F474809

General Info

Members Datasets Scaffolds Average Seq Length
680 332 680 73

Family's Representative Sequence

Representative Sequence 3300050492|nmdc:mga0yw44_647867_c1|nmdc:mga0yw44_647867_c1_266_490
Length 74
Sequence MAAQSVEIGFEGGQVVSVRLDEGELKNLRKQLEKGGWHDLQTDGGGYVTVYLGKVAFLRVGAGQSRVGFALESD

Samples

Sample ID Description Type Environment
1 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
67 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
68 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
69 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
91 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
168 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
169 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
170 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
171 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
172 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
173 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
174 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
175 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
176 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
177 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
178 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
179 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
180 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
181 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
182 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
183 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
184 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
185 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
186 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
187 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
188 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
189 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
190 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
191 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
192 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
193 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
194 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
195 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
196 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
197 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
198 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
199 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
200 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
201 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
202 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
203 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
204 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
205 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
206 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
207 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
208 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
209 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
210 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
211 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
212 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
213 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
214 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
215 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
216 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
217 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
218 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
219 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
220 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
221 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
222 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
223 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
224 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
225 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
226 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
227 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
228 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
229 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
230 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
231 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
232 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
233 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
234 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
235 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
236 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
237 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
238 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
239 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
240 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
241 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
242 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
243 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
244 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
245 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
246 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
247 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
248 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
249 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
250 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
251 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
252 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
253 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
254 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
255 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
256 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
257 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
258 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
259 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
260 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
261 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
262 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
263 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
264 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
265 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
266 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
267 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
268 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
269 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
270 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
271 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
272 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
273 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
274 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
275 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
276 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
277 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
278 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
279 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
280 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
281 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
282 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
283 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
284 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
285 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
286 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
287 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
288 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
289 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
290 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
291 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
293 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
294 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
296 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
299 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
302 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
303 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
304 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
305 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
306 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
307 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
308 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
309 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
310 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
311 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
312 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
313 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
314 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
315 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
316 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
317 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
318 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
319 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
320 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
321 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
322 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
323 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
324 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
325 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
326 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
327 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
328 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
329 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
330 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
331 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
332 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.12
Metatranscriptomes 0.88
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.03
Nodule 0
Rhizoplane 10.74
Rhizosphere 83.97
Stem 0
Stem Tuber 0
Unclassified 4.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1000728 3300001977 Bacteria 5066
2 JGI24740J21852_10005676 3300001979 Bacteria 5254
3 JGI24034J26672_10000167 3300002239 Bacteria 9222
4 JGI24742J22300_10000390 3300002244 Bacteria 6507
5 JGI24751J29686_10026666 3300002459 Bacteria 1199
