 | 73 |
| 152 | 3300005535 | Ga0070684_100541613 | Ga0070684_1005416133 | 73 |
| 153 | 3300005539 | Ga0068853_100810114 | Ga0068853_1008101141 | 73 |
| 154 | 3300005544 | Ga0070686_101552802 | Ga0070686_1015528021 | 73 |
| 155 | 3300005545 | Ga0070695_100763658 | Ga0070695_1007636582 | 73 |
| 156 | 3300005548 | Ga0070665_100002483 | Ga0070665_1000024839 | 73 |
| 157 | 3300005548 | Ga0070665_100022800 | Ga0070665_1000228006 | 73 |
| 158 | 3300005548 | Ga0070665_100047809 | Ga0070665_1000478096 | 73 |
| 159 | 3300005548 | Ga0070665_101688485 | Ga0070665_1016884852 | 73 |
| 160 | 3300005549 | Ga0070704_100596651 | Ga0070704_1005966512 | 73 |
| 161 | 3300005563 | Ga0068855_100149600 | Ga0068855_1001496003 | 73 |
| 162 | 3300005577 | Ga0068857_100501548 | Ga0068857_1005015483 | 73 |
| 163 | 3300005614 | Ga0068856_100000057 | Ga0068856_10000005752 | 73 |
| 164 | 3300005614 | Ga0068856_100020527 | Ga0068856_1000205275 | 73 |
| 165 | 3300005615 | Ga0070702_100002851 | Ga0070702_1000028513 | 73 |
| 166 | 3300005616 | Ga0068852_100000058 | Ga0068852_10000005829 | 73 |
| 167 | 3300005617 | Ga0068859_101172030 | Ga0068859_1011720302 | 73 |
| 168 | 3300005718 | Ga0068866_10104165 | Ga0068866_101041653 | 73 |
| 169 | 3300005834 | Ga0068851_10022934 | Ga0068851_100229342 | 73 |
| 170 | 3300005841 | Ga0068863_100003904 | Ga0068863_10000390410 | 73 |
| 171 | 3300005843 | Ga0068860_100194561 | Ga0068860_1001945614 | 73 |
| 172 | 3300005843 | Ga0068860_102556009 | Ga0068860_1025560092 | 73 |
| 173 | 3300005844 | Ga0068862_100010337 | Ga0068862_1000103375 | 73 |
| 174 | 3300005844 | Ga0068862_100742992 | Ga0068862_1007429923 | 73 |
| 175 | 3300005937 | Ga0081455_10100357 | Ga0081455_101003571 | 73 |
| 176 | 3300005983 | Ga0081540_1000546 | Ga0081540_100054619 | 73 |
| 177 | 3300005985 | Ga0081539_10001100 | Ga0081539_1000110040 | 73 |
| 178 | 3300005985 | Ga0081539_10489412 | Ga0081539_104894121 | 73 |
| 179 | 3300006038 | Ga0075365_10309978 | Ga0075365_103099782 | 73 |
| 180 | 3300006175 | Ga0070712_100001300 | Ga0070712_1000013004 | 73 |
| 181 | 3300006846 | Ga0075430_100077761 | Ga0075430_1000777613 | 73 |
| 182 | 3300006852 | Ga0075433_10003490 | Ga0075433_100034902 | 73 |
| 183 | 3300006881 | Ga0068865_100000020 | Ga0068865_10000002020 | 73 |
| 184 | 3300006881 | Ga0068865_100258678 | Ga0068865_1002586782 | 73 |
| 185 | 3300006931 | Ga0097620_101172093 | Ga0097620_1011720932 | 73 |
| 186 | 3300007076 | Ga0075435_100768870 | Ga0075435_1007688702 | 73 |
| 187 | 3300009093 | Ga0105240_10694108 | Ga0105240_106941082 | 73 |
| 188 | 3300009098 | Ga0105245_10000159 | Ga0105245_1000015942 | 73 |
| 189 | 3300009101 | Ga0105247_10000993 | Ga0105247_1000099316 | 73 |
| 190 | 3300009101 | Ga0105247_10104372 | Ga0105247_101043722 | 73 |
| 191 | 3300009147 | Ga0114129_10743544 | Ga0114129_107435443 | 73 |
| 192 | 3300009174 | Ga0105241_11710066 | Ga0105241_117100662 | 73 |
| 193 | 3300009176 | Ga0105242_10000017 | Ga0105242_10000017100 | 73 |
| 194 | 3300009176 | Ga0105242_10002766 | Ga0105242_1000276611 | 73 |
| 195 | 3300009177 | Ga0105248_10000022 | Ga0105248_10000022252 | 73 |
| 196 | 3300009553 | Ga0105249_10000085 | Ga0105249_1000008521 | 73 |
| 197 | 3300009553 | Ga0105249_10000841 | Ga0105249_1000084112 | 73 |
| 198 | 3300010375 | Ga0105239_10423863 | Ga0105239_104238633 | 73 |
| 199 | 3300010375 | Ga0105239_10645854 | Ga0105239_106458543 | 73 |
| 200 | 3300010375 | Ga0105239_11936167 | Ga0105239_119361671 | 73 |
| 201 | 3300010375 | Ga0105239_13631877 | Ga0105239_136318772 | 73 |
| 202 | 3300013102 | Ga0157371_10004276 | Ga0157371_1000427611 | 73 |
| 203 | 3300013104 | Ga0157370_10187874 | Ga0157370_101878742 | 73 |
| 204 | 3300013296 | Ga0157374_10074388 | Ga0157374_100743883 | 73 |
| 205 | 3300013296 | Ga0157374_10297473 | Ga0157374_102974733 | 73 |
| 206 | 3300013297 | Ga0157378_10092044 | Ga0157378_100920442 | 73 |
| 207 | 3300013297 | Ga0157378_10386968 | Ga0157378_103869682 | 73 |
| 208 | 3300013306 | Ga0163162_10166902 | Ga0163162_101669023 | 73 |
| 209 | 3300013307 | Ga0157372_12564454 | Ga0157372_125644542 | 73 |
| 210 | 3300013308 | Ga0157375_10664790 | Ga0157375_106647902 | 73 |
| 211 | 3300013308 | Ga0157375_11937808 | Ga0157375_119378082 | 73 |
| 212 | 3300014325 | Ga0163163_10164392 | Ga0163163_101643924 | 73 |
| 213 | 3300014326 | Ga0157380_10000024 | Ga0157380_1000002427 | 73 |
| 214 | 3300014326 | Ga0157380_10514808 | Ga0157380_105148082 | 73 |
| 215 | 3300014968 | Ga0157379_10055979 | Ga0157379_100559793 | 73 |
| 216 | 3300014968 | Ga0157379_10125057 | Ga0157379_101250573 | 73 |
| 217 | 3300014969 | Ga0157376_10035064 | Ga0157376_100350645 | 73 |
| 218 | 3300020069 | Ga0197907_11298225 | Ga0197907_112982252 | 73 |
| 219 | 3300020070 | Ga0206356_11661110 | Ga0206356_116611103 | 73 |
| 220 | 3300022467 | Ga0224712_10163623 | Ga0224712_101636231 | 73 |
| 221 | 3300025321 | Ga0207656_10004306 | Ga0207656_100043064 | 73 |
| 222 | 3300025893 | Ga0207682_10000228 | Ga0207682_100002284 | 73 |
| 223 | 3300025898 | Ga0207692_10784804 | Ga0207692_107848042 | 73 |