6 JGI25404J52841_10017023 3300003659 Bacteria 1576
7 Ga0070683_100002929 3300005329 Bacteria 13677
8 Ga0070683_100004842 3300005329 Bacteria 11145
9 Ga0070683_100015414 3300005329 Bacteria 6713
10 Ga0070683_100271872 3300005329 Bacteria 1612
11 Ga0070683_101206817 3300005329 Bacteria 727
12 Ga0070690_100786082 3300005330 Bacteria 737
13 Ga0070670_100129379 3300005331 Bacteria 2179
14 Ga0070670_101590203 3300005331 Unclassified 601
15 Ga0070670_102035597 3300005331 Bacteria 529
16 Ga0068869_100333891 3300005334 Unclassified 1232
17 Ga0070666_10010127 3300005335 Bacteria 5888
18 Ga0070666_10023706 3300005335 Bacteria 3996
19 Ga0070682_100000029 3300005337 Bacteria 183516
20 Ga0070682_100000815 3300005337 Bacteria 18228
21 Ga0068868_100004232 3300005338 Bacteria 10039
22 Ga0068868_100043307 3300005338 Bacteria 3516
23 Ga0068868_101612469 3300005338 Bacteria 610
24 Ga0070691_10000069 3300005341 Bacteria 28638
25 Ga0070691_10003720 3300005341 Bacteria 6890
26 Ga0070661_100000161 3300005344 Bacteria 55183
27 Ga0070692_11069626 3300005345 Unclassified 568
28 Ga0070668_100018528 3300005347 Bacteria 5227
29 Ga0070668_100295683 3300005347 Bacteria 1357
30 Ga0070669_100486485 3300005353 Bacteria 1022
31 Ga0070669_101134422 3300005353 Bacteria 674
32 Ga0070675_100000153 3300005354 Bacteria 41558
33 Ga0070671_100738930 3300005355 Unclassified 855
34 Ga0070674_100000011 3300005356 Bacteria 134886
35 Ga0070674_100000014 3300005356 Bacteria 100122
36 Ga0070674_100106832 3300005356 Bacteria 2049
37 Ga0070673_100019029 3300005364 Bacteria 4925
38 Ga0070673_100365643 3300005364 Bacteria 1283
39 Ga0070673_102259367 3300005364 Bacteria 517
40 Ga0070688_100000453 3300005365 Bacteria 20787
41 Ga0070688_100542171 3300005365 Unclassified 883
42 Ga0070659_100009701 3300005366 Bacteria 7074
43 Ga0070667_100001368 3300005367 Bacteria 21878
44 Ga0070667_100102281 3300005367 Bacteria 2476
45 Ga0070714_100008340 3300005435 Bacteria 8083
46 Ga0070713_100000076 3300005436 Bacteria 61668
47 Ga0070710_10770198 3300005437 Bacteria 685
48 Ga0070711_100546033 3300005439 Bacteria 961
49 Ga0070700_100038140 3300005441 Bacteria 2927
50 Ga0070700_100450694 3300005441 Bacteria 979
51 Ga0070694_100536825 3300005444 Bacteria 935
52 Ga0070663_100012594 3300005455 Bacteria 5358
53 Ga0070678_100355966 3300005456 Unclassified 1260
54 Ga0070678_100408611 3300005456 Unclassified 1181
55 Ga0070662_100000008 3300005457 Bacteria 168754
56 Ga0070681_10043861 3300005458 Bacteria 4477
57 Ga0070681_10463432 3300005458 Bacteria 1180
58 Ga0068867_100000247 3300005459 Bacteria 35692
59 Ga0070685_10000203 3300005466 Bacteria 39835
60 Ga0070679_100000651 3300005530 Bacteria 29562
61 Ga0070679_100114971 3300005530 Bacteria 2676
62 Ga0070684_100022662 3300005535 Bacteria 5241
63 Ga0070684_100022755 3300005535 Bacteria 5232
64 Ga0070684_100033478 3300005535 Bacteria 4388
65 Ga0070684_100061999 3300005535 Bacteria 3275
66 Ga0070684_100117307 3300005535 Bacteria 2392
67 Ga0070684_100541613 3300005535 Bacteria 1080
68 Ga0068853_100810114 3300005539 Bacteria 897
69 Ga0070686_101552802 3300005544 Bacteria 559
70 Ga0070695_100763658 3300005545 Bacteria 772
71 Ga0070695_101345322 3300005545 Unclassified 591
72 Ga0070696_100880147 3300005546 Bacteria 742
73 Ga0070693_100000398 3300005547 Bacteria 19763
74 Ga0070693_100815604 3300005547 Bacteria 693
75 Ga0070665_100000870 3300005548 Bacteria 39061
76 Ga0070665_100002483 3300005548 Bacteria 20309
77 Ga0070665_100022800 3300005548 Bacteria 6303
78 Ga0070665_100047809 3300005548 Bacteria 4294
79 Ga0070665_101688485 3300005548 Bacteria 641
80 Ga0070704_100596651 3300005549 Bacteria 970
81 Ga0068855_100149600 3300005563 Bacteria 2655
82 Ga0068855_100356527 3300005563 Bacteria 1610
83 Ga0070664_100093697 3300005564 Bacteria 2603
84 Ga0068857_100501548 3300005577 Bacteria 1139
85 Ga0068857_102371919 3300005577 Bacteria 521
86 Ga0068854_100000115 3300005578 Bacteria 55089
87 Ga0068856_100000057 3300005614 Bacteria 102045
88 Ga0068856_100010700 3300005614 Bacteria 8912
89 Ga0068856_100020527 3300005614 Bacteria 6417
90 Ga0068856_101478997 3300005614 Bacteria 693
91 Ga0070702_100002851 3300005615 Bacteria 7585
92 Ga0068852_100000058 3300005616 Bacteria 75312
93 Ga0068859_101172030 3300005617 Bacteria 846
94 Ga0068864_100000044 3300005618 Bacteria 157919
95 Ga0068866_10000002 3300005718 Bacteria 394090
96 Ga0068866_10000219 3300005718 Bacteria 27162
97 Ga0068866_10104165 3300005718 Bacteria 1571
98 Ga0068851_10001867 3300005834 Bacteria 9251
99 Ga0068851_10022934 3300005834 Bacteria 3047
100 Ga0068870_10115813 3300005840 Bacteria 1537
101 Ga0068863_100000042 3300005841 Bacteria 154459
102 Ga0068863_100003904 3300005841 Bacteria 14726
103 Ga0068858_100000086 3300005842 Bacteria 96201
104 Ga0068858_100000155 3300005842 Bacteria 72794
105 Ga0068860_100010275 3300005843 Bacteria 9264
106 Ga0068860_100194561 3300005843 Bacteria 1963
107 Ga0068860_102556009 3300005843 Bacteria 530
108 Ga0068862_100010337 3300005844 Bacteria 7701
109 Ga0068862_100742992 3300005844 Bacteria 954
110 Ga0081455_10100357 3300005937 Bacteria 2326
111 Ga0081540_1000546 3300005983 Bacteria 36470
112 Ga0081540_1021526 3300005983 Bacteria 3834
113 Ga0081539_10001100 3300005985 Bacteria 49090
114 Ga0081539_10489412 3300005985 Bacteria 509
115 Ga0075365_10309978 3300006038 Bacteria 1111
116 Ga0070715_10000015 3300006163 Bacteria 152816
117 Ga0070715_10085070 3300006163 Bacteria 1444
118 Ga0070715_10208143 3300006163 Bacteria 998
119 Ga0070716_100681297 3300006173 Unclassified 783
120 Ga0070716_101110091 3300006173 Bacteria 631
121 Ga0070712_100001300 3300006175 Bacteria 15100
122 Ga0070712_100224422 3300006175 Bacteria 1489
123 Ga0097621_100734357 3300006237 Bacteria 911
124 Ga0068871_100576412 3300006358 Bacteria 1021
125 Ga0075430_100077761 3300006846 Bacteria 2781
126 Ga0075433_10000663 3300006852 Bacteria 23254
127 Ga0075433_10003490 3300006852 Bacteria 12148
128 Ga0068865_100000020 3300006881 Bacteria 104487
129 Ga0068865_100258678 3300006881 Bacteria 1377
130 Ga0097620_101172093 3300006931 Bacteria 846
131 Ga0075435_100768870 3300007076 Bacteria 838
132 Ga0105240_10694108 3300009093 Unclassified 1112
133 Ga0105245_10000053 3300009098 Bacteria 125678
134 Ga0105245_10000159 3300009098 Bacteria 63630
135 Ga0105245_10001015 3300009098 Bacteria 25483
136 Ga0105245_10002749 3300009098 Bacteria 15821
137 Ga0105247_10000993 3300009101 Bacteria 21414
138 Ga0105247_10104372 3300009101 Bacteria 1816
139 Ga0114129_10743544 3300009147 Bacteria 1256
140 Ga0105243_10004998 3300009148 Bacteria 10392
141 Ga0105243_10221148 3300009148 Bacteria 1674
142 Ga0105241_10590912 3300009174 Bacteria 1002
143 Ga0105241_11710066 3300009174 Bacteria 611
144 Ga0105242_10000017 3300009176 Bacteria 122190
145 Ga0105242_10002766 3300009176 Bacteria 13729
146 Ga0105242_10008605 3300009176 Bacteria 7837
147 Ga0105242_10238304 3300009176 Bacteria 1634
148 Ga0105242_10250629 3300009176 Bacteria 1595
149 Ga0105248_10000022 3300009177 Bacteria 275935
150 Ga0105238_10000299 3300009551 Bacteria 54293
151 Ga0105238_10652846 3300009551 Bacteria 1062
152 Ga0105249_10000085 3300009553 Bacteria 133497
153 Ga0105249_10000841 3300009553 Bacteria 27506
154 Ga0105249_10189958 3300009553 Unclassified 2004
155 Ga0105239_10050654 3300010375 Bacteria 4554
156 Ga0105239_10423863 3300010375 Unclassified 1508
157 Ga0105239_10645854 3300010375 Bacteria 1208
158 Ga0105239_10659490 3300010375 Bacteria 1195
159 Ga0105239_10889786 3300010375 Bacteria 1022
160 Ga0105239_11936167 3300010375 Bacteria 684
161 Ga0105239_13631877 3300010375 Unclassified 501
162 Ga0105246_11428851 3300011119 Bacteria 647
163 Ga0157373_10496552 3300013100 Bacteria 881
164 Ga0157371_10004276 3300013102 Bacteria 12531
165 Ga0157370_10006328 3300013104 Bacteria 13080
166 Ga0157370_10187874 3300013104 Bacteria 1918
167 Ga0157374_10074388 3300013296 Bacteria 3208
168 Ga0157374_10297473 3300013296 Bacteria 1596
169 Ga0157378_10092044 3300013297 Bacteria 2758
170 Ga0157378_10386968 3300013297 Bacteria 1375
171 Ga0163162_10078269 3300013306 Bacteria 3372
172 Ga0163162_10166902 3300013306 Bacteria 2325
173 Ga0157372_10000616 3300013307 Bacteria 38850
174 Ga0157372_12564454 3300013307 Bacteria 585
175 Ga0157375_10008882 3300013308 Bacteria 8794
176 Ga0157375_10302567 3300013308 Unclassified 1763
177 Ga0157375_10573648 3300013308 Bacteria 1289
178 Ga0157375_10664790 3300013308 Bacteria 1197
179 Ga0157375_11937808 3300013308 Bacteria 700
180 Ga0157375_11956333 3300013308 Unclassified 696
181 Ga0157375_13618746 3300013308 Bacteria 514
182 Ga0163163_10164392 3300014325 Bacteria 2265
183 Ga0163163_10761392 3300014325 Bacteria 1032
184 Ga0163163_10975566 3300014325 Bacteria 911
185 Ga0163163_11125753 3300014325 Bacteria 848
186 Ga0157380_10000024 3300014326 Bacteria 110947
187 Ga0157380_10000080 3300014326 Bacteria 53731
188 Ga0157380_10514808 3300014326 Archaea 1166
189 Ga0157379_10055979 3300014968 Bacteria 3525
190 Ga0157379_10121840 3300014968 Bacteria 2346
191 Ga0157379_10125057 3300014968 Bacteria 2314
192 Ga0157376_10035064 3300014969 Bacteria 4056
193 Ga0163161_10009328 3300017792 Bacteria 6790
194 Ga0197907_11298225 3300020069 Unclassified 767
195 Ga0206356_11661110 3300020070 Bacteria 3396
196 Ga0206352_10935449 3300020078 Bacteria 1513
197 Ga0206354_11092466 3300020081 Bacteria 1363
198 Ga0206353_11601057 3300020082 Bacteria 1801
199 Ga0224712_10163623 3300022467 Bacteria 994
200 Ga0207656_10000354 3300025321 Bacteria 15472
201 Ga0207656_10004306 3300025321 Bacteria 4960
202 Ga0207653_10216855 3300025885 Bacteria 725
203 Ga0207682_10000228 3300025893 Bacteria 25297
204 Ga0207692_10531534 3300025898 Bacteria 749
205 Ga0207692_10784804 3300025898 Bacteria 622
206 Ga0207642_10000001 3300025899 Bacteria 714030
207 Ga0207642_10000003 3300025899 Bacteria 650651
208 Ga0207642_10000094 3300025899 Bacteria 23395
209 Ga0207642_10026554 3300025899 Bacteria 2359
210 Ga0207710_10000151 3300025900 Bacteria 77424
211 Ga0207710_10112969 3300025900 Bacteria 1291
212 Ga0207680_10048971 3300025903 Bacteria 2513
213 Ga0207680_10272508 3300025903 Bacteria 1174
214 Ga0207685_10000001 3300025905 Bacteria 604473
215 Ga0207643_10134307 3300025908 Bacteria 1474
216 Ga0207705_10091476 3300025909 Bacteria 2228
217 Ga0207705_10974544 3300025909 Bacteria 656
218 Ga0207654_10270279 3300025911 Bacteria 1146