| 224 | 3300025899 | Ga0207642_10026554 | Ga0207642_100265542 | 73 |
| 225 | 3300025900 | Ga0207710_10000151 | Ga0207710_1000015134 | 73 |
| 226 | 3300025903 | Ga0207680_10048971 | Ga0207680_100489714 | 73 |
| 227 | 3300025903 | Ga0207680_10272508 | Ga0207680_102725082 | 73 |
| 228 | 3300025911 | Ga0207654_11125583 | Ga0207654_111255832 | 73 |
| 229 | 3300025912 | Ga0207707_10065523 | Ga0207707_100655234 | 73 |
| 230 | 3300025915 | Ga0207693_10000859 | Ga0207693_100008595 | 73 |
| 231 | 3300025917 | Ga0207660_10650918 | Ga0207660_106509181 | 73 |
| 232 | 3300025920 | Ga0207649_10328326 | Ga0207649_103283263 | 73 |
| 233 | 3300025921 | Ga0207652_10015731 | Ga0207652_100157316 | 73 |
| 234 | 3300025923 | Ga0207681_10902401 | Ga0207681_109024012 | 73 |
| 235 | 3300025925 | Ga0207650_10829818 | Ga0207650_108298182 | 73 |
| 236 | 3300025926 | Ga0207659_10000043 | Ga0207659_1000004326 | 73 |
| 237 | 3300025927 | Ga0207687_10000011 | Ga0207687_10000011351 | 73 |
| 238 | 3300025927 | Ga0207687_11238758 | Ga0207687_112387582 | 73 |
| 239 | 3300025929 | Ga0207664_10056834 | Ga0207664_100568343 | 73 |
| 240 | 3300025929 | Ga0207664_10081702 | Ga0207664_100817024 | 73 |
| 241 | 3300025933 | Ga0207706_11416642 | Ga0207706_114166422 | 73 |
| 242 | 3300025934 | Ga0207686_10000016 | Ga0207686_10000016100 | 73 |
| 243 | 3300025934 | Ga0207686_10000029 | Ga0207686_1000002955 | 73 |
| 244 | 3300025934 | Ga0207686_10000549 | Ga0207686_1000054910 | 73 |
| 245 | 3300025938 | Ga0207704_10000004 | Ga0207704_10000004172 | 73 |
| 246 | 3300025938 | Ga0207704_10294588 | Ga0207704_102945883 | 73 |
| 247 | 3300025938 | Ga0207704_10323007 | Ga0207704_103230072 | 73 |
| 248 | 3300025941 | Ga0207711_10000019 | Ga0207711_1000001987 | 73 |
| 249 | 3300025944 | Ga0207661_10000142 | Ga0207661_1000014238 | 73 |
| 250 | 3300025944 | Ga0207661_10001987 | Ga0207661_100019875 | 73 |
| 251 | 3300025944 | Ga0207661_10142891 | Ga0207661_101428912 | 73 |
| 252 | 3300025944 | Ga0207661_10935637 | Ga0207661_109356372 | 73 |
| 253 | 3300025949 | Ga0207667_10360611 | Ga0207667_103606113 | 73 |
| 254 | 3300025961 | Ga0207712_10000033 | Ga0207712_1000003329 | 73 |
| 255 | 3300025961 | Ga0207712_10009331 | Ga0207712_100093315 | 73 |
| 256 | 3300025981 | Ga0207640_10001105 | Ga0207640_100011059 | 73 |
| 257 | 3300025986 | Ga0207658_10001768 | Ga0207658_100017683 | 73 |
| 258 | 3300025986 | Ga0207658_10117944 | Ga0207658_101179442 | 73 |
| 259 | 3300026041 | Ga0207639_10773149 | Ga0207639_107731491 | 73 |
| 260 | 3300026067 | Ga0207678_10074841 | Ga0207678_100748413 | 73 |
| 261 | 3300026078 | Ga0207702_10000027 | Ga0207702_1000002795 | 73 |
| 262 | 3300026078 | Ga0207702_10014910 | Ga0207702_100149104 | 73 |
| 263 | 3300026088 | Ga0207641_10002660 | Ga0207641_1000266011 | 73 |
| 264 | 3300026088 | Ga0207641_11890617 | Ga0207641_118906172 | 73 |
| 265 | 3300026116 | Ga0207674_10541945 | Ga0207674_105419452 | 73 |
| 266 | 3300026118 | Ga0207675_100546644 | Ga0207675_1005466443 | 73 |
| 267 | 3300026121 | Ga0207683_10010360 | Ga0207683_100103607 | 73 |
| 268 | 3300026142 | Ga0207698_10000002 | Ga0207698_10000002170 | 73 |
| 269 | 3300026142 | Ga0207698_10483913 | Ga0207698_104839133 | 73 |
| 270 | 3300028379 | Ga0268266_10000664 | Ga0268266_1000066432 | 73 |
| 271 | 3300028379 | Ga0268266_10004334 | Ga0268266_1000433412 | 73 |
| 272 | 3300028379 | Ga0268266_10194892 | Ga0268266_101948923 | 73 |
| 273 | 3300028379 | Ga0268266_10530272 | Ga0268266_105302722 | 73 |
| 274 | 3300028380 | Ga0268265_10054427 | Ga0268265_100544275 | 73 |
| 275 | 3300028381 | Ga0268264_10070092 | Ga0268264_100700923 | 73 |
| 276 | 3300028381 | Ga0268264_10882427 | Ga0268264_108824272 | 73 |
| 277 | 3300028556 | Ga0265337_1000004 | Ga0265337_100000455 | 73 |
| 278 | 3300028558 | Ga0265326_10000091 | Ga0265326_1000009111 | 73 |
| 279 | 3300028563 | Ga0265319_1000029 | Ga0265319_100002933 | 73 |
| 280 | 3300028563 | Ga0265319_1053753 | Ga0265319_10537533 | 73 |
| 281 | 3300028654 | Ga0265322_10000006 | Ga0265322_1000000655 | 73 |
| 282 | 3300028654 | Ga0265322_10200866 | Ga0265322_102008662 | 73 |
| 283 | 3300028666 | Ga0265336_10012904 | Ga0265336_100129043 | 73 |
| 284 | 3300028666 | Ga0265336_10055192 | Ga0265336_100551921 | 73 |
| 285 | 3300028800 | Ga0265338_10000179 | Ga0265338_1000017941 | 73 |
| 286 | 3300028800 | Ga0265338_10129959 | Ga0265338_101299594 | 73 |
| 287 | 3300029957 | Ga0265324_10000185 | Ga0265324_1000018540 | 73 |
| 288 | 3300029957 | Ga0265324_10041275 | Ga0265324_100412754 | 73 |
| 289 | 3300031238 | Ga0265332_10134902 | Ga0265332_101349022 | 73 |
| 290 | 3300031239 | Ga0265328_10005073 | Ga0265328_100050737 | 73 |
| 291 | 3300031240 | Ga0265320_10000001 | Ga0265320_10000001524 | 73 |
| 292 | 3300031241 | Ga0265325_10011215 | Ga0265325_100112154 | 73 |
| 293 | 3300031242 | Ga0265329_10010765 | Ga0265329_100107654 | 73 |
| 294 | 3300031249 | Ga0265339_10051548 | Ga0265339_100515484 | 73 |
| 295 | 3300031250 | Ga0265331_10001249 | Ga0265331_1000124917 | 73 |
| 296 | 3300031251 | Ga0265327_10000003 | Ga0265327_10000003524 | 73 |
| 297 | 3300031344 | Ga0265316_10016212 | Ga0265316_100162124 | 73 |
| 298 | 3300031595 | Ga0265313_10114404 | Ga0265313_101144043 | 73 |
| 299 | 3300031595 | Ga0265313_10291529 | Ga0265313_102915292 | 73 |
| 300 | 3300031665 | Ga0316575_10290042 | Ga0316575_102900421 | 73 |
| 301 | 3300031711 | Ga0265314_10000535 | Ga0265314_1000053548 | 73 |
| 302 | 3300031712 | Ga0265342_10213099 | Ga0265342_102130992 | 73 |
| 303 | 3300032002 | Ga0307416_100953691 | Ga0307416_1009536912 | 73 |
| 304 | 3300032126 | Ga0307415_100180956 | Ga0307415_1001809563 | 73 |
| 305 | 3300032133 | Ga0316583_10123813 | Ga0316583_101238132 | 73 |
| 306 | 3300041451 | Ga0451791_1480066 | Ga0451791_1480066_259_480 | 73 |
| 307 | 3300041459 | Ga0451800_0979465 | Ga0451800_0979465_520_741 | 73 |
| 308 | 3300041486 | Ga0451807_2679065 | Ga0451807_2679065_56_277 | 73 |
| 309 | 3300041492 | Ga0451835_0616804 | Ga0451835_0616804_53_274 | 73 |
| 310 | 3300041512 | Ga0451853_0013456 | Ga0451853_0013456_311_532 | 73 |
| 311 | 3300044683 | Ga0466965_0486456 | Ga0466965_0486456_240_461 | 73 |
| 312 | 3300044694 | Ga0466963_0000124 | Ga0466963_0000124_4158_4379 | 73 |
| 313 | 3300044842 | Ga0466957_0008475 | Ga0466957_0008475_3608_3829 | 73 |
| 314 | 3300044901 | Ga0466960_0582468 | Ga0466960_0582468_118_339 | 73 |
| 315 | 3300045836 | Ga0466958_0061588 | Ga0466958_0061588_727_948 | 73 |
| 316 | 3300045976 | Ga0466967_0000008 | Ga0466967_0000008_70934_71155 | 73 |
| 317 | 3300046454 | Ga0495592_0064755 | Ga0495592_0064755_1384_1605 | 73 |
| 318 | 3300046455 | Ga0495603_0000045 | Ga0495603_0000045_4631_4852 | 73 |
| 319 | 3300046455 | Ga0495603_0000622 | Ga0495603_0000622_1201_1422 | 73 |
| 320 | 3300046459 | Ga0495629_0001391 | Ga0495629_0001391_11595_11816 | 73 |
| 321 | 3300046460 | Ga0495638_0005536 | Ga0495638_0005536_8393_8614 | 73 |
| 322 | 3300046462 | Ga0495651_0991179 | Ga0495651_0991179_106_327 | 73 |
| 323 | 3300046475 | Ga0495639_0030389 | Ga0495639_0030389_1248_1469 | 73 |
| 324 | 3300046476 | Ga0495662_0009206 | Ga0495662_0009206_1073_1294 | 73 |
| 325 | 3300046499 | Ga0495594_0000276 | Ga0495594_0000276_6256_6477 | 73 |
| 326 | 3300046512 | Ga0495610_0112349 | Ga0495610_0112349_24_245 | 73 |
| 327 | 3300046514 | Ga0495618_0858040 | Ga0495618_0858040_262_483 | 73 |
| 328 | 3300046515 | Ga0495620_0001840 | Ga0495620_0001840_9651_9872 | 73 |
| 329 | 3300046516 | Ga0495628_0000858 | Ga0495628_0000858_3065_3286 | 73 |
| 330 | 3300046517 | Ga0495630_0000037 | Ga0495630_0000037_5444_5665 | 73 |
| 331 | 3300046517 | Ga0495630_0739763 | Ga0495630_0739763_158_379 | 73 |
| 332 | 3300046529 | Ga0495652_0000086 | Ga0495652_0000086_32814_33035 | 73 |
| 333 | 3300046529 | Ga0495652_0060323 | Ga0495652_0060323_1024_1245 | 73 |
| 334 | 3300046535 | Ga0495586_0007201 | Ga0495586_0007201_4710_4931 | 73 |
| 335 | 3300046535 | Ga0495586_0598951 | Ga0495586_0598951_52_276 | 73 |
| 336 | 3300046536 | Ga0495587_0001022 | Ga0495587_0001022_12025_12246 | 73 |
| 337 | 3300046536 | Ga0495587_0054135 | Ga0495587_0054135_1753_1974 | 73 |
| 338 | 3300046536 | Ga0495587_0541880 | Ga0495587_0541880_78_299 | 73 |
| 339 | 3300046542 | Ga0495597_0211600 | Ga0495597_0211600_107_328 | 73 |
| 340 | 3300046543 | Ga0495645_0024357 | Ga0495645_0024357_538_759 | 73 |
| 341 | 3300046557 | Ga0495622_0000690 | Ga0495622_0000690_18211_18432 | 73 |
| 342 | 3300046559 | Ga0495667_0000044 | Ga0495667_0000044_19142_19363 | 73 |
| 343 | 3300046660 | Ga0495625_0001659 | Ga0495625_0001659_4855_5076 | 73 |
| 344 | 3300046678 | Ga0495599_0133382 | Ga0495599_0133382_372_593 | 73 |
| 345 | 3300046681 | Ga0495647_0008323 | Ga0495647_0008323_1964_2185 | 73 |
| 346 | 3300046681 | Ga0495647_0307576 | Ga0495647_0307576_348_569 | 73 |
| 347 | 3300046683 | Ga0495658_0098296 | Ga0495658_0098296_858_1079 | 73 |
| 348 | 3300046684 | Ga0495669_0000651 | Ga0495669_0000651_11994_12215 | 73 |
| 349 | 3300046689 | Ga0495613_0481736 | Ga0495613_0481736_233_454 | 73 |
| 350 | 3300046690 | Ga0495624_0002296 | Ga0495624_0002296_5391_5612 | 73 |
| 351 | 3300047320 | Ga0495672_0083207 | Ga0495672_0083207_1322_1543 | 73 |
| 352 | 3300047321 | Ga0495676_0000652 | Ga0495676_0000652_2836_3057 | 73 |
| 353 | 3300047321 | Ga0495676_0007512 | Ga0495676_0007512_8546_8767 | 73 |
| 354 | 3300047321 | Ga0495676_0636780 | Ga0495676_0636780_78_299 | 73 |
| 355 | 3300047322 | Ga0495680_0002422 | Ga0495680_0002422_1363_1584 | 73 |
| 356 | 3300047444 | Ga0495675_0015728 | Ga0495675_0015728_2510_2731 | 73 |
| 357 | 3300047471 | Ga0495684_0828614 | Ga0495684_0828614_39_260 | 73 |
| 358 | 3300047673 | Ga0495593_0010922 | Ga0495593_0010922_3348_3569 | 73 |
| 359 | 3300048088 | Ga0495602_0000188 | Ga0495602_0000188_56801_57022 | 73 |
| 360 | 3300048088 | Ga0495602_0163145 | Ga0495602_0163145_1328_1549 | 73 |
| 361 | 3300048088 | Ga0495602_0411448 | Ga0495602_0411448_162_383 | 73 |
| 362 | 3300048903 | Ga0496100_0000003 | Ga0496100_0000003_196972_197193 | 73 |
| 363 | 3300048903 | Ga0496100_0000063 | Ga0496100_0000063_11904_12125 | 73 |