219 Ga0207654_11125583 3300025911 Bacteria 572
220 Ga0207707_10018135 3300025912 Bacteria 6134
221 Ga0207707_10065523 3300025912 Bacteria 3164
222 Ga0207695_10714554 3300025913 Bacteria 882
223 Ga0207693_10000859 3300025915 Bacteria 27121
224 Ga0207693_10299747 3300025915 Bacteria 1259
225 Ga0207663_10121651 3300025916 Bacteria 1788
226 Ga0207660_10650918 3300025917 Bacteria 859
227 Ga0207649_10000024 3300025920 Bacteria 183104
228 Ga0207649_10328326 3300025920 Bacteria 1126
229 Ga0207652_10000150 3300025921 Bacteria 75189
230 Ga0207652_10015731 3300025921 Bacteria 6162
231 Ga0207681_10360413 3300025923 Bacteria 1166
232 Ga0207681_10902401 3300025923 Bacteria 740
233 Ga0207694_10000035 3300025924 Bacteria 195870
234 Ga0207694_10818072 3300025924 Bacteria 787
235 Ga0207694_11024536 3300025924 Bacteria 699
236 Ga0207650_10829818 3300025925 Bacteria 784
237 Ga0207659_10000043 3300025926 Bacteria 90795
238 Ga0207659_10852866 3300025926 Bacteria 783
239 Ga0207687_10000011 3300025927 Bacteria 388349
240 Ga0207687_10000021 3300025927 Bacteria 226396
241 Ga0207687_10000350 3300025927 Bacteria 30682
242 Ga0207687_10000716 3300025927 Bacteria 22524
243 Ga0207687_11238758 3300025927 Unclassified 641
244 Ga0207700_10000009 3300025928 Bacteria 314953
245 Ga0207664_10056834 3300025929 Bacteria 3109
246 Ga0207664_10081702 3300025929 Bacteria 2631
247 Ga0207690_10006983 3300025932 Bacteria 6695
248 Ga0207706_10000016 3300025933 Bacteria 170697
249 Ga0207706_11416642 3300025933 Bacteria 570
250 Ga0207686_10000016 3300025934 Bacteria 198779
251 Ga0207686_10000029 3300025934 Bacteria 160239
252 Ga0207686_10000549 3300025934 Bacteria 24232
253 Ga0207686_10015756 3300025934 Bacteria 4235
254 Ga0207686_10070529 3300025934 Bacteria 2246
255 Ga0207686_11086241 3300025934 Unclassified 652
256 Ga0207709_10162874 3300025935 Bacteria 1557
257 Ga0207709_10390025 3300025935 Bacteria 1062
258 Ga0207670_10129878 3300025936 Bacteria 1844
259 Ga0207669_10000007 3300025937 Bacteria 169904
260 Ga0207669_10000027 3300025937 Bacteria 91216
261 Ga0207669_10213635 3300025937 Bacteria 1410
262 Ga0207704_10000004 3300025938 Bacteria 239295
263 Ga0207704_10294588 3300025938 Unclassified 1240
264 Ga0207704_10323007 3300025938 Bacteria 1191
265 Ga0207665_10966109 3300025939 Bacteria 677
266 Ga0207665_11229300 3300025939 Bacteria 598
267 Ga0207711_10000019 3300025941 Bacteria 412779
268 Ga0207689_10666123 3300025942 Unclassified 877
269 Ga0207661_10000142 3300025944 Bacteria 45456
270 Ga0207661_10001987 3300025944 Bacteria 14072
271 Ga0207661_10003394 3300025944 Bacteria 11055
272 Ga0207661_10035924 3300025944 Bacteria 3865
273 Ga0207661_10142891 3300025944 Bacteria 2061
274 Ga0207661_10499527 3300025944 Bacteria 1111
275 Ga0207661_10935637 3300025944 Bacteria 798
276 Ga0207679_10010691 3300025945 Bacteria 5918
277 Ga0207667_10360611 3300025949 Bacteria 1482
278 Ga0207667_10380532 3300025949 Bacteria 1438
279 Ga0207651_10029595 3300025960 Bacteria 3472
280 Ga0207712_10000033 3300025961 Bacteria 209336
281 Ga0207712_10009331 3300025961 Bacteria 6208
282 Ga0207712_11318127 3300025961 Bacteria 645
283 Ga0207668_10099829 3300025972 Bacteria 2154
284 Ga0207640_10000059 3300025981 Bacteria 90901
285 Ga0207640_10001105 3300025981 Bacteria 14885
286 Ga0207658_10001768 3300025986 Bacteria 16221
287 Ga0207658_10117944 3300025986 Bacteria 2110
288 Ga0207677_10004273 3300026023 Bacteria 7643
289 Ga0207677_10039439 3300026023 Bacteria 3105
290 Ga0207703_10000072 3300026035 Bacteria 120727
291 Ga0207703_10000266 3300026035 Bacteria 58337
292 Ga0207639_10003854 3300026041 Bacteria 10101
293 Ga0207639_10773149 3300026041 Bacteria 894
294 Ga0207639_11523494 3300026041 Bacteria 627
295 Ga0207678_10074841 3300026067 Bacteria 2901
296 Ga0207678_10334069 3300026067 Bacteria 1305
297 Ga0207708_10100994 3300026075 Bacteria 2233
298 Ga0207708_10183890 3300026075 Bacteria 1660
299 Ga0207702_10000027 3300026078 Bacteria 183792
300 Ga0207702_10007605 3300026078 Bacteria 9224
301 Ga0207702_10014910 3300026078 Bacteria 6446
302 Ga0207641_10000231 3300026088 Bacteria 72245
303 Ga0207641_10002660 3300026088 Bacteria 16331
304 Ga0207641_11890617 3300026088 Bacteria 598
305 Ga0207648_10000230 3300026089 Bacteria 59713
306 Ga0207676_10000043 3300026095 Bacteria 161948
307 Ga0207674_10541945 3300026116 Bacteria 1124
308 Ga0207674_12189789 3300026116 Unclassified 516
309 Ga0207675_100546644 3300026118 Unclassified 1157
310 Ga0207683_10010360 3300026121 Bacteria 7953
311 Ga0207683_10121638 3300026121 Bacteria 2344
312 Ga0207683_10421762 3300026121 Unclassified 1229
313 Ga0207683_11479912 3300026121 Bacteria 627
314 Ga0207698_10000002 3300026142 Bacteria 404991
315 Ga0207698_10483913 3300026142 Bacteria 1201
316 Ga0268266_10000076 3300028379 Bacteria 217644
317 Ga0268266_10000664 3300028379 Bacteria 46506
318 Ga0268266_10004334 3300028379 Bacteria 13637
319 Ga0268266_10194892 3300028379 Bacteria 1851
320 Ga0268266_10530272 3300028379 Unclassified 1126
321 Ga0268265_10054427 3300028380 Bacteria 3036
322 Ga0268264_10070092 3300028381 Bacteria 2967
323 Ga0268264_10882427 3300028381 Unclassified 897
324 Ga0265337_1000004 3300028556 Bacteria 106708
325 Ga0265326_10000091 3300028558 Bacteria 47039
326 Ga0265319_1000029 3300028563 Bacteria 131291
327 Ga0265319_1053753 3300028563 Bacteria 1322
328 Ga0265322_10000006 3300028654 Bacteria 231685
329 Ga0265322_10200866 3300028654 Bacteria 571
330 Ga0265336_10012904 3300028666 Bacteria 2798
331 Ga0265336_10055192 3300028666 Bacteria 1195
332 Ga0265338_10000179 3300028800 Bacteria 117995
333 Ga0265338_10129959 3300028800 Bacteria 1991
334 Ga0265324_10000185 3300029957 Bacteria 47817
335 Ga0265324_10041275 3300029957 Bacteria 1597
336 Ga0265332_10134902 3300031238 Bacteria 1035
337 Ga0265328_10005073 3300031239 Bacteria 5671
338 Ga0265320_10000001 3300031240 Bacteria 847191
339 Ga0265325_10011215 3300031241 Bacteria 5154
340 Ga0265329_10010765 3300031242 Bacteria 3346
341 Ga0265339_10051548 3300031249 Bacteria 2245
342 Ga0265331_10001249 3300031250 Bacteria 19056
343 Ga0265327_10000003 3300031251 Bacteria 852750
344 Ga0265316_10016212 3300031344 Bacteria 6472
345 Ga0265313_10114404 3300031595 Bacteria 1183
346 Ga0265313_10291529 3300031595 Bacteria 657
347 Ga0316575_10290042 3300031665 Bacteria 691
348 Ga0265314_10000535 3300031711 Bacteria 49105
349 Ga0265342_10213099 3300031712 Unclassified 1044
350 Ga0307416_100953691 3300032002 Bacteria 960
351 Ga0307415_100180956 3300032126 Bacteria 1654
352 Ga0316583_10123813 3300032133 Bacteria 901
353 Ga0373956_0576642 3300035119 Bacteria 537
354 Ga0373933_0065959 3300035724 Bacteria 2193
355 Ga0373937_0041924 3300036401 Bacteria 4177
356 Ga0451791_1480066 3300041451 Bacteria 650
357 Ga0451800_0234848 3300041459 Bacteria 1253
358 Ga0451800_0979465 3300041459 Bacteria 892
359 Ga0451802_0624704 3300041460 Bacteria 561
360 Ga0451807_1911921 3300041486 Bacteria 646
361 Ga0451807_2679065 3300041486 Bacteria 790
362 Ga0451835_0616804 3300041492 Bacteria 534
363 Ga0451839_0881515 3300041496 Bacteria 599
364 Ga0451845_0341957 3300041501 Bacteria 1222
365 Ga0451853_0013456 3300041512 Unclassified 568
366 Ga0451853_0215495 3300041512 Bacteria 562
367 Ga0451853_0674116 3300041512 Bacteria 5453
368 Ga0451853_2031101 3300041512 Bacteria 1408
369 Ga0466965_0486456 3300044683 Bacteria 691
370 Ga0466963_0000124 3300044694 Bacteria 28905
371 Ga0466963_0010933 3300044694 Bacteria 5514
372 Ga0466963_0028080 3300044694 Bacteria 3609
373 Ga0466957_0008475 3300044842 Bacteria 5848
374 Ga0466960_0582468 3300044901 Bacteria 663
375 Ga0466958_0061588 3300045836 Bacteria 2286
376 Ga0466967_0000008 3300045976 Bacteria 127135
377 Ga0466967_0038536 3300045976 Bacteria 4100
378 Ga0466967_0155107 3300045976 Bacteria 2144
379 Ga0495592_0000521 3300046454 Bacteria 27805
380 Ga0495592_0064755 3300046454 Bacteria 2678
381 Ga0495592_0118314 3300046454 Bacteria 1867
382 Ga0495592_0176354 3300046454 Bacteria 1459
383 Ga0495592_0326099 3300046454 Unclassified 991
384 Ga0495603_0000045 3300046455 Bacteria 53543
385 Ga0495603_0000622 3300046455 Bacteria 19869
386 Ga0495603_0004750 3300046455 Bacteria 8110
387 Ga0495629_0001361 3300046459 Bacteria 19270
388 Ga0495629_0001391 3300046459 Bacteria 19098
389 Ga0495629_0150945 3300046459 Bacteria 1615
390 Ga0495629_0158193 3300046459 Bacteria 1574
391 Ga0495629_0361790 3300046459 Bacteria 989
392 Ga0495638_0005536 3300046460 Bacteria 9366
393 Ga0495641_0000001 3300046461 Bacteria 485224
394 Ga0495641_0022741 3300046461 Bacteria 3131
395 Ga0495641_0178994 3300046461 Bacteria 949
396 Ga0495651_0991179 3300046462 Unclassified 510
397 Ga0495653_0072155 3300046463 Bacteria 2579
398 Ga0495653_0160018 3300046463 Bacteria 1564
399 Ga0495653_0217667 3300046463 Bacteria 1286
400 Ga0495653_0607979 3300046463 Bacteria 671
401 Ga0495582_0000022 3300046473 Bacteria 83315
402 Ga0495639_0030389 3300046475 Bacteria 2401
403 Ga0495662_0000137 3300046476 Bacteria 28083
404 Ga0495662_0009206 3300046476 Bacteria 4845
405 Ga0495664_0117990 3300046477 Bacteria 1604
406 Ga0495594_0000276 3300046499 Bacteria 25314
407 Ga0495606_0000045 3300046507 Bacteria 212105
408 Ga0495608_0100950 3300046511 Bacteria 1860
409 Ga0495608_0287385 3300046511 Bacteria 1020
410 Ga0495608_0919183 3300046511 Bacteria 511
411 Ga0495610_0112349 3300046512 Bacteria 1205
412 Ga0495618_0001468 3300046514 Bacteria 15801
413 Ga0495618_0503988 3300046514 Bacteria 729
414 Ga0495618_0858040 3300046514 Bacteria 526
415 Ga0495618_0902817 3300046514 Unclassified 510
416 Ga0495620_0001840 3300046515 Bacteria 12507
417 Ga0495628_0000858 3300046516 Bacteria 28086
418 Ga0495628_0026019 3300046516 Bacteria 4777
419 Ga0495628_0061540 3300046516 Bacteria 2944
420 Ga0495628_0064761 3300046516 Bacteria 2861
421 Ga0495628_0201839 3300046516 Bacteria 1498
422 Ga0495630_0000037 3300046517 Bacteria 114404
423 Ga0495630_0020101 3300046517 Bacteria 4918
424 Ga0495630_0070337 3300046517 Bacteria 2633
425 Ga0495630_0558988 3300046517 Bacteria 877
426 Ga0495630_0739763 3300046517 Bacteria 752
427 Ga0495630_0873466 3300046517 Bacteria 685
428 Ga0495637_0209606 3300046520 Bacteria 713
429 Ga0495663_0209496 3300046525 Unclassified 682
430 Ga0495652_0000086 3300046529 Bacteria 99373
431 Ga0495652_0060323 3300046529 Bacteria 3206
432 Ga0495640_0021952 3300046533 Bacteria 4675