| 364 | 3300048904 | Ga0496101_0000003 | Ga0496101_0000003_196972_197193 | 73 |
| 365 | 3300048904 | Ga0496101_0000012 | Ga0496101_0000012_265054_265275 | 73 |
| 366 | 3300048904 | Ga0496101_0932423 | Ga0496101_0932423_13_234 | 73 |
| 367 | 3300048905 | Ga0496102_0000965 | Ga0496102_0000965_11848_12069 | 73 |
| 368 | 3300048905 | Ga0496102_0041849 | Ga0496102_0041849_3229_3450 | 73 |
| 369 | 3300048905 | Ga0496102_1353218 | Ga0496102_1353218_350_571 | 73 |
| 370 | 3300048906 | Ga0496103_0000627 | Ga0496103_0000627_11864_12085 | 73 |
| 371 | 3300048906 | Ga0496103_0012939 | Ga0496103_0012939_4252_4473 | 73 |
| 372 | 3300048906 | Ga0496103_0042724 | Ga0496103_0042724_209_430 | 73 |
| 373 | 3300048907 | Ga0496104_0000002 | Ga0496104_0000002_123345_123566 | 73 |
| 374 | 3300048908 | Ga0496105_0000001 | Ga0496105_0000001_1204613_1204834 | 73 |
| 375 | 3300048909 | Ga0496106_0000015 | Ga0496106_0000015_65384_65605 | 73 |
| 376 | 3300048909 | Ga0496106_0000020 | Ga0496106_0000020_164555_164776 | 73 |
| 377 | 3300048910 | Ga0496107_0000008 | Ga0496107_0000008_88032_88253 | 73 |
| 378 | 3300048910 | Ga0496107_0000014 | Ga0496107_0000014_164544_164765 | 73 |
| 379 | 3300048911 | Ga0496108_0001400 | Ga0496108_0001400_7115_7336 | 73 |
| 380 | 3300048912 | Ga0496109_0000246 | Ga0496109_0000246_40285_40506 | 73 |
| 381 | 3300048913 | Ga0496110_1128874 | Ga0496110_1128874_405_626 | 73 |
| 382 | 3300048913 | Ga0496110_1902771 | Ga0496110_1902771_239_460 | 73 |
| 383 | 3300048914 | Ga0496111_0031644 | Ga0496111_0031644_771_995 | 73 |
| 384 | 3300048915 | Ga0496112_0000003 | Ga0496112_0000003_638215_638436 | 73 |
| 385 | 3300048916 | Ga0496113_0157168 | Ga0496113_0157168_658_879 | 73 |
| 386 | 3300048916 | Ga0496113_0807510 | Ga0496113_0807510_429_650 | 73 |
| 387 | 3300048917 | Ga0496114_0000010 | Ga0496114_0000010_273596_273817 | 73 |
| 388 | 3300048917 | Ga0496114_0287108 | Ga0496114_0287108_56_277 | 73 |
| 389 | 3300048917 | Ga0496114_1091197 | Ga0496114_1091197_333_554 | 73 |
| 390 | 3300048918 | Ga0496115_0000004 | Ga0496115_0000004_271241_271462 | 73 |
| 391 | 3300048918 | Ga0496115_0019408 | Ga0496115_0019408_2105_2326 | 73 |
| 392 | 3300048918 | Ga0496115_0239479 | Ga0496115_0239479_276_497 | 73 |
| 393 | 3300048919 | Ga0496116_0000014 | Ga0496116_0000014_295667_295888 | 73 |
| 394 | 3300048920 | Ga0496117_0003519 | Ga0496117_0003519_17449_17670 | 73 |
| 395 | 3300048920 | Ga0496117_0200471 | Ga0496117_0200471_796_1017 | 73 |
| 396 | 3300048920 | Ga0496117_0389083 | Ga0496117_0389083_143_364 | 73 |
| 397 | 3300048921 | Ga0496118_0002996 | Ga0496118_0002996_17692_17913 | 73 |
| 398 | 3300048921 | Ga0496118_0244582 | Ga0496118_0244582_137_358 | 73 |
| 399 | 3300048921 | Ga0496118_0325901 | Ga0496118_0325901_262_483 | 73 |
| 400 | 3300048921 | Ga0496118_0629171 | Ga0496118_0629171_252_473 | 73 |
| 401 | 3300048922 | Ga0496119_0019537 | Ga0496119_0019537_1304_1525 | 73 |
| 402 | 3300048922 | Ga0496119_0083811 | Ga0496119_0083811_1440_1661 | 73 |
| 403 | 3300048922 | Ga0496119_0125950 | Ga0496119_0125950_381_602 | 73 |
| 404 | 3300048922 | Ga0496119_0281096 | Ga0496119_0281096_41_262 | 73 |
| 405 | 3300048923 | Ga0496120_0009355 | Ga0496120_0009355_6269_6490 | 73 |
| 406 | 3300048923 | Ga0496120_0049030 | Ga0496120_0049030_1014_1235 | 73 |
| 407 | 3300048924 | Ga0496121_0215119 | Ga0496121_0215119_515_736 | 73 |
| 408 | 3300048924 | Ga0496121_0368833 | Ga0496121_0368833_710_931 | 73 |
| 409 | 3300048927 | Ga0496124_0279512 | Ga0496124_0279512_103_324 | 73 |
| 410 | 3300048928 | Ga0496125_0039010 | Ga0496125_0039010_3550_3771 | 73 |
| 411 | 3300048929 | Ga0496126_0018873 | Ga0496126_0018873_3756_3977 | 73 |
| 412 | 3300048929 | Ga0496126_0601407 | Ga0496126_0601407_613_834 | 73 |
| 413 | 3300048929 | Ga0496126_0859192 | Ga0496126_0859192_344_565 | 73 |
| 414 | 3300049459 | Ga0495678_166368 | Ga0495678_166368_386_607 | 73 |
| 415 | 3300049569 | Ga0501032_0319805 | Ga0501032_0319805_453_674 | 73 |
| 416 | 3300049571 | Ga0501034_0228395 | Ga0501034_0228395_502_723 | 73 |
| 417 | 3300049574 | Ga0501038_1139173 | Ga0501038_1139173_118_339 | 73 |
| 418 | 3300049579 | Ga0501043_0316082 | Ga0501043_0316082_225_446 | 73 |
| 419 | 3300049581 | Ga0501047_0006224 | Ga0501047_0006224_10941_11162 | 73 |
| 420 | 3300049581 | Ga0501047_0838454 | Ga0501047_0838454_454_675 | 73 |
| 421 | 3300049581 | Ga0501047_1230257 | Ga0501047_1230257_320_541 | 73 |
| 422 | 3300049582 | Ga0501048_0190513 | Ga0501048_0190513_635_856 | 73 |
| 423 | 3300049583 | Ga0501067_0286369 | Ga0501067_0286369_302_523 | 73 |
| 424 | 3300049584 | Ga0501068_0132544 | Ga0501068_0132544_379_600 | 73 |
| 425 | 3300049585 | Ga0501069_0842684 | Ga0501069_0842684_291_512 | 73 |
| 426 | 3300049586 | Ga0501070_0016424 | Ga0501070_0016424_3957_4178 | 73 |
| 427 | 3300049586 | Ga0501070_0082163 | Ga0501070_0082163_367_588 | 73 |
| 428 | 3300049587 | Ga0501071_0088414 | Ga0501071_0088414_402_623 | 73 |
| 429 | 3300049588 | Ga0501072_0104844 | Ga0501072_0104844_340_561 | 73 |
| 430 | 3300049589 | Ga0501073_0166437 | Ga0501073_0166437_498_719 | 73 |
| 431 | 3300049592 | Ga0501076_0046430 | Ga0501076_0046430_514_735 | 73 |
| 432 | 3300049741 | Ga0501079_0031923 | Ga0501079_0031923_3014_3235 | 73 |
| 433 | 3300049742 | Ga0501080_0071013 | Ga0501080_0071013_1083_1304 | 73 |
| 434 | 3300049744 | Ga0501083_0031277 | Ga0501083_0031277_2174_2395 | 73 |
| 435 | 3300049744 | Ga0501083_0533817 | Ga0501083_0533817_98_319 | 73 |
| 436 | 3300049823 | Ga0501044_0164207 | Ga0501044_0164207_1729_1950 | 73 |
| 437 | 3300049823 | Ga0501044_0610442 | Ga0501044_0610442_11_232 | 73 |
| 438 | 3300050492 | nmdc:mga0yw44_647867_c1 | nmdc:mga0yw44_647867_c1_266_490 | 73 |
| 439 | 3300050507 | nmdc:mga05p37_1603939_c1 | nmdc:mga05p37_1603939_c1_174_395 | 73 |
| 440 | 3300050509 | nmdc:mga0qj67_67177_c1 | nmdc:mga0qj67_67177_c1_1856_2077 | 73 |
| 441 | 3300050513 | nmdc:mga0rr50_462661_c1 | nmdc:mga0rr50_462661_c1_802_1023 | 73 |
| 442 | 3300050515 | nmdc:mga0a205_9_c2 | nmdc:mga0a205_9_c2_68056_68277 | 73 |
| 443 | 3300053077 | Ga0495601_0397119 | Ga0495601_0397119_190_411 | 73 |
| 444 | 3300053078 | Ga0495612_0076366 | Ga0495612_0076366_469_693 | 73 |
| 445 | 3300053083 | Ga0495655_0000003 | Ga0495655_0000003_195950_196171 | 73 |
| 446 | 3300053119 | Ga0500595_044499 | Ga0500595_044499_435_656 | 73 |
| 447 | 3300053119 | Ga0500595_059425 | Ga0500595_059425_481_702 | 73 |
| 448 | 3300053129 | Ga0500628_000002 | Ga0500628_000002_195950_196171 | 73 |
| 449 | 3300053139 | Ga0500568_0077023 | Ga0500568_0077023_386_607 | 73 |
| 450 | 3300060353 | Ga0501082_0841855 | Ga0501082_0841855_55_276 | 73 |
| 451 | 3300005329 | Ga0070683_100015414 | Ga0070683_1000154144 | 74 |
| 452 | 3300005338 | Ga0068868_101612469 | Ga0068868_1016124692 | 74 |
| 453 | 3300005356 | Ga0070674_100106832 | Ga0070674_1001068324 | 74 |
| 454 | 3300005439 | Ga0070711_100546033 | Ga0070711_1005460333 | 74 |
| 455 | 3300005535 | Ga0070684_100022755 | Ga0070684_1000227554 | 74 |
| 456 | 3300005545 | Ga0070695_101345322 | Ga0070695_1013453221 | 74 |
| 457 | 3300005546 | Ga0070696_100880147 | Ga0070696_1008801471 | 74 |
| 458 | 3300006237 | Ga0097621_100734357 | Ga0097621_1007343572 | 74 |
| 459 | 3300006358 | Ga0068871_100576412 | Ga0068871_1005764122 | 74 |
| 460 | 3300011119 | Ga0105246_11428851 | Ga0105246_114288512 | 74 |
| 461 | 3300013308 | Ga0157375_10302567 | Ga0157375_103025672 | 74 |
| 462 | 3300025900 | Ga0207710_10112969 | Ga0207710_101129693 | 74 |
| 463 | 3300025909 | Ga0207705_10091476 | Ga0207705_100914764 | 74 |
| 464 | 3300025916 | Ga0207663_10121651 | Ga0207663_101216512 | 74 |
| 465 | 3300025924 | Ga0207694_10818072 | Ga0207694_108180722 | 74 |
| 466 | 3300025937 | Ga0207669_10213635 | Ga0207669_102136352 | 74 |
| 467 | 3300045976 | Ga0466967_0038536 | Ga0466967_0038536_2287_2511 | 74 |
| 468 | 3300046459 | Ga0495629_0001361 | Ga0495629_0001361_6835_7059 | 74 |
| 469 | 3300046459 | Ga0495629_0361790 | Ga0495629_0361790_478_705 | 74 |
| 470 | 3300046476 | Ga0495662_0000137 | Ga0495662_0000137_12861_13088 | 74 |
| 471 | 3300046507 | Ga0495606_0000045 | Ga0495606_0000045_23556_23780 | 74 |
| 472 | 3300046539 | Ga0495621_0011410 | Ga0495621_0011410_1973_2197 | 74 |
| 473 | 3300046642 | Ga0495634_0004564 | Ga0495634_0004564_10096_10323 | 74 |
| 474 | 3300046681 | Ga0495647_0003248 | Ga0495647_0003248_2161_2388 | 74 |
| 475 | 3300046681 | Ga0495647_0172528 | Ga0495647_0172528_491_718 | 74 |
| 476 | 3300046684 | Ga0495669_0015561 | Ga0495669_0015561_1997_2224 | 74 |
| 477 | 3300048908 | Ga0496105_0454399 | Ga0496105_0454399_746_973 | 74 |
| 478 | 3300048911 | Ga0496108_0010707 | Ga0496108_0010707_6218_6442 | 74 |
| 479 | 3300048911 | Ga0496108_1748952 | Ga0496108_1748952_226_453 | 74 |
| 480 | 3300048912 | Ga0496109_0042252 | Ga0496109_0042252_2755_2979 | 74 |
| 481 | 3300048912 | Ga0496109_1290188 | Ga0496109_1290188_236_463 | 74 |
| 482 | 3300048913 | Ga0496110_0143574 | Ga0496110_0143574_785_1009 | 74 |
| 483 | 3300048914 | Ga0496111_0140500 | Ga0496111_0140500_285_509 | 74 |
| 484 | 3300048914 | Ga0496111_0281843 | Ga0496111_0281843_684_911 | 74 |
| 485 | 3300048915 | Ga0496112_1270242 | Ga0496112_1270242_294_518 | 74 |
| 486 | 3300048916 | Ga0496113_0017949 | Ga0496113_0017949_2548_2772 | 74 |
| 487 | 3300048916 | Ga0496113_0058250 | Ga0496113_0058250_1380_1604 | 74 |
| 488 | 3300048917 | Ga0496114_0589689 | Ga0496114_0589689_215_439 | 74 |
| 489 | 3300049572 | Ga0501036_0733159 | Ga0501036_0733159_447_674 | 74 |
| 490 | 3300049575 | Ga0501039_0434263 | Ga0501039_0434263_382_606 | 74 |
| 491 | 3300049578 | Ga0501042_0442095 | Ga0501042_0442095_624_851 | 74 |
| 492 | 3300049588 | Ga0501072_0147757 | Ga0501072_0147757_1086_1313 | 74 |
| 493 | 3300049741 | Ga0501079_0390869 | Ga0501079_0390869_751_975 | 74 |
| 494 | 3300053078 | Ga0495612_0039082 | Ga0495612_0039082_1239_1463 | 74 |
| 495 | 3300060353 | Ga0501082_0308157 | Ga0501082_0308157_267_494 | 74 |
| 496 | 3300061734 | Ga0530510_1028374 | Ga0530510_1028374_267_491 | 74 |
| 497 | 3300001977 | JGI24746J21847_1000728 | JGI24746J21847_10007284 | 75 |