433 Ga0495640_0151885 3300046533 Unclassified 1488
434 Ga0495586_0007201 3300046535 Bacteria 5933
435 Ga0495586_0598951 3300046535 Bacteria 637
436 Ga0495587_0001022 3300046536 Bacteria 18410
437 Ga0495587_0054135 3300046536 Bacteria 2365
438 Ga0495587_0356779 3300046536 Bacteria 814
439 Ga0495587_0541880 3300046536 Bacteria 642
440 Ga0495598_0003687 3300046537 Bacteria 3273
441 Ga0495621_0011410 3300046539 Bacteria 2747
442 Ga0495597_0211600 3300046542 Bacteria 773
443 Ga0495645_0024357 3300046543 Bacteria 4391
444 Ga0495645_0355832 3300046543 Bacteria 942
445 Ga0495622_0000690 3300046557 Bacteria 19165
446 Ga0495633_0006532 3300046558 Bacteria 6890
447 Ga0495667_0000044 3300046559 Bacteria 121910
448 Ga0495667_0098396 3300046559 Unclassified 1894
449 Ga0495668_0107861 3300046616 Bacteria 1523
450 Ga0495634_0001471 3300046642 Bacteria 20875
451 Ga0495634_0004564 3300046642 Bacteria 10814
452 Ga0495634_0068337 3300046642 Bacteria 2348
453 Ga0495634_0090023 3300046642 Bacteria 1994
454 Ga0495634_0141968 3300046642 Bacteria 1524
455 Ga0495634_0449690 3300046642 Unclassified 760
456 Ga0495625_0001659 3300046660 Bacteria 26100
457 Ga0495635_0000063 3300046663 Bacteria 65304
458 Ga0495635_0042554 3300046663 Bacteria 3136
459 Ga0495635_0067371 3300046663 Bacteria 2456
460 Ga0495635_0242685 3300046663 Unclassified 1215
461 Ga0495588_0000179 3300046674 Bacteria 77030
462 Ga0495657_0014113 3300046675 Bacteria 5871
463 Ga0495599_0006457 3300046678 Bacteria 7074
464 Ga0495599_0119765 3300046678 Bacteria 1637
465 Ga0495599_0133382 3300046678 Bacteria 1542
466 Ga0495646_0421904 3300046680 Unclassified 691
467 Ga0495647_0003248 3300046681 Bacteria 5203
468 Ga0495647_0008323 3300046681 Bacteria 3485
469 Ga0495647_0172528 3300046681 Bacteria 937
470 Ga0495647_0307576 3300046681 Bacteria 715
471 Ga0495647_0477971 3300046681 Unclassified 578
472 Ga0495647_0631895 3300046681 Bacteria 504
473 Ga0495658_0000008 3300046683 Bacteria 115426
474 Ga0495658_0098296 3300046683 Bacteria 1743
475 Ga0495669_0000651 3300046684 Bacteria 15129
476 Ga0495669_0015561 3300046684 Bacteria 3258
477 Ga0495613_0000298 3300046689 Bacteria 44864
478 Ga0495613_0000369 3300046689 Bacteria 39198
479 Ga0495613_0481736 3300046689 Bacteria 837
480 Ga0495624_0002296 3300046690 Bacteria 14562
481 Ga0495624_0251287 3300046690 Unclassified 1069
482 Ga0495670_0007059 3300046691 Bacteria 5530
483 Ga0495600_0035731 3300046809 Bacteria 3229
484 Ga0495600_0097188 3300046809 Unclassified 1920
485 Ga0495600_0119424 3300046809 Bacteria 1715
486 Ga0495600_0147749 3300046809 Bacteria 1523
487 Ga0495600_0358097 3300046809 Bacteria 913
488 Ga0495600_0401893 3300046809 Bacteria 852
489 Ga0495604_0000850 3300047317 Bacteria 25489
490 Ga0495604_0050587 3300047317 Bacteria 3226
491 Ga0495604_0235900 3300047317 Unclassified 1253
492 Ga0495604_0974513 3300047317 Bacteria 526
493 Ga0495674_1180442 3300047319 Bacteria 579
494 Ga0495672_0083207 3300047320 Bacteria 1778
495 Ga0495676_0000652 3300047321 Bacteria 28858
496 Ga0495676_0007512 3300047321 Bacteria 9996
497 Ga0495676_0131933 3300047321 Bacteria 1802
498 Ga0495676_0388046 3300047321 Bacteria 928
499 Ga0495676_0636780 3300047321 Bacteria 693
500 Ga0495680_0000215 3300047322 Bacteria 63049
501 Ga0495680_0002422 3300047322 Bacteria 19086
502 Ga0495680_0036038 3300047322 Bacteria 3977
503 Ga0495680_0059144 3300047322 Bacteria 2960
504 Ga0495680_0635733 3300047322 Bacteria 711
505 Ga0495675_0015728 3300047444 Bacteria 4784
506 Ga0495679_009212 3300047446 Bacteria 3966
507 Ga0495685_017740 3300047447 Bacteria 2439
508 Ga0495684_0828614 3300047471 Bacteria 602
509 Ga0495593_0010922 3300047673 Bacteria 5230
510 Ga0495593_0302308 3300047673 Bacteria 800
511 Ga0495593_0560629 3300047673 Bacteria 573
512 Ga0495602_0000010 3300048088 Bacteria 212121
513 Ga0495602_0000188 3300048088 Bacteria 58305
514 Ga0495602_0163145 3300048088 Bacteria 1738
515 Ga0495602_0411448 3300048088 Bacteria 962
516 Ga0495602_0466744 3300048088 Unclassified 888
517 Ga0496100_0000003 3300048903 Bacteria 360802
518 Ga0496100_0000063 3300048903 Bacteria 60957
519 Ga0496101_0000003 3300048904 Bacteria 406565
520 Ga0496101_0000012 3300048904 Bacteria 268127
521 Ga0496101_0932423 3300048904 Bacteria 683
522 Ga0496102_0000965 3300048905 Bacteria 27059
523 Ga0496102_0041849 3300048905 Bacteria 4150
524 Ga0496102_1353218 3300048905 Bacteria 631
525 Ga0496103_0000627 3300048906 Bacteria 27075
526 Ga0496103_0012939 3300048906 Bacteria 4950
527 Ga0496103_0042724 3300048906 Bacteria 2790
528 Ga0496104_0000002 3300048907 Bacteria 686017
529 Ga0496104_0000666 3300048907 Bacteria 29447
530 Ga0496104_0264888 3300048907 Bacteria 1631
531 Ga0496104_1644383 3300048907 Bacteria 545
532 Ga0496105_0000001 3300048908 Bacteria 1328178
533 Ga0496105_0004549 3300048908 Bacteria 10446
534 Ga0496105_0022756 3300048908 Bacteria 5078
535 Ga0496105_0454399 3300048908 Bacteria 1011
536 Ga0496106_0000015 3300048909 Bacteria 187570
537 Ga0496106_0000020 3300048909 Bacteria 169168
538 Ga0496106_0000160 3300048909 Bacteria 48936
539 Ga0496107_0000008 3300048910 Bacteria 251874
540 Ga0496107_0000014 3300048910 Bacteria 176738
541 Ga0496108_0000002 3300048911 Bacteria 700890
542 Ga0496108_0001295 3300048911 Bacteria 19647
543 Ga0496108_0001400 3300048911 Bacteria 18998
544 Ga0496108_0010707 3300048911 Bacteria 7442
545 Ga0496108_1748952 3300048911 Bacteria 510
546 Ga0496109_0000001 3300048912 Bacteria 700852
547 Ga0496109_0000035 3300048912 Bacteria 159744
548 Ga0496109_0000246 3300048912 Bacteria 52127
549 Ga0496109_0000888 3300048912 Bacteria 25009
550 Ga0496109_0042252 3300048912 Bacteria 4129
551 Ga0496109_0662593 3300048912 Bacteria 981
552 Ga0496109_1290188 3300048912 Bacteria 666
553 Ga0496110_0002971 3300048913 Bacteria 12859
554 Ga0496110_0018894 3300048913 Bacteria 5791
555 Ga0496110_0143574 3300048913 Bacteria 2158
556 Ga0496110_0233155 3300048913 Bacteria 1674
557 Ga0496110_1128874 3300048913 Bacteria 692
558 Ga0496110_1902771 3300048913 Bacteria 505
559 Ga0496111_0000022 3300048914 Bacteria 66777
560 Ga0496111_0009354 3300048914 Bacteria 6535
561 Ga0496111_0031644 3300048914 Bacteria 3770
562 Ga0496111_0140500 3300048914 Bacteria 1789
563 Ga0496111_0281843 3300048914 Bacteria 1233
564 Ga0496112_0000003 3300048915 Bacteria 660147
565 Ga0496112_0006530 3300048915 Bacteria 10256
566 Ga0496112_0103593 3300048915 Bacteria 2816
567 Ga0496112_0429113 3300048915 Bacteria 1260
568 Ga0496112_1270242 3300048915 Bacteria 652
569 Ga0496113_0000093 3300048916 Bacteria 38914
570 Ga0496113_0017949 3300048916 Bacteria 4920
571 Ga0496113_0058250 3300048916 Bacteria 2906
572 Ga0496113_0067331 3300048916 Unclassified 2715
573 Ga0496113_0083986 3300048916 Bacteria 2444
574 Ga0496113_0157168 3300048916 Bacteria 1796
575 Ga0496113_0807510 3300048916 Bacteria 745
576 Ga0496114_0000010 3300048917 Bacteria 363396
577 Ga0496114_0030582 3300048917 Bacteria 4431
578 Ga0496114_0287108 3300048917 Bacteria 1451
579 Ga0496114_0589689 3300048917 Bacteria 980
580 Ga0496114_1091197 3300048917 Unclassified 683
581 Ga0496115_0000004 3300048918 Bacteria 319734
582 Ga0496115_0019408 3300048918 Bacteria 5230
583 Ga0496115_0239479 3300048918 Bacteria 1495
584 Ga0496116_0000014 3300048919 Bacteria 569049
585 Ga0496117_0003519 3300048920 Bacteria 18132
586 Ga0496117_0200471 3300048920 Bacteria 1128
587 Ga0496117_0389083 3300048920 Unclassified 707
588 Ga0496118_0002996 3300048921 Bacteria 21807
589 Ga0496118_0244582 3300048921 Bacteria 1024
590 Ga0496118_0325901 3300048921 Unclassified 831
591 Ga0496118_0629171 3300048921 Bacteria 508
592 Ga0496119_0019537 3300048922 Bacteria 4985
593 Ga0496119_0083811 3300048922 Bacteria 1829
594 Ga0496119_0125950 3300048922 Bacteria 1401
595 Ga0496119_0281096 3300048922 Bacteria 827
596 Ga0496120_0009355 3300048923 Bacteria 6964
597 Ga0496120_0049030 3300048923 Bacteria 2426
598 Ga0496121_0215119 3300048924 Bacteria 1358
599 Ga0496121_0368833 3300048924 Unclassified 950
600 Ga0496124_0279512 3300048927 Bacteria 1218
601 Ga0496125_0039010 3300048928 Bacteria 4099
602 Ga0496125_0047605 3300048928 Bacteria 3583
603 Ga0496126_0018873 3300048929 Bacteria 6814
604 Ga0496126_0601407 3300048929 Bacteria 866
605 Ga0496126_0859192 3300048929 Bacteria 691
606 Ga0495678_166368 3300049459 Bacteria 701
607 Ga0501032_0319805 3300049569 Bacteria 1002
608 Ga0501034_0228395 3300049571 Bacteria 1811
609 Ga0501036_0733159 3300049572 Unclassified 816
610 Ga0501038_1139173 3300049574 Unclassified 568
611 Ga0501039_0434263 3300049575 Unclassified 1031
612 Ga0501040_0430317 3300049576 Bacteria 949
613 Ga0501040_1331422 3300049576 Bacteria 521
614 Ga0501041_0805023 3300049577 Bacteria 603
615 Ga0501042_0012267 3300049578 Bacteria 5800
616 Ga0501042_0271107 3300049578 Bacteria 1225
617 Ga0501042_0442095 3300049578 Bacteria 943
618 Ga0501043_0316082 3300049579 Bacteria 1191
619 Ga0501047_0006224 3300049581 Bacteria 11220
620 Ga0501047_0838454 3300049581 Bacteria 733
621 Ga0501047_1230257 3300049581 Bacteria 562
622 Ga0501048_0190513 3300049582 Bacteria 1453
623 Ga0501067_0286369 3300049583 Bacteria 917
624 Ga0501068_0132544 3300049584 Bacteria 1559
625 Ga0501069_0842684 3300049585 Bacteria 556
626 Ga0501070_0016424 3300049586 Bacteria 6220
627 Ga0501070_0082163 3300049586 Bacteria 2666
628 Ga0501070_0420345 3300049586 Bacteria 1080
629 Ga0501071_0088414 3300049587 Bacteria 2273
630 Ga0501072_0104844 3300049588 Bacteria 2248
631 Ga0501072_0147757 3300049588 Bacteria 1874
632 Ga0501073_0166437 3300049589 Bacteria 1527
633 Ga0501076_0046430 3300049592 Bacteria 3432
634 Ga0501076_1623212 3300049592 Bacteria 530
635 Ga0501079_0031923 3300049741 Bacteria 4047
636 Ga0501079_0390869 3300049741 Bacteria 1091
637 Ga0501080_0071013 3300049742 Bacteria 3238
638 Ga0501081_0381156 3300049743 Bacteria 1042
639 Ga0501081_1414562 3300049743 Bacteria 528
640 Ga0501083_0031277 3300049744 Bacteria 3653
641 Ga0501083_0533817 3300049744 Bacteria 763
642 Ga0501044_0164207 3300049823 Bacteria 2195
643 Ga0501044_0610442 3300049823 Bacteria 983
644 Ga0501045_1411418 3300049824 Unclassified 506
645 nmdc:mga0yw44_647867_c1 3300050492 Bacteria 718
646 nmdc:mga05p37_1603939_c1 3300050507 Bacteria 641
647 nmdc:mga0qj67_67177_c1 3300050509 Bacteria 2856
648 nmdc:mga0rr50_462661_c1 3300050513 Bacteria 1076
649 nmdc:mga0a205_155_c1 3300050515 Bacteria 44726