| 498 | 3300002239 | JGI24034J26672_10000167 | JGI24034J26672_100001678 | 75 |
| 499 | 3300002244 | JGI24742J22300_10000390 | JGI24742J22300_100003904 | 75 |
| 500 | 3300002459 | JGI24751J29686_10026666 | JGI24751J29686_100266662 | 75 |
| 501 | 3300005329 | Ga0070683_100004842 | Ga0070683_1000048426 | 75 |
| 502 | 3300005330 | Ga0070690_100786082 | Ga0070690_1007860822 | 75 |
| 503 | 3300005331 | Ga0070670_102035597 | Ga0070670_1020355972 | 75 |
| 504 | 3300005334 | Ga0068869_100333891 | Ga0068869_1003338913 | 75 |
| 505 | 3300005337 | Ga0070682_100000029 | Ga0070682_10000002919 | 75 |
| 506 | 3300005338 | Ga0068868_100043307 | Ga0068868_1000433072 | 75 |
| 507 | 3300005341 | Ga0070691_10003720 | Ga0070691_100037206 | 75 |
| 508 | 3300005345 | Ga0070692_11069626 | Ga0070692_110696262 | 75 |
| 509 | 3300005356 | Ga0070674_100000014 | Ga0070674_10000001415 | 75 |
| 510 | 3300005364 | Ga0070673_100019029 | Ga0070673_1000190295 | 75 |
| 511 | 3300005364 | Ga0070673_102259367 | Ga0070673_1022593672 | 75 |
| 512 | 3300005365 | Ga0070688_100542171 | Ga0070688_1005421712 | 75 |
| 513 | 3300005441 | Ga0070700_100038140 | Ga0070700_1000381403 | 75 |
| 514 | 3300005444 | Ga0070694_100536825 | Ga0070694_1005368251 | 75 |
| 515 | 3300005456 | Ga0070678_100408611 | Ga0070678_1004086112 | 75 |
| 516 | 3300005457 | Ga0070662_100000008 | Ga0070662_10000000869 | 75 |
| 517 | 3300005458 | Ga0070681_10043861 | Ga0070681_100438613 | 75 |
| 518 | 3300005459 | Ga0068867_100000247 | Ga0068867_10000024711 | 75 |
| 519 | 3300005530 | Ga0070679_100000651 | Ga0070679_10000065126 | 75 |
| 520 | 3300005535 | Ga0070684_100022662 | Ga0070684_1000226623 | 75 |
| 521 | 3300005535 | Ga0070684_100117307 | Ga0070684_1001173074 | 75 |
| 522 | 3300005547 | Ga0070693_100000398 | Ga0070693_1000003987 | 75 |
| 523 | 3300005548 | Ga0070665_100000870 | Ga0070665_10000087030 | 75 |
| 524 | 3300005563 | Ga0068855_100356527 | Ga0068855_1003565274 | 75 |
| 525 | 3300005577 | Ga0068857_102371919 | Ga0068857_1023719192 | 75 |
| 526 | 3300005614 | Ga0068856_100010700 | Ga0068856_1000107003 | 75 |
| 527 | 3300005614 | Ga0068856_101478997 | Ga0068856_1014789971 | 75 |
| 528 | 3300005618 | Ga0068864_100000044 | Ga0068864_100000044132 | 75 |
| 529 | 3300005718 | Ga0068866_10000219 | Ga0068866_1000021919 | 75 |
| 530 | 3300005842 | Ga0068858_100000155 | Ga0068858_10000015541 | 75 |
| 531 | 3300006173 | Ga0070716_101110091 | Ga0070716_1011100912 | 75 |
| 532 | 3300006175 | Ga0070712_100224422 | Ga0070712_1002244221 | 75 |
| 533 | 3300006852 | Ga0075433_10000663 | Ga0075433_1000066310 | 75 |
| 534 | 3300009098 | Ga0105245_10001015 | Ga0105245_1000101517 | 75 |
| 535 | 3300009148 | Ga0105243_10221148 | Ga0105243_102211482 | 75 |
| 536 | 3300009176 | Ga0105242_10008605 | Ga0105242_100086054 | 75 |
| 537 | 3300009551 | Ga0105238_10652846 | Ga0105238_106528463 | 75 |
| 538 | 3300009553 | Ga0105249_10189958 | Ga0105249_101899583 | 75 |
| 539 | 3300013104 | Ga0157370_10006328 | Ga0157370_100063289 | 75 |
| 540 | 3300013308 | Ga0157375_10573648 | Ga0157375_105736482 | 75 |
| 541 | 3300013308 | Ga0157375_13618746 | Ga0157375_136187462 | 75 |
| 542 | 3300014325 | Ga0163163_10761392 | Ga0163163_107613922 | 75 |
| 543 | 3300014325 | Ga0163163_10975566 | Ga0163163_109755662 | 75 |
| 544 | 3300014325 | Ga0163163_11125753 | Ga0163163_111257532 | 75 |
| 545 | 3300014968 | Ga0157379_10121840 | Ga0157379_101218402 | 75 |
| 546 | 3300020078 | Ga0206352_10935449 | Ga0206352_109354493 | 75 |
| 547 | 3300025885 | Ga0207653_10216855 | Ga0207653_102168552 | 75 |
| 548 | 3300025898 | Ga0207692_10531534 | Ga0207692_105315342 | 75 |
| 549 | 3300025899 | Ga0207642_10000094 | Ga0207642_1000009420 | 75 |
| 550 | 3300025912 | Ga0207707_10018135 | Ga0207707_100181359 | 75 |
| 551 | 3300025913 | Ga0207695_10714554 | Ga0207695_107145542 | 75 |
| 552 | 3300025915 | Ga0207693_10299747 | Ga0207693_102997472 | 75 |
| 553 | 3300025921 | Ga0207652_10000150 | Ga0207652_1000015052 | 75 |
| 554 | 3300025924 | Ga0207694_11024536 | Ga0207694_110245362 | 75 |
| 555 | 3300025926 | Ga0207659_10852866 | Ga0207659_108528662 | 75 |
| 556 | 3300025927 | Ga0207687_10000716 | Ga0207687_100007164 | 75 |
| 557 | 3300025933 | Ga0207706_10000016 | Ga0207706_10000016105 | 75 |
| 558 | 3300025934 | Ga0207686_10015756 | Ga0207686_100157563 | 75 |
| 559 | 3300025935 | Ga0207709_10162874 | Ga0207709_101628743 | 75 |
| 560 | 3300025936 | Ga0207670_10129878 | Ga0207670_101298783 | 75 |
| 561 | 3300025937 | Ga0207669_10000007 | Ga0207669_1000000725 | 75 |
| 562 | 3300025939 | Ga0207665_10966109 | Ga0207665_109661092 | 75 |
| 563 | 3300025942 | Ga0207689_10666123 | Ga0207689_106661232 | 75 |
| 564 | 3300025944 | Ga0207661_10003394 | Ga0207661_100033949 | 75 |
| 565 | 3300025944 | Ga0207661_10499527 | Ga0207661_104995272 | 75 |
| 566 | 3300025949 | Ga0207667_10380532 | Ga0207667_103805323 | 75 |
| 567 | 3300025960 | Ga0207651_10029595 | Ga0207651_100295954 | 75 |
| 568 | 3300025961 | Ga0207712_11318127 | Ga0207712_113181272 | 75 |