650 nmdc:mga0a205_9_c2 3300050515 Bacteria 69167
651 Ga0495601_0000012 3300053077 Bacteria 227853
652 Ga0495601_0000169 3300053077 Bacteria 35095
653 Ga0495601_0012989 3300053077 Bacteria 5002
654 Ga0495601_0023415 3300053077 Bacteria 3794
655 Ga0495601_0103639 3300053077 Bacteria 1839
656 Ga0495601_0397119 3300053077 Bacteria 894
657 Ga0495612_0001003 3300053078 Bacteria 11610
658 Ga0495612_0017880 3300053078 Bacteria 2837
659 Ga0495612_0039082 3300053078 Bacteria 1929
660 Ga0495612_0076366 3300053078 Bacteria 1403
661 Ga0495655_0000003 3300053083 Bacteria 303053
662 Ga0495595_0001241 3300053084 Bacteria 9932
663 Ga0495595_0375146 3300053084 Unclassified 719
664 Ga0495619_0000018 3300053085 Bacteria 209943
665 Ga0495619_0000408 3300053085 Bacteria 29246
666 Ga0495619_0000758 3300053085 Bacteria 21054
667 Ga0495619_0007151 3300053085 Bacteria 7068
668 Ga0495619_0011996 3300053085 Bacteria 5459
669 Ga0495619_0040276 3300053085 Bacteria 3054
670 Ga0495619_0070764 3300053085 Bacteria 2333
671 Ga0495619_0346693 3300053085 Bacteria 1027
672 Ga0500595_044499 3300053119 Bacteria 1406
673 Ga0500595_059425 3300053119 Bacteria 1159
674 Ga0500614_000374 3300053123 Bacteria 11670
675 Ga0500628_000002 3300053129 Bacteria 357687
676 Ga0500568_0077023 3300053139 Bacteria 1269
677 Ga0501084_0572153 3300054114 Bacteria 955
678 Ga0501082_0308157 3300060353 Bacteria 1379
679 Ga0501082_0841855 3300060353 Bacteria 802
680 Ga0530510_1028374 3300061734 Unclassified 631

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005353 Ga0070669_100486485 Ga0070669_1004864852 69
2 3300005356 Ga0070674_100000011 Ga0070674_1000000114 69
3 3300005456 Ga0070678_100355966 Ga0070678_1003559662 69
4 3300005547 Ga0070693_100815604 Ga0070693_1008156041 69
5 3300005718 Ga0068866_10000002 Ga0068866_1000000252 69
6 3300005841 Ga0068863_100000042 Ga0068863_10000004243 69
7 3300005842 Ga0068858_100000086 Ga0068858_10000008613 69
8 3300005843 Ga0068860_100010275 Ga0068860_1000102753 69
9 3300005983 Ga0081540_1021526 Ga0081540_10215264 69
10 3300006163 Ga0070715_10000015 Ga0070715_10000015115 69
11 3300006173 Ga0070716_100681297 Ga0070716_1006812972 69
12 3300009098 Ga0105245_10000053 Ga0105245_10000053115 69
13 3300009176 Ga0105242_10250629 Ga0105242_102506292 69
14 3300009551 Ga0105238_10000299 Ga0105238_1000029924 69
15 3300010375 Ga0105239_10659490 Ga0105239_106594903 69
16 3300010375 Ga0105239_10889786 Ga0105239_108897862 69
17 3300014326 Ga0157380_10000080 Ga0157380_1000008016 69
18 3300025899 Ga0207642_10000001 Ga0207642_10000001556 69
19 3300025899 Ga0207642_10000003 Ga0207642_10000003556 69
20 3300025905 Ga0207685_10000001 Ga0207685_10000001311 69
21 3300025923 Ga0207681_10360413 Ga0207681_103604132 69
22 3300025924 Ga0207694_10000035 Ga0207694_10000035159 69
23 3300025927 Ga0207687_10000021 Ga0207687_10000021154 69
24 3300025934 Ga0207686_10070529 Ga0207686_100705293 69
25 3300025937 Ga0207669_10000027 Ga0207669_100000274 69
26 3300025939 Ga0207665_11229300 Ga0207665_112293002 69
27 3300026035 Ga0207703_10000072 Ga0207703_1000007283 69
28 3300026088 Ga0207641_10000231 Ga0207641_1000023143 69
29 3300026121 Ga0207683_10121638 Ga0207683_101216384 69
30 3300026121 Ga0207683_11479912 Ga0207683_114799122 69
31 3300046454 Ga0495592_0000521 Ga0495592_0000521_14747_14959 69
32 3300046455 Ga0495603_0004750 Ga0495603_0004750_7275_7484 69
33 3300046459 Ga0495629_0150945 Ga0495629_0150945_705_914 69
34 3300046463 Ga0495653_0217667 Ga0495653_0217667_187_399 69
35 3300046463 Ga0495653_0607979 Ga0495653_0607979_302_511 69
36 3300046511 Ga0495608_0100950 Ga0495608_0100950_159_368 69
37 3300046514 Ga0495618_0503988 Ga0495618_0503988_90_299 69
38 3300046516 Ga0495628_0201839 Ga0495628_0201839_849_1058 69
39 3300046533 Ga0495640_0151885 Ga0495640_0151885_544_753 69
40 3300046536 Ga0495587_0356779 Ga0495587_0356779_412_621 69
41 3300046559 Ga0495667_0098396 Ga0495667_0098396_506_715 69
42 3300046642 Ga0495634_0001471 Ga0495634_0001471_18891_19100 69
43 3300046675 Ga0495657_0014113 Ga0495657_0014113_2714_2926 69
44 3300046681 Ga0495647_0477971 Ga0495647_0477971_13_222 69
45 3300046689 Ga0495613_0000369 Ga0495613_0000369_35974_36186 69
46 3300046809 Ga0495600_0401893 Ga0495600_0401893_44_253 69
47 3300048907 Ga0496104_0000666 Ga0496104_0000666_66_275 69
48 3300048908 Ga0496105_0004549 Ga0496105_0004549_3233_3442 69
49 3300048909 Ga0496106_0000160 Ga0496106_0000160_22685_22894 69
50 3300048911 Ga0496108_0000002 Ga0496108_0000002_68543_68752 69
51 3300048912 Ga0496109_0000001 Ga0496109_0000001_68505_68714 69
52 3300048928 Ga0496125_0047605 Ga0496125_0047605_1902_2111 69
53 3300049743 Ga0501081_0381156 Ga0501081_0381156_430_639 69
54 3300005329 Ga0070683_100271872 Ga0070683_1002718721 71
55 3300005337 Ga0070682_100000815 Ga0070682_1000008158 71
56 3300005338 Ga0068868_100004232 Ga0068868_10000423212 71
57 3300005344 Ga0070661_100000161 Ga0070661_1000001619 71
58 3300005347 Ga0070668_100295683 Ga0070668_1002956833 71
59 3300005364 Ga0070673_100365643 Ga0070673_1003656433 71
60 3300005365 Ga0070688_100000453 Ga0070688_10000045320 71
61 3300005441 Ga0070700_100450694 Ga0070700_1004506943 71
62 3300005564 Ga0070664_100093697 Ga0070664_1000936972 71
63 3300005578 Ga0068854_100000115 Ga0068854_10000011547 71
64 3300005834 Ga0068851_10001867 Ga0068851_100018677 71
65 3300005840 Ga0068870_10115813 Ga0068870_101158133 71
66 3300006163 Ga0070715_10085070 Ga0070715_100850702 71
67 3300006163 Ga0070715_10208143 Ga0070715_102081432 71
68 3300009098 Ga0105245_10002749 Ga0105245_1000274917 71
69 3300009148 Ga0105243_10004998 Ga0105243_100049989 71
70 3300009174 Ga0105241_10590912 Ga0105241_105909123 71
71 3300010375 Ga0105239_10050654 Ga0105239_100506548 71
72 3300013306 Ga0163162_10078269 Ga0163162_100782694 71
73 3300013307 Ga0157372_10000616 Ga0157372_1000061617 71
74 3300013308 Ga0157375_10008882 Ga0157375_100088825 71
75 3300013308 Ga0157375_11956333 Ga0157375_119563332 71
76 3300017792 Ga0163161_10009328 Ga0163161_100093284 71
77 3300020081 Ga0206354_11092466 Ga0206354_110924663 71
78 3300020082 Ga0206353_11601057 Ga0206353_116010573 71
79 3300025321 Ga0207656_10000354 Ga0207656_1000035413 71
80 3300025908 Ga0207643_10134307 Ga0207643_101343073 71
81 3300025909 Ga0207705_10974544 Ga0207705_109745442 71
82 3300025911 Ga0207654_10270279 Ga0207654_102702793 71
83 3300025920 Ga0207649_10000024 Ga0207649_1000002455 71
84 3300025927 Ga0207687_10000350 Ga0207687_1000035019 71
85 3300025935 Ga0207709_10390025 Ga0207709_103900252 71
86 3300025944 Ga0207661_10035924 Ga0207661_100359244 71
87 3300025945 Ga0207679_10010691 Ga0207679_100106917 71
88 3300025972 Ga0207668_10099829 Ga0207668_100998293 71
89 3300025981 Ga0207640_10000059 Ga0207640_1000005943 71
90 3300026023 Ga0207677_10004273 Ga0207677_100042733 71
91 3300026067 Ga0207678_10334069 Ga0207678_103340693 71
92 3300026075 Ga0207708_10183890 Ga0207708_101838901 71
93 3300041460 Ga0451802_0624704 Ga0451802_0624704_57_272 71
94 3300041486 Ga0451807_1911921 Ga0451807_1911921_74_289 71
95 3300041496 Ga0451839_0881515 Ga0451839_0881515_251_466 71
96 3300041501 Ga0451845_0341957 Ga0451845_0341957_573_788 71
97 3300041512 Ga0451853_2031101 Ga0451853_2031101_422_637 71
98 3300048913 Ga0496110_0002971 Ga0496110_0002971_5140_5355 71
99 3300048914 Ga0496111_0000022 Ga0496111_0000022_10555_10770 71
100 3300048915 Ga0496112_0006530 Ga0496112_0006530_5185_5400 71
101 3300048916 Ga0496113_0000093 Ga0496113_0000093_21558_21773 71
102 3300049578 Ga0501042_0271107 Ga0501042_0271107_189_404 71
103 3300053085 Ga0495619_0000018 Ga0495619_0000018_150499_150714 71
104 3300005331 Ga0070670_100129379 Ga0070670_1001293791 72
105 3300005366 Ga0070659_100009701 Ga0070659_1000097014 72
106 3300005436 Ga0070713_100000076 Ga0070713_10000007635 72
107 3300009176 Ga0105242_10238304 Ga0105242_102383044 72
108 3300013100 Ga0157373_10496552 Ga0157373_104965522 72
109 3300025928 Ga0207700_10000009 Ga0207700_10000009218 72
110 3300025932 Ga0207690_10006983 Ga0207690_100069833 72
111 3300025934 Ga0207686_11086241 Ga0207686_110862411 72
112 3300041512 Ga0451853_0215495 Ga0451853_0215495_57_275 72
113 3300044694 Ga0466963_0010933 Ga0466963_0010933_1821_2039 72
114 3300044694 Ga0466963_0028080 Ga0466963_0028080_1386_1604 72
115 3300045976 Ga0466967_0155107 Ga0466967_0155107_1088_1306 72
116 3300046461 Ga0495641_0022741 Ga0495641_0022741_435_653 72
117 3300046674 Ga0495588_0000179 Ga0495588_0000179_2540_2758 72
118 3300046689 Ga0495613_0000298 Ga0495613_0000298_44556_44774 72
119 3300046809 Ga0495600_0097188 Ga0495600_0097188_894_1112 72
120 3300046809 Ga0495600_0147749 Ga0495600_0147749_121_339 72
121 3300047317 Ga0495604_0000850 Ga0495604_0000850_19281_19499 72
122 3300047319 Ga0495674_1180442 Ga0495674_1180442_284_502 72
123 3300047321 Ga0495676_0388046 Ga0495676_0388046_345_566 72
124 3300048088 Ga0495602_0000010 Ga0495602_0000010_187451_187669 72
125 3300048907 Ga0496104_0264888 Ga0496104_0264888_1261_1479 72
126 3300048912 Ga0496109_0662593 Ga0496109_0662593_554_772 72
127 3300048916 Ga0496113_0067331 Ga0496113_0067331_285_503 72
128 3300053077 Ga0495601_0000012 Ga0495601_0000012_185731_185949 72
129 3300053084 Ga0495595_0001241 Ga0495595_0001241_4602_4820 72
130 3300001979 JGI24740J21852_10005676 JGI24740J21852_100056767 73
131 3300003659 JGI25404J52841_10017023 JGI25404J52841_100170231 73
132 3300005329 Ga0070683_100002929 Ga0070683_10000292913 73
133 3300005329 Ga0070683_101206817 Ga0070683_1012068172 73
134 3300005331 Ga0070670_101590203 Ga0070670_1015902031 73
135 3300005335 Ga0070666_10010127 Ga0070666_100101276 73
136 3300005335 Ga0070666_10023706 Ga0070666_100237062 73
137 3300005341 Ga0070691_10000069 Ga0070691_1000006913 73
138 3300005347 Ga0070668_100018528 Ga0070668_1000185288 73
139 3300005353 Ga0070669_101134422 Ga0070669_1011344222 73
140 3300005354 Ga0070675_100000153 Ga0070675_10000015323 73
141 3300005355 Ga0070671_100738930 Ga0070671_1007389302 73
142 3300005367 Ga0070667_100001368 Ga0070667_1000013689 73
143 3300005367 Ga0070667_100102281 Ga0070667_1001022814 73
144 3300005435 Ga0070714_100008340 Ga0070714_1000083402 73
145 3300005437 Ga0070710_10770198 Ga0070710_107701982 73
146 3300005455 Ga0070663_100012594 Ga0070663_1000125943 73
147 3300005458 Ga0070681_10463432 Ga0070681_104634323 73
148 3300005466 Ga0070685_10000203 Ga0070685_1000020324 73
149 3300005530 Ga0070679_100114971 Ga0070679_1001149713 73
150 3300005535 Ga0070684_100033478 Ga0070684_1000334784 73
151 3300005535 Ga0070684_100061999 Ga0070684_1000619992 73
152 3300005535 Ga0070684_100541613 Ga0070684_1005416133 73
153 3300005539 Ga0068853_100810114 Ga0068853_1008101141 73
154 3300005544 Ga0070686_101552802 Ga0070686_1015528021 73
155 3300005545 Ga0070695_100763658 Ga0070695_1007636582 73
156 3300005548 Ga0070665_100002483 Ga0070665_1000024839 73
157 3300005548 Ga0070665_100022800 Ga0070665_1000228006 73
158 3300005548 Ga0070665_100047809 Ga0070665_1000478096 73
159 3300005548 Ga0070665_101688485 Ga0070665_1016884852 73
160 3300005549 Ga0070704_100596651 Ga0070704_1005966512 73
161 3300005563 Ga0068855_100149600 Ga0068855_1001496003 73
162 3300005577 Ga0068857_100501548 Ga0068857_1005015483 73
163 3300005614 Ga0068856_100000057 Ga0068856_10000005752 73
164 3300005614 Ga0068856_100020527 Ga0068856_1000205275 73
165 3300005615 Ga0070702_100002851 Ga0070702_1000028513 73
166 3300005616 Ga0068852_100000058 Ga0068852_10000005829 73
167 3300005617 Ga0068859_101172030 Ga0068859_1011720302 73
168 3300005718 Ga0068866_10104165 Ga0068866_101041653 73
169 3300005834 Ga0068851_10022934 Ga0068851_100229342 73
170 3300005841 Ga0068863_100003904 Ga0068863_10000390410 73
171 3300005843 Ga0068860_100194561 Ga0068860_1001945614 73
172 3300005843 Ga0068860_102556009 Ga0068860_1025560092 73
173 3300005844 Ga0068862_100010337 Ga0068862_1000103375 73
174 3300005844 Ga0068862_100742992 Ga0068862_1007429923 73
175 3300005937 Ga0081455_10100357 Ga0081455_101003571 73
176 3300005983 Ga0081540_1000546 Ga0081540_100054619 73
177 3300005985 Ga0081539_10001100 Ga0081539_1000110040 73
178 3300005985 Ga0081539_10489412 Ga0081539_104894121 73
179 3300006038 Ga0075365_10309978 Ga0075365_103099782 73
180 3300006175 Ga0070712_100001300 Ga0070712_1000013004 73
181 3300006846 Ga0075430_100077761 Ga0075430_1000777613 73
182 3300006852 Ga0075433_10003490 Ga0075433_100034902 73
183 3300006881 Ga0068865_100000020 Ga0068865_10000002020 73
184 3300006881 Ga0068865_100258678 Ga0068865_1002586782 73
185 3300006931 Ga0097620_101172093 Ga0097620_1011720932 73
186 3300007076 Ga0075435_100768870 Ga0075435_1007688702 73
187 3300009093 Ga0105240_10694108 Ga0105240_106941082 73
188 3300009098 Ga0105245_10000159 Ga0105245_1000015942 73
189 3300009101 Ga0105247_10000993 Ga0105247_1000099316 73
190 3300009101 Ga0105247_10104372 Ga0105247_101043722 73
191 3300009147 Ga0114129_10743544 Ga0114129_107435443 73
192 3300009174 Ga0105241_11710066 Ga0105241_117100662 73
193 3300009176 Ga0105242_10000017 Ga0105242_10000017100 73
194 3300009176 Ga0105242_10002766 Ga0105242_1000276611 73
195 3300009177 Ga0105248_10000022 Ga0105248_10000022252 73
196 3300009553 Ga0105249_10000085 Ga0105249_1000008521 73
197 3300009553 Ga0105249_10000841 Ga0105249_1000084112 73
198 3300010375 Ga0105239_10423863 Ga0105239_104238633 73
199 3300010375 Ga0105239_10645854 Ga0105239_106458543 73
200 3300010375 Ga0105239_11936167 Ga0105239_119361671 73
201 3300010375 Ga0105239_13631877 Ga0105239_136318772 73
202 3300013102 Ga0157371_10004276 Ga0157371_1000427611 73
203 3300013104 Ga0157370_10187874 Ga0157370_101878742 73
204 3300013296 Ga0157374_10074388 Ga0157374_100743883 73
205 3300013296 Ga0157374_10297473 Ga0157374_102974733 73
206 3300013297 Ga0157378_10092044 Ga0157378_100920442 73
207 3300013297 Ga0157378_10386968 Ga0157378_103869682 73
208 3300013306 Ga0163162_10166902 Ga0163162_101669023 73
209 3300013307 Ga0157372_12564454 Ga0157372_125644542 73
210 3300013308 Ga0157375_10664790 Ga0157375_106647902 73
211 3300013308 Ga0157375_11937808 Ga0157375_119378082 73
212 3300014325 Ga0163163_10164392 Ga0163163_101643924 73
213 3300014326 Ga0157380_10000024 Ga0157380_1000002427 73
214 3300014326 Ga0157380_10514808 Ga0157380_105148082 73
215 3300014968 Ga0157379_10055979 Ga0157379_100559793 73
216 3300014968 Ga0157379_10125057 Ga0157379_101250573 73
217 3300014969 Ga0157376_10035064 Ga0157376_100350645 73
218 3300020069 Ga0197907_11298225 Ga0197907_112982252 73
219 3300020070 Ga0206356_11661110 Ga0206356_116611103 73
220 3300022467 Ga0224712_10163623 Ga0224712_101636231 73
221 3300025321 Ga0207656_10004306 Ga0207656_100043064 73
222 3300025893 Ga0207682_10000228 Ga0207682_100002284 73
223 3300025898 Ga0207692_10784804 Ga0207692_107848042 73
224 3300025899 Ga0207642_10026554 Ga0207642_100265542 73
225 3300025900 Ga0207710_10000151 Ga0207710_1000015134 73
226 3300025903 Ga0207680_10048971 Ga0207680_100489714 73
227 3300025903 Ga0207680_10272508 Ga0207680_102725082 73
228 3300025911 Ga0207654_11125583 Ga0207654_111255832 73
229 3300025912 Ga0207707_10065523 Ga0207707_100655234 73
230 3300025915 Ga0207693_10000859 Ga0207693_100008595 73
231 3300025917 Ga0207660_10650918 Ga0207660_106509181 73
232 3300025920 Ga0207649_10328326 Ga0207649_103283263 73
233 3300025921 Ga0207652_10015731 Ga0207652_100157316 73
234 3300025923 Ga0207681_10902401 Ga0207681_109024012 73
235 3300025925 Ga0207650_10829818 Ga0207650_108298182 73
236 3300025926 Ga0207659_10000043 Ga0207659_1000004326 73
237 3300025927 Ga0207687_10000011 Ga0207687_10000011351 73
238 3300025927 Ga0207687_11238758 Ga0207687_112387582 73
239 3300025929 Ga0207664_10056834 Ga0207664_100568343 73
240 3300025929 Ga0207664_10081702 Ga0207664_100817024 73
241 3300025933 Ga0207706_11416642 Ga0207706_114166422 73
242 3300025934 Ga0207686_10000016 Ga0207686_10000016100 73
243 3300025934 Ga0207686_10000029 Ga0207686_1000002955 73
244 3300025934 Ga0207686_10000549 Ga0207686_1000054910 73
245 3300025938 Ga0207704_10000004 Ga0207704_10000004172 73
246 3300025938 Ga0207704_10294588 Ga0207704_102945883 73
247 3300025938 Ga0207704_10323007 Ga0207704_103230072 73
248 3300025941 Ga0207711_10000019 Ga0207711_1000001987 73
249 3300025944 Ga0207661_10000142 Ga0207661_1000014238 73
250 3300025944 Ga0207661_10001987 Ga0207661_100019875 73
251 3300025944 Ga0207661_10142891 Ga0207661_101428912 73
252 3300025944 Ga0207661_10935637 Ga0207661_109356372 73
253 3300025949 Ga0207667_10360611 Ga0207667_103606113 73
254 3300025961 Ga0207712_10000033 Ga0207712_1000003329 73
255 3300025961 Ga0207712_10009331 Ga0207712_100093315 73
256 3300025981 Ga0207640_10001105 Ga0207640_100011059 73
257 3300025986 Ga0207658_10001768 Ga0207658_100017683 73
258 3300025986 Ga0207658_10117944 Ga0207658_101179442 73
259 3300026041 Ga0207639_10773149 Ga0207639_107731491 73
260 3300026067 Ga0207678_10074841 Ga0207678_100748413 73
261 3300026078 Ga0207702_10000027 Ga0207702_1000002795 73
262 3300026078 Ga0207702_10014910 Ga0207702_100149104 73
263 3300026088 Ga0207641_10002660 Ga0207641_1000266011 73
264 3300026088 Ga0207641_11890617 Ga0207641_118906172 73
265 3300026116 Ga0207674_10541945 Ga0207674_105419452 73
266 3300026118 Ga0207675_100546644 Ga0207675_1005466443 73
267 3300026121 Ga0207683_10010360 Ga0207683_100103607 73
268 3300026142 Ga0207698_10000002 Ga0207698_10000002170 73
269 3300026142 Ga0207698_10483913 Ga0207698_104839133 73
270 3300028379 Ga0268266_10000664 Ga0268266_1000066432 73
271 3300028379 Ga0268266_10004334 Ga0268266_1000433412 73
272 3300028379 Ga0268266_10194892 Ga0268266_101948923 73
273 3300028379 Ga0268266_10530272 Ga0268266_105302722 73
274 3300028380 Ga0268265_10054427 Ga0268265_100544275 73
275 3300028381 Ga0268264_10070092 Ga0268264_100700923 73
276 3300028381 Ga0268264_10882427 Ga0268264_108824272 73
277 3300028556 Ga0265337_1000004 Ga0265337_100000455 73
278 3300028558 Ga0265326_10000091 Ga0265326_1000009111 73
279 3300028563 Ga0265319_1000029 Ga0265319_100002933 73
280 3300028563 Ga0265319_1053753 Ga0265319_10537533 73
281 3300028654 Ga0265322_10000006 Ga0265322_1000000655 73
282 3300028654 Ga0265322_10200866 Ga0265322_102008662 73
283 3300028666 Ga0265336_10012904 Ga0265336_100129043 73
284 3300028666 Ga0265336_10055192 Ga0265336_100551921 73
285 3300028800 Ga0265338_10000179 Ga0265338_1000017941 73
286 3300028800 Ga0265338_10129959 Ga0265338_101299594 73
287 3300029957 Ga0265324_10000185 Ga0265324_1000018540 73
288 3300029957 Ga0265324_10041275 Ga0265324_100412754 73
289 3300031238 Ga0265332_10134902 Ga0265332_101349022 73
290 3300031239 Ga0265328_10005073 Ga0265328_100050737 73
291 3300031240 Ga0265320_10000001 Ga0265320_10000001524 73
292 3300031241 Ga0265325_10011215 Ga0265325_100112154 73
293 3300031242 Ga0265329_10010765 Ga0265329_100107654 73
294 3300031249 Ga0265339_10051548 Ga0265339_100515484 73
295 3300031250 Ga0265331_10001249 Ga0265331_1000124917 73
296 3300031251 Ga0265327_10000003 Ga0265327_10000003524 73
297 3300031344 Ga0265316_10016212 Ga0265316_100162124 73
298 3300031595 Ga0265313_10114404 Ga0265313_101144043 73
299 3300031595 Ga0265313_10291529 Ga0265313_102915292 73
300 3300031665 Ga0316575_10290042 Ga0316575_102900421 73
301 3300031711 Ga0265314_10000535 Ga0265314_1000053548 73
302 3300031712 Ga0265342_10213099 Ga0265342_102130992 73
303 3300032002 Ga0307416_100953691 Ga0307416_1009536912 73
304 3300032126 Ga0307415_100180956 Ga0307415_1001809563 73
305 3300032133 Ga0316583_10123813 Ga0316583_101238132 73
306 3300041451 Ga0451791_1480066 Ga0451791_1480066_259_480 73
307 3300041459 Ga0451800_0979465 Ga0451800_0979465_520_741 73
308 3300041486 Ga0451807_2679065 Ga0451807_2679065_56_277 73
309 3300041492 Ga0451835_0616804 Ga0451835_0616804_53_274 73
310 3300041512 Ga0451853_0013456 Ga0451853_0013456_311_532 73
311 3300044683 Ga0466965_0486456 Ga0466965_0486456_240_461 73
312 3300044694 Ga0466963_0000124 Ga0466963_0000124_4158_4379 73
313 3300044842 Ga0466957_0008475 Ga0466957_0008475_3608_3829 73
314 3300044901 Ga0466960_0582468 Ga0466960_0582468_118_339 73
315 3300045836 Ga0466958_0061588 Ga0466958_0061588_727_948 73
316 3300045976 Ga0466967_0000008 Ga0466967_0000008_70934_71155 73
317 3300046454 Ga0495592_0064755 Ga0495592_0064755_1384_1605 73
318 3300046455 Ga0495603_0000045 Ga0495603_0000045_4631_4852 73
319 3300046455 Ga0495603_0000622 Ga0495603_0000622_1201_1422 73
320 3300046459 Ga0495629_0001391 Ga0495629_0001391_11595_11816 73
321 3300046460 Ga0495638_0005536 Ga0495638_0005536_8393_8614 73
322 3300046462 Ga0495651_0991179 Ga0495651_0991179_106_327 73
323 3300046475 Ga0495639_0030389 Ga0495639_0030389_1248_1469 73
324 3300046476 Ga0495662_0009206 Ga0495662_0009206_1073_1294 73
325 3300046499 Ga0495594_0000276 Ga0495594_0000276_6256_6477 73
326 3300046512 Ga0495610_0112349 Ga0495610_0112349_24_245 73
327 3300046514 Ga0495618_0858040 Ga0495618_0858040_262_483 73
328 3300046515 Ga0495620_0001840 Ga0495620_0001840_9651_9872 73
329 3300046516 Ga0495628_0000858 Ga0495628_0000858_3065_3286 73
330 3300046517 Ga0495630_0000037 Ga0495630_0000037_5444_5665 73
331 3300046517 Ga0495630_0739763 Ga0495630_0739763_158_379 73
332 3300046529 Ga0495652_0000086 Ga0495652_0000086_32814_33035 73
333 3300046529 Ga0495652_0060323 Ga0495652_0060323_1024_1245 73
334 3300046535 Ga0495586_0007201 Ga0495586_0007201_4710_4931 73
335 3300046535 Ga0495586_0598951 Ga0495586_0598951_52_276 73
336 3300046536 Ga0495587_0001022 Ga0495587_0001022_12025_12246 73
337 3300046536 Ga0495587_0054135 Ga0495587_0054135_1753_1974 73
338 3300046536 Ga0495587_0541880 Ga0495587_0541880_78_299 73
339 3300046542 Ga0495597_0211600 Ga0495597_0211600_107_328 73
340 3300046543 Ga0495645_0024357 Ga0495645_0024357_538_759 73
341 3300046557 Ga0495622_0000690 Ga0495622_0000690_18211_18432 73
342 3300046559 Ga0495667_0000044 Ga0495667_0000044_19142_19363 73
343 3300046660 Ga0495625_0001659 Ga0495625_0001659_4855_5076 73
344 3300046678 Ga0495599_0133382 Ga0495599_0133382_372_593 73
345 3300046681 Ga0495647_0008323 Ga0495647_0008323_1964_2185 73
346 3300046681 Ga0495647_0307576 Ga0495647_0307576_348_569 73
347 3300046683 Ga0495658_0098296 Ga0495658_0098296_858_1079 73
348 3300046684 Ga0495669_0000651 Ga0495669_0000651_11994_12215 73
349 3300046689 Ga0495613_0481736 Ga0495613_0481736_233_454 73
350 3300046690 Ga0495624_0002296 Ga0495624_0002296_5391_5612 73
351 3300047320 Ga0495672_0083207 Ga0495672_0083207_1322_1543 73
352 3300047321 Ga0495676_0000652 Ga0495676_0000652_2836_3057 73
353 3300047321 Ga0495676_0007512 Ga0495676_0007512_8546_8767 73
354 3300047321 Ga0495676_0636780 Ga0495676_0636780_78_299 73
355 3300047322 Ga0495680_0002422 Ga0495680_0002422_1363_1584 73
356 3300047444 Ga0495675_0015728 Ga0495675_0015728_2510_2731 73
357 3300047471 Ga0495684_0828614 Ga0495684_0828614_39_260 73
358 3300047673 Ga0495593_0010922 Ga0495593_0010922_3348_3569 73
359 3300048088 Ga0495602_0000188 Ga0495602_0000188_56801_57022 73
360 3300048088 Ga0495602_0163145 Ga0495602_0163145_1328_1549 73
361 3300048088 Ga0495602_0411448 Ga0495602_0411448_162_383 73
362 3300048903 Ga0496100_0000003 Ga0496100_0000003_196972_197193 73
363 3300048903 Ga0496100_0000063 Ga0496100_0000063_11904_12125 73
364 3300048904 Ga0496101_0000003 Ga0496101_0000003_196972_197193 73
365 3300048904 Ga0496101_0000012 Ga0496101_0000012_265054_265275 73
366 3300048904 Ga0496101_0932423 Ga0496101_0932423_13_234 73
367 3300048905 Ga0496102_0000965 Ga0496102_0000965_11848_12069 73
368 3300048905 Ga0496102_0041849 Ga0496102_0041849_3229_3450 73
369 3300048905 Ga0496102_1353218 Ga0496102_1353218_350_571 73
370 3300048906 Ga0496103_0000627 Ga0496103_0000627_11864_12085 73
371 3300048906 Ga0496103_0012939 Ga0496103_0012939_4252_4473 73
372 3300048906 Ga0496103_0042724 Ga0496103_0042724_209_430 73
373 3300048907 Ga0496104_0000002 Ga0496104_0000002_123345_123566 73
374 3300048908 Ga0496105_0000001 Ga0496105_0000001_1204613_1204834 73
375 3300048909 Ga0496106_0000015 Ga0496106_0000015_65384_65605 73
376 3300048909 Ga0496106_0000020 Ga0496106_0000020_164555_164776 73
377 3300048910 Ga0496107_0000008 Ga0496107_0000008_88032_88253 73
378 3300048910 Ga0496107_0000014 Ga0496107_0000014_164544_164765 73
379 3300048911 Ga0496108_0001400 Ga0496108_0001400_7115_7336 73
380 3300048912 Ga0496109_0000246 Ga0496109_0000246_40285_40506 73
381 3300048913 Ga0496110_1128874 Ga0496110_1128874_405_626 73
382 3300048913 Ga0496110_1902771 Ga0496110_1902771_239_460 73
383 3300048914 Ga0496111_0031644 Ga0496111_0031644_771_995 73
384 3300048915 Ga0496112_0000003 Ga0496112_0000003_638215_638436 73
385 3300048916 Ga0496113_0157168 Ga0496113_0157168_658_879 73
386 3300048916 Ga0496113_0807510 Ga0496113_0807510_429_650 73
387 3300048917 Ga0496114_0000010 Ga0496114_0000010_273596_273817 73
388 3300048917 Ga0496114_0287108 Ga0496114_0287108_56_277 73
389 3300048917 Ga0496114_1091197 Ga0496114_1091197_333_554 73
390 3300048918 Ga0496115_0000004 Ga0496115_0000004_271241_271462 73
391 3300048918 Ga0496115_0019408 Ga0496115_0019408_2105_2326 73
392 3300048918 Ga0496115_0239479 Ga0496115_0239479_276_497 73
393 3300048919 Ga0496116_0000014 Ga0496116_0000014_295667_295888 73
394 3300048920 Ga0496117_0003519 Ga0496117_0003519_17449_17670 73
395 3300048920 Ga0496117_0200471 Ga0496117_0200471_796_1017 73
396 3300048920 Ga0496117_0389083 Ga0496117_0389083_143_364 73
397 3300048921 Ga0496118_0002996 Ga0496118_0002996_17692_17913 73
398 3300048921 Ga0496118_0244582 Ga0496118_0244582_137_358 73
399 3300048921 Ga0496118_0325901 Ga0496118_0325901_262_483 73
400 3300048921 Ga0496118_0629171 Ga0496118_0629171_252_473 73
401 3300048922 Ga0496119_0019537 Ga0496119_0019537_1304_1525 73
402 3300048922 Ga0496119_0083811 Ga0496119_0083811_1440_1661 73
403 3300048922 Ga0496119_0125950 Ga0496119_0125950_381_602 73
404 3300048922 Ga0496119_0281096 Ga0496119_0281096_41_262 73
405 3300048923 Ga0496120_0009355 Ga0496120_0009355_6269_6490 73
406 3300048923 Ga0496120_0049030 Ga0496120_0049030_1014_1235 73
407 3300048924 Ga0496121_0215119 Ga0496121_0215119_515_736 73
408 3300048924 Ga0496121_0368833 Ga0496121_0368833_710_931 73
409 3300048927 Ga0496124_0279512 Ga0496124_0279512_103_324 73
410 3300048928 Ga0496125_0039010 Ga0496125_0039010_3550_3771 73
411 3300048929 Ga0496126_0018873 Ga0496126_0018873_3756_3977 73
412 3300048929 Ga0496126_0601407 Ga0496126_0601407_613_834 73
413 3300048929 Ga0496126_0859192 Ga0496126_0859192_344_565 73
414 3300049459 Ga0495678_166368 Ga0495678_166368_386_607 73
415 3300049569 Ga0501032_0319805 Ga0501032_0319805_453_674 73
416 3300049571 Ga0501034_0228395 Ga0501034_0228395_502_723 73
417 3300049574 Ga0501038_1139173 Ga0501038_1139173_118_339 73
418 3300049579 Ga0501043_0316082 Ga0501043_0316082_225_446 73
419 3300049581 Ga0501047_0006224 Ga0501047_0006224_10941_11162 73
420 3300049581 Ga0501047_0838454 Ga0501047_0838454_454_675 73
421 3300049581 Ga0501047_1230257 Ga0501047_1230257_320_541 73
422 3300049582 Ga0501048_0190513 Ga0501048_0190513_635_856 73
423 3300049583 Ga0501067_0286369 Ga0501067_0286369_302_523 73
424 3300049584 Ga0501068_0132544 Ga0501068_0132544_379_600 73
425 3300049585 Ga0501069_0842684 Ga0501069_0842684_291_512 73
426 3300049586 Ga0501070_0016424 Ga0501070_0016424_3957_4178 73
427 3300049586 Ga0501070_0082163 Ga0501070_0082163_367_588 73
428 3300049587 Ga0501071_0088414 Ga0501071_0088414_402_623 73
429 3300049588 Ga0501072_0104844 Ga0501072_0104844_340_561 73
430 3300049589 Ga0501073_0166437 Ga0501073_0166437_498_719 73
431 3300049592 Ga0501076_0046430 Ga0501076_0046430_514_735 73
432 3300049741 Ga0501079_0031923 Ga0501079_0031923_3014_3235 73
433 3300049742 Ga0501080_0071013 Ga0501080_0071013_1083_1304 73
434 3300049744 Ga0501083_0031277 Ga0501083_0031277_2174_2395 73
435 3300049744 Ga0501083_0533817 Ga0501083_0533817_98_319 73
436 3300049823 Ga0501044_0164207 Ga0501044_0164207_1729_1950 73
437 3300049823 Ga0501044_0610442 Ga0501044_0610442_11_232 73
438 3300050492 nmdc:mga0yw44_647867_c1 nmdc:mga0yw44_647867_c1_266_490 73
439 3300050507 nmdc:mga05p37_1603939_c1 nmdc:mga05p37_1603939_c1_174_395 73
440 3300050509 nmdc:mga0qj67_67177_c1 nmdc:mga0qj67_67177_c1_1856_2077 73
441 3300050513 nmdc:mga0rr50_462661_c1 nmdc:mga0rr50_462661_c1_802_1023 73
442 3300050515 nmdc:mga0a205_9_c2 nmdc:mga0a205_9_c2_68056_68277 73
443 3300053077 Ga0495601_0397119 Ga0495601_0397119_190_411 73
444 3300053078 Ga0495612_0076366 Ga0495612_0076366_469_693 73
445 3300053083 Ga0495655_0000003 Ga0495655_0000003_195950_196171 73
446 3300053119 Ga0500595_044499 Ga0500595_044499_435_656 73
447 3300053119 Ga0500595_059425 Ga0500595_059425_481_702 73
448 3300053129 Ga0500628_000002 Ga0500628_000002_195950_196171 73
449 3300053139 Ga0500568_0077023 Ga0500568_0077023_386_607 73
450 3300060353 Ga0501082_0841855 Ga0501082_0841855_55_276 73
451 3300005329 Ga0070683_100015414 Ga0070683_1000154144 74
452 3300005338 Ga0068868_101612469 Ga0068868_1016124692 74
453 3300005356 Ga0070674_100106832 Ga0070674_1001068324 74
454 3300005439 Ga0070711_100546033 Ga0070711_1005460333 74
455 3300005535 Ga0070684_100022755 Ga0070684_1000227554 74
456 3300005545 Ga0070695_101345322 Ga0070695_1013453221 74
457 3300005546 Ga0070696_100880147 Ga0070696_1008801471 74
458 3300006237 Ga0097621_100734357 Ga0097621_1007343572 74
459 3300006358 Ga0068871_100576412 Ga0068871_1005764122 74
460 3300011119 Ga0105246_11428851 Ga0105246_114288512 74
461 3300013308 Ga0157375_10302567 Ga0157375_103025672 74
462 3300025900 Ga0207710_10112969 Ga0207710_101129693 74
463 3300025909 Ga0207705_10091476 Ga0207705_100914764 74
464 3300025916 Ga0207663_10121651 Ga0207663_101216512 74
465 3300025924 Ga0207694_10818072 Ga0207694_108180722 74
466 3300025937 Ga0207669_10213635 Ga0207669_102136352 74
467 3300045976 Ga0466967_0038536 Ga0466967_0038536_2287_2511 74
468 3300046459 Ga0495629_0001361 Ga0495629_0001361_6835_7059 74
469 3300046459 Ga0495629_0361790 Ga0495629_0361790_478_705 74
470 3300046476 Ga0495662_0000137 Ga0495662_0000137_12861_13088 74
471 3300046507 Ga0495606_0000045 Ga0495606_0000045_23556_23780 74
472 3300046539 Ga0495621_0011410 Ga0495621_0011410_1973_2197 74
473 3300046642 Ga0495634_0004564 Ga0495634_0004564_10096_10323 74
474 3300046681 Ga0495647_0003248 Ga0495647_0003248_2161_2388 74
475 3300046681 Ga0495647_0172528 Ga0495647_0172528_491_718 74
476 3300046684 Ga0495669_0015561 Ga0495669_0015561_1997_2224 74
477 3300048908 Ga0496105_0454399 Ga0496105_0454399_746_973 74
478 3300048911 Ga0496108_0010707 Ga0496108_0010707_6218_6442 74
479 3300048911 Ga0496108_1748952 Ga0496108_1748952_226_453 74
480 3300048912 Ga0496109_0042252 Ga0496109_0042252_2755_2979 74
481 3300048912 Ga0496109_1290188 Ga0496109_1290188_236_463 74
482 3300048913 Ga0496110_0143574 Ga0496110_0143574_785_1009 74
483 3300048914 Ga0496111_0140500 Ga0496111_0140500_285_509 74
484 3300048914 Ga0496111_0281843 Ga0496111_0281843_684_911 74
485 3300048915 Ga0496112_1270242 Ga0496112_1270242_294_518 74
486 3300048916 Ga0496113_0017949 Ga0496113_0017949_2548_2772 74
487 3300048916 Ga0496113_0058250 Ga0496113_0058250_1380_1604 74
488 3300048917 Ga0496114_0589689 Ga0496114_0589689_215_439 74