| 569 | 3300026023 | Ga0207677_10039439 | Ga0207677_100394392 | 75 |
| 570 | 3300026035 | Ga0207703_10000266 | Ga0207703_1000026647 | 75 |
| 571 | 3300026041 | Ga0207639_10003854 | Ga0207639_100038547 | 75 |
| 572 | 3300026041 | Ga0207639_11523494 | Ga0207639_115234941 | 75 |
| 573 | 3300026075 | Ga0207708_10100994 | Ga0207708_101009943 | 75 |
| 574 | 3300026078 | Ga0207702_10007605 | Ga0207702_100076054 | 75 |
| 575 | 3300026089 | Ga0207648_10000230 | Ga0207648_1000023017 | 75 |
| 576 | 3300026095 | Ga0207676_10000043 | Ga0207676_10000043131 | 75 |
| 577 | 3300026116 | Ga0207674_12189789 | Ga0207674_121897892 | 75 |
| 578 | 3300026121 | Ga0207683_10421762 | Ga0207683_104217623 | 75 |
| 579 | 3300028379 | Ga0268266_10000076 | Ga0268266_10000076188 | 75 |
| 580 | 3300035119 | Ga0373956_0576642 | Ga0373956_0576642_86_313 | 75 |
| 581 | 3300035724 | Ga0373933_0065959 | Ga0373933_0065959_610_837 | 75 |
| 582 | 3300036401 | Ga0373937_0041924 | Ga0373937_0041924_2647_2874 | 75 |
| 583 | 3300041459 | Ga0451800_0234848 | Ga0451800_0234848_996_1223 | 75 |
| 584 | 3300041512 | Ga0451853_0674116 | Ga0451853_0674116_1572_1799 | 75 |
| 585 | 3300046454 | Ga0495592_0118314 | Ga0495592_0118314_1393_1623 | 75 |
| 586 | 3300046454 | Ga0495592_0176354 | Ga0495592_0176354_252_479 | 75 |
| 587 | 3300046454 | Ga0495592_0326099 | Ga0495592_0326099_110_337 | 75 |
| 588 | 3300046459 | Ga0495629_0158193 | Ga0495629_0158193_989_1219 | 75 |
| 589 | 3300046461 | Ga0495641_0000001 | Ga0495641_0000001_188808_189035 | 75 |
| 590 | 3300046461 | Ga0495641_0178994 | Ga0495641_0178994_270_500 | 75 |
| 591 | 3300046463 | Ga0495653_0072155 | Ga0495653_0072155_493_720 | 75 |
| 592 | 3300046463 | Ga0495653_0160018 | Ga0495653_0160018_549_776 | 75 |
| 593 | 3300046473 | Ga0495582_0000022 | Ga0495582_0000022_68887_69117 | 75 |
| 594 | 3300046477 | Ga0495664_0117990 | Ga0495664_0117990_1272_1502 | 75 |
| 595 | 3300046511 | Ga0495608_0287385 | Ga0495608_0287385_79_306 | 75 |
| 596 | 3300046511 | Ga0495608_0919183 | Ga0495608_0919183_134_361 | 75 |
| 597 | 3300046514 | Ga0495618_0001468 | Ga0495618_0001468_1732_1962 | 75 |
| 598 | 3300046514 | Ga0495618_0902817 | Ga0495618_0902817_210_437 | 75 |
| 599 | 3300046516 | Ga0495628_0026019 | Ga0495628_0026019_2518_2748 | 75 |
| 600 | 3300046516 | Ga0495628_0061540 | Ga0495628_0061540_818_1045 | 75 |
| 601 | 3300046516 | Ga0495628_0064761 | Ga0495628_0064761_1426_1656 | 75 |
| 602 | 3300046517 | Ga0495630_0020101 | Ga0495630_0020101_3184_3414 | 75 |
| 603 | 3300046517 | Ga0495630_0070337 | Ga0495630_0070337_1970_2197 | 75 |
| 604 | 3300046517 | Ga0495630_0558988 | Ga0495630_0558988_324_551 | 75 |
| 605 | 3300046517 | Ga0495630_0873466 | Ga0495630_0873466_293_520 | 75 |
| 606 | 3300046520 | Ga0495637_0209606 | Ga0495637_0209606_440_667 | 75 |
| 607 | 3300046525 | Ga0495663_0209496 | Ga0495663_0209496_380_610 | 75 |
| 608 | 3300046533 | Ga0495640_0021952 | Ga0495640_0021952_3506_3736 | 75 |
| 609 | 3300046537 | Ga0495598_0003687 | Ga0495598_0003687_2656_2886 | 75 |
| 610 | 3300046543 | Ga0495645_0355832 | Ga0495645_0355832_412_639 | 75 |
| 611 | 3300046558 | Ga0495633_0006532 | Ga0495633_0006532_1700_1930 | 75 |
| 612 | 3300046616 | Ga0495668_0107861 | Ga0495668_0107861_70_300 | 75 |
| 613 | 3300046642 | Ga0495634_0068337 | Ga0495634_0068337_1989_2219 | 75 |
| 614 | 3300046642 | Ga0495634_0090023 | Ga0495634_0090023_990_1217 | 75 |
| 615 | 3300046642 | Ga0495634_0141968 | Ga0495634_0141968_306_536 | 75 |
| 616 | 3300046642 | Ga0495634_0449690 | Ga0495634_0449690_517_744 | 75 |
| 617 | 3300046663 | Ga0495635_0000063 | Ga0495635_0000063_21247_21477 | 75 |
| 618 | 3300046663 | Ga0495635_0042554 | Ga0495635_0042554_586_813 | 75 |
| 619 | 3300046663 | Ga0495635_0067371 | Ga0495635_0067371_628_855 | 75 |
| 620 | 3300046663 | Ga0495635_0242685 | Ga0495635_0242685_799_1026 | 75 |
| 621 | 3300046678 | Ga0495599_0006457 | Ga0495599_0006457_227_454 | 75 |
| 622 | 3300046678 | Ga0495599_0119765 | Ga0495599_0119765_868_1098 | 75 |
| 623 | 3300046680 | Ga0495646_0421904 | Ga0495646_0421904_219_446 | 75 |
| 624 | 3300046681 | Ga0495647_0631895 | Ga0495647_0631895_46_273 | 75 |
| 625 | 3300046683 | Ga0495658_0000008 | Ga0495658_0000008_69327_69557 | 75 |
| 626 | 3300046690 | Ga0495624_0251287 | Ga0495624_0251287_818_1045 | 75 |
| 627 | 3300046691 | Ga0495670_0007059 | Ga0495670_0007059_1830_2060 | 75 |
| 628 | 3300046809 | Ga0495600_0035731 | Ga0495600_0035731_1325_1555 | 75 |
| 629 | 3300046809 | Ga0495600_0119424 | Ga0495600_0119424_1249_1476 | 75 |
| 630 | 3300046809 | Ga0495600_0358097 | Ga0495600_0358097_89_316 | 75 |
| 631 | 3300047317 | Ga0495604_0050587 | Ga0495604_0050587_1685_1915 | 75 |
| 632 | 3300047317 | Ga0495604_0235900 | Ga0495604_0235900_696_923 | 75 |
| 633 | 3300047317 | Ga0495604_0974513 | Ga0495604_0974513_116_343 | 75 |
| 634 | 3300047321 | Ga0495676_0131933 | Ga0495676_0131933_311_541 | 75 |
| 635 | 3300047322 | Ga0495680_0000215 | Ga0495680_0000215_34598_34825 | 75 |
| 636 | 3300047322 | Ga0495680_0036038 | Ga0495680_0036038_1894_2124 | 75 |