489 3300049572 Ga0501036_0733159 Ga0501036_0733159_447_674 74
490 3300049575 Ga0501039_0434263 Ga0501039_0434263_382_606 74
491 3300049578 Ga0501042_0442095 Ga0501042_0442095_624_851 74
492 3300049588 Ga0501072_0147757 Ga0501072_0147757_1086_1313 74
493 3300049741 Ga0501079_0390869 Ga0501079_0390869_751_975 74
494 3300053078 Ga0495612_0039082 Ga0495612_0039082_1239_1463 74
495 3300060353 Ga0501082_0308157 Ga0501082_0308157_267_494 74
496 3300061734 Ga0530510_1028374 Ga0530510_1028374_267_491 74
497 3300001977 JGI24746J21847_1000728 JGI24746J21847_10007284 75
498 3300002239 JGI24034J26672_10000167 JGI24034J26672_100001678 75
499 3300002244 JGI24742J22300_10000390 JGI24742J22300_100003904 75
500 3300002459 JGI24751J29686_10026666 JGI24751J29686_100266662 75
501 3300005329 Ga0070683_100004842 Ga0070683_1000048426 75
502 3300005330 Ga0070690_100786082 Ga0070690_1007860822 75
503 3300005331 Ga0070670_102035597 Ga0070670_1020355972 75
504 3300005334 Ga0068869_100333891 Ga0068869_1003338913 75
505 3300005337 Ga0070682_100000029 Ga0070682_10000002919 75
506 3300005338 Ga0068868_100043307 Ga0068868_1000433072 75
507 3300005341 Ga0070691_10003720 Ga0070691_100037206 75
508 3300005345 Ga0070692_11069626 Ga0070692_110696262 75
509 3300005356 Ga0070674_100000014 Ga0070674_10000001415 75
510 3300005364 Ga0070673_100019029 Ga0070673_1000190295 75
511 3300005364 Ga0070673_102259367 Ga0070673_1022593672 75
512 3300005365 Ga0070688_100542171 Ga0070688_1005421712 75
513 3300005441 Ga0070700_100038140 Ga0070700_1000381403 75
514 3300005444 Ga0070694_100536825 Ga0070694_1005368251 75
515 3300005456 Ga0070678_100408611 Ga0070678_1004086112 75
516 3300005457 Ga0070662_100000008 Ga0070662_10000000869 75
517 3300005458 Ga0070681_10043861 Ga0070681_100438613 75
518 3300005459 Ga0068867_100000247 Ga0068867_10000024711 75
519 3300005530 Ga0070679_100000651 Ga0070679_10000065126 75
520 3300005535 Ga0070684_100022662 Ga0070684_1000226623 75
521 3300005535 Ga0070684_100117307 Ga0070684_1001173074 75
522 3300005547 Ga0070693_100000398 Ga0070693_1000003987 75
523 3300005548 Ga0070665_100000870 Ga0070665_10000087030 75
524 3300005563 Ga0068855_100356527 Ga0068855_1003565274 75
525 3300005577 Ga0068857_102371919 Ga0068857_1023719192 75
526 3300005614 Ga0068856_100010700 Ga0068856_1000107003 75
527 3300005614 Ga0068856_101478997 Ga0068856_1014789971 75
528 3300005618 Ga0068864_100000044 Ga0068864_100000044132 75
529 3300005718 Ga0068866_10000219 Ga0068866_1000021919 75
530 3300005842 Ga0068858_100000155 Ga0068858_10000015541 75
531 3300006173 Ga0070716_101110091 Ga0070716_1011100912 75
532 3300006175 Ga0070712_100224422 Ga0070712_1002244221 75
533 3300006852 Ga0075433_10000663 Ga0075433_1000066310 75
534 3300009098 Ga0105245_10001015 Ga0105245_1000101517 75
535 3300009148 Ga0105243_10221148 Ga0105243_102211482 75
536 3300009176 Ga0105242_10008605 Ga0105242_100086054 75
537 3300009551 Ga0105238_10652846 Ga0105238_106528463 75
538 3300009553 Ga0105249_10189958 Ga0105249_101899583 75
539 3300013104 Ga0157370_10006328 Ga0157370_100063289 75
540 3300013308 Ga0157375_10573648 Ga0157375_105736482 75
541 3300013308 Ga0157375_13618746 Ga0157375_136187462 75
542 3300014325 Ga0163163_10761392 Ga0163163_107613922 75
543 3300014325 Ga0163163_10975566 Ga0163163_109755662 75
544 3300014325 Ga0163163_11125753 Ga0163163_111257532 75
545 3300014968 Ga0157379_10121840 Ga0157379_101218402 75
546 3300020078 Ga0206352_10935449 Ga0206352_109354493 75
547 3300025885 Ga0207653_10216855 Ga0207653_102168552 75
548 3300025898 Ga0207692_10531534 Ga0207692_105315342 75
549 3300025899 Ga0207642_10000094 Ga0207642_1000009420 75
550 3300025912 Ga0207707_10018135 Ga0207707_100181359 75
551 3300025913 Ga0207695_10714554 Ga0207695_107145542 75
552 3300025915 Ga0207693_10299747 Ga0207693_102997472 75
553 3300025921 Ga0207652_10000150 Ga0207652_1000015052 75
554 3300025924 Ga0207694_11024536 Ga0207694_110245362 75
555 3300025926 Ga0207659_10852866 Ga0207659_108528662 75
556 3300025927 Ga0207687_10000716 Ga0207687_100007164 75
557 3300025933 Ga0207706_10000016 Ga0207706_10000016105 75
558 3300025934 Ga0207686_10015756 Ga0207686_100157563 75
559 3300025935 Ga0207709_10162874 Ga0207709_101628743 75
560 3300025936 Ga0207670_10129878 Ga0207670_101298783 75
561 3300025937 Ga0207669_10000007 Ga0207669_1000000725 75
562 3300025939 Ga0207665_10966109 Ga0207665_109661092 75
563 3300025942 Ga0207689_10666123 Ga0207689_106661232 75
564 3300025944 Ga0207661_10003394 Ga0207661_100033949 75
565 3300025944 Ga0207661_10499527 Ga0207661_104995272 75
566 3300025949 Ga0207667_10380532 Ga0207667_103805323 75
567 3300025960 Ga0207651_10029595 Ga0207651_100295954 75
568 3300025961 Ga0207712_11318127 Ga0207712_113181272 75
569 3300026023 Ga0207677_10039439 Ga0207677_100394392 75
570 3300026035 Ga0207703_10000266 Ga0207703_1000026647 75
571 3300026041 Ga0207639_10003854 Ga0207639_100038547 75
572 3300026041 Ga0207639_11523494 Ga0207639_115234941 75
573 3300026075 Ga0207708_10100994 Ga0207708_101009943 75
574 3300026078 Ga0207702_10007605 Ga0207702_100076054 75
575 3300026089 Ga0207648_10000230 Ga0207648_1000023017 75
576 3300026095 Ga0207676_10000043 Ga0207676_10000043131 75
577 3300026116 Ga0207674_12189789 Ga0207674_121897892 75
578 3300026121 Ga0207683_10421762 Ga0207683_104217623 75
579 3300028379 Ga0268266_10000076 Ga0268266_10000076188 75
580 3300035119 Ga0373956_0576642 Ga0373956_0576642_86_313 75
581 3300035724 Ga0373933_0065959 Ga0373933_0065959_610_837 75
582 3300036401 Ga0373937_0041924 Ga0373937_0041924_2647_2874 75
583 3300041459 Ga0451800_0234848 Ga0451800_0234848_996_1223 75
584 3300041512 Ga0451853_0674116 Ga0451853_0674116_1572_1799 75
585 3300046454 Ga0495592_0118314 Ga0495592_0118314_1393_1623 75
586 3300046454 Ga0495592_0176354 Ga0495592_0176354_252_479 75
587 3300046454 Ga0495592_0326099 Ga0495592_0326099_110_337 75
588 3300046459 Ga0495629_0158193 Ga0495629_0158193_989_1219 75
589 3300046461 Ga0495641_0000001 Ga0495641_0000001_188808_189035 75
590 3300046461 Ga0495641_0178994 Ga0495641_0178994_270_500 75
591 3300046463 Ga0495653_0072155 Ga0495653_0072155_493_720 75
592 3300046463 Ga0495653_0160018 Ga0495653_0160018_549_776 75
593 3300046473 Ga0495582_0000022 Ga0495582_0000022_68887_69117 75
594 3300046477 Ga0495664_0117990 Ga0495664_0117990_1272_1502 75
595 3300046511 Ga0495608_0287385 Ga0495608_0287385_79_306 75
596 3300046511 Ga0495608_0919183 Ga0495608_0919183_134_361 75
597 3300046514 Ga0495618_0001468 Ga0495618_0001468_1732_1962 75
598 3300046514 Ga0495618_0902817 Ga0495618_0902817_210_437 75
599 3300046516 Ga0495628_0026019 Ga0495628_0026019_2518_2748 75
600 3300046516 Ga0495628_0061540 Ga0495628_0061540_818_1045 75
601 3300046516 Ga0495628_0064761 Ga0495628_0064761_1426_1656 75
602 3300046517 Ga0495630_0020101 Ga0495630_0020101_3184_3414 75
603 3300046517 Ga0495630_0070337 Ga0495630_0070337_1970_2197 75
604 3300046517 Ga0495630_0558988 Ga0495630_0558988_324_551 75
605 3300046517 Ga0495630_0873466 Ga0495630_0873466_293_520 75
606 3300046520 Ga0495637_0209606 Ga0495637_0209606_440_667 75
607 3300046525 Ga0495663_0209496 Ga0495663_0209496_380_610 75
608 3300046533 Ga0495640_0021952 Ga0495640_0021952_3506_3736 75
609 3300046537 Ga0495598_0003687 Ga0495598_0003687_2656_2886 75
610 3300046543 Ga0495645_0355832 Ga0495645_0355832_412_639 75
611 3300046558 Ga0495633_0006532 Ga0495633_0006532_1700_1930 75
612 3300046616 Ga0495668_0107861 Ga0495668_0107861_70_300 75
613 3300046642 Ga0495634_0068337 Ga0495634_0068337_1989_2219 75
614 3300046642 Ga0495634_0090023 Ga0495634_0090023_990_1217 75
615 3300046642 Ga0495634_0141968 Ga0495634_0141968_306_536 75
616 3300046642 Ga0495634_0449690 Ga0495634_0449690_517_744 75
617 3300046663 Ga0495635_0000063 Ga0495635_0000063_21247_21477 75
618 3300046663 Ga0495635_0042554 Ga0495635_0042554_586_813 75
619 3300046663 Ga0495635_0067371 Ga0495635_0067371_628_855 75
620 3300046663 Ga0495635_0242685 Ga0495635_0242685_799_1026 75
621 3300046678 Ga0495599_0006457 Ga0495599_0006457_227_454 75
622 3300046678 Ga0495599_0119765 Ga0495599_0119765_868_1098 75
623 3300046680 Ga0495646_0421904 Ga0495646_0421904_219_446 75
624 3300046681 Ga0495647_0631895 Ga0495647_0631895_46_273 75
625 3300046683 Ga0495658_0000008 Ga0495658_0000008_69327_69557 75
626 3300046690 Ga0495624_0251287 Ga0495624_0251287_818_1045 75
627 3300046691 Ga0495670_0007059 Ga0495670_0007059_1830_2060 75
628 3300046809 Ga0495600_0035731 Ga0495600_0035731_1325_1555 75
629 3300046809 Ga0495600_0119424 Ga0495600_0119424_1249_1476 75
630 3300046809 Ga0495600_0358097 Ga0495600_0358097_89_316 75
631 3300047317 Ga0495604_0050587 Ga0495604_0050587_1685_1915 75
632 3300047317 Ga0495604_0235900 Ga0495604_0235900_696_923 75
633 3300047317 Ga0495604_0974513 Ga0495604_0974513_116_343 75
634 3300047321 Ga0495676_0131933 Ga0495676_0131933_311_541 75
635 3300047322 Ga0495680_0000215 Ga0495680_0000215_34598_34825 75
636 3300047322 Ga0495680_0036038 Ga0495680_0036038_1894_2124 75
637 3300047322 Ga0495680_0059144 Ga0495680_0059144_2484_2711 75
638 3300047322 Ga0495680_0635733 Ga0495680_0635733_322_549 75
639 3300047446 Ga0495679_009212 Ga0495679_009212_1031_1258 75
640 3300047447 Ga0495685_017740 Ga0495685_017740_201_431 75
641 3300047673 Ga0495593_0302308 Ga0495593_0302308_322_549 75
642 3300047673 Ga0495593_0560629 Ga0495593_0560629_293_523 75
643 3300048088 Ga0495602_0466744 Ga0495602_0466744_492_719 75
644 3300048907 Ga0496104_1644383 Ga0496104_1644383_139_369 75
645 3300048908 Ga0496105_0022756 Ga0496105_0022756_1551_1781 75
646 3300048911 Ga0496108_0001295 Ga0496108_0001295_12374_12601 75
647 3300048912 Ga0496109_0000035 Ga0496109_0000035_125429_125656 75
648 3300048912 Ga0496109_0000888 Ga0496109_0000888_12386_12613 75
649 3300048913 Ga0496110_0018894 Ga0496110_0018894_4874_5101 75
650 3300048913 Ga0496110_0233155 Ga0496110_0233155_498_725 75
651 3300048914 Ga0496111_0009354 Ga0496111_0009354_4955_5182 75
652 3300048915 Ga0496112_0103593 Ga0496112_0103593_2358_2585 75
653 3300048915 Ga0496112_0429113 Ga0496112_0429113_308_535 75
654 3300048916 Ga0496113_0083986 Ga0496113_0083986_1379_1606 75
655 3300048917 Ga0496114_0030582 Ga0496114_0030582_2205_2432 75
656 3300049576 Ga0501040_0430317 Ga0501040_0430317_161_388 75
657 3300049576 Ga0501040_1331422 Ga0501040_1331422_66_293 75
658 3300049577 Ga0501041_0805023 Ga0501041_0805023_259_486 75
659 3300