| 637 | 3300047322 | Ga0495680_0059144 | Ga0495680_0059144_2484_2711 | 75 |
| 638 | 3300047322 | Ga0495680_0635733 | Ga0495680_0635733_322_549 | 75 |
| 639 | 3300047446 | Ga0495679_009212 | Ga0495679_009212_1031_1258 | 75 |
| 640 | 3300047447 | Ga0495685_017740 | Ga0495685_017740_201_431 | 75 |
| 641 | 3300047673 | Ga0495593_0302308 | Ga0495593_0302308_322_549 | 75 |
| 642 | 3300047673 | Ga0495593_0560629 | Ga0495593_0560629_293_523 | 75 |
| 643 | 3300048088 | Ga0495602_0466744 | Ga0495602_0466744_492_719 | 75 |
| 644 | 3300048907 | Ga0496104_1644383 | Ga0496104_1644383_139_369 | 75 |
| 645 | 3300048908 | Ga0496105_0022756 | Ga0496105_0022756_1551_1781 | 75 |
| 646 | 3300048911 | Ga0496108_0001295 | Ga0496108_0001295_12374_12601 | 75 |
| 647 | 3300048912 | Ga0496109_0000035 | Ga0496109_0000035_125429_125656 | 75 |
| 648 | 3300048912 | Ga0496109_0000888 | Ga0496109_0000888_12386_12613 | 75 |
| 649 | 3300048913 | Ga0496110_0018894 | Ga0496110_0018894_4874_5101 | 75 |
| 650 | 3300048913 | Ga0496110_0233155 | Ga0496110_0233155_498_725 | 75 |
| 651 | 3300048914 | Ga0496111_0009354 | Ga0496111_0009354_4955_5182 | 75 |
| 652 | 3300048915 | Ga0496112_0103593 | Ga0496112_0103593_2358_2585 | 75 |
| 653 | 3300048915 | Ga0496112_0429113 | Ga0496112_0429113_308_535 | 75 |
| 654 | 3300048916 | Ga0496113_0083986 | Ga0496113_0083986_1379_1606 | 75 |
| 655 | 3300048917 | Ga0496114_0030582 | Ga0496114_0030582_2205_2432 | 75 |
| 656 | 3300049576 | Ga0501040_0430317 | Ga0501040_0430317_161_388 | 75 |
| 657 | 3300049576 | Ga0501040_1331422 | Ga0501040_1331422_66_293 | 75 |
| 658 | 3300049577 | Ga0501041_0805023 | Ga0501041_0805023_259_486 | 75 |
| 659 | 3300049578 | Ga0501042_0012267 | Ga0501042_0012267_4526_4756 | 75 |
| 660 | 3300049586 | Ga0501070_0420345 | Ga0501070_0420345_671_898 | 75 |
| 661 | 3300049592 | Ga0501076_1623212 | Ga0501076_1623212_81_308 | 75 |
| 662 | 3300049743 | Ga0501081_1414562 | Ga0501081_1414562_84_311 | 75 |
| 663 | 3300049824 | Ga0501045_1411418 | Ga0501045_1411418_44_271 | 75 |
| 664 | 3300050515 | nmdc:mga0a205_155_c1 | nmdc:mga0a205_155_c1_20011_20238 | 75 |
| 665 | 3300053077 | Ga0495601_0000169 | Ga0495601_0000169_18892_19119 | 75 |
| 666 | 3300053077 | Ga0495601_0012989 | Ga0495601_0012989_3154_3381 | 75 |
| 667 | 3300053077 | Ga0495601_0023415 | Ga0495601_0023415_2341_2571 | 75 |
| 668 | 3300053077 | Ga0495601_0103639 | Ga0495601_0103639_741_968 | 75 |
| 669 | 3300053078 | Ga0495612_0001003 | Ga0495612_0001003_6627_6854 | 75 |
| 670 | 3300053078 | Ga0495612_0017880 | Ga0495612_0017880_1366_1596 | 75 |
| 671 | 3300053084 | Ga0495595_0375146 | Ga0495595_0375146_366_593 | 75 |
| 672 | 3300053085 | Ga0495619_0000408 | Ga0495619_0000408_27285_27512 | 75 |
| 673 | 3300053085 | Ga0495619_0000758 | Ga0495619_0000758_20089_20316 | 75 |
| 674 | 3300053085 | Ga0495619_0007151 | Ga0495619_0007151_3340_3567 | 75 |
| 675 | 3300053085 | Ga0495619_0011996 | Ga0495619_0011996_519_746 | 75 |
| 676 | 3300053085 | Ga0495619_0040276 | Ga0495619_0040276_1661_1888 | 75 |
| 677 | 3300053085 | Ga0495619_0070764 | Ga0495619_0070764_498_725 | 75 |
| 678 | 3300053085 | Ga0495619_0346693 | Ga0495619_0346693_619_846 | 75 |
| 679 | 3300053123 | Ga0500614_000374 | Ga0500614_000374_8184_8411 | 75 |
| 680 | 3300054114 | Ga0501084_0572153 | Ga0501084_0572153_525_752 | 75 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7pib-assembly1.cif.gz_v | 70s ribosome with ef-g, a/p- and p/e-site trnas in spectinomycin-treated mycoplasma pneumoniae cells | 0.7338 | 2 | 32 |
| 1yn4-assembly1.cif.gz_A | crystal structures of eap domains from staphylococcus aureus reveal an unexpected homology to bacterial superantigens | 0.7296 | 2 | 60 |
| 3m4g-assembly2.cif.gz_G | h57a hfq from pseudomonas aeruginosa | 0.701 | 5 | 60 |
| 4jrk-assembly1.cif.gz_B | crystal structure of escherichia coli hfq surface mutant | 0.7007 | 5 | 62 |
| 8bvj-assembly1.cif.gz_F | hfq-crc-esta translation repression complex | 0.7 | 5 | 60 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1yn4A00 | Alpha Beta;Roll;Ubiquitin-like (UB roll); | 0.7296 | 2 | 60 | 3.10.20.120 |
| 3hsbD00 | Mainly Beta;Roll;SH3 type barrels.; | 0.702 | 5 | 60 | 2.30.30.100 |
| af_A0A0B4LG43_69_168_2.40.10.10 | Mainly Beta;Beta Barrel;Thrombin, subunit H;Trypsin-like serine proteases | 0.6995 | 6 | 21 | 2.40.10.10 |
| af_Q2FWW2_1_96_3.10.20.120 | Alpha Beta;Roll;Ubiquitin-like (UB roll); | 0.6826 | 2 | 20 | 3.10.20.120 |
| af_P45472_1_97_3.40.1440.10 | Alpha Beta;3-Layer(aba) Sandwich;GIY-YIG endonuclease;GIY-YIG endonuclease | 0.6817 | 1 | 36 | 3.40.1440.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A5N2D3-F1-model_v4 | HTH LytTR-type domain-containing protein | 0.9126 | 5 | 60 |
|
| AF-U7GB24-F1-model_v4 | deleted | 0.9043 | 4 | 62 |
|
| AF-A0A317SPH4-F1-model_v4 | Uncharacterized protein | 0.8995 | 2 | 35 |
|
| AF-A0A640Y943-F1-model_v4 | Uncharacterized protein | 0.8988 | 1 | 69 |
|
| AF-A0A524J8P7-F1-model_v4 | DUF3107 family protein | 0.8968 | 1 | 70 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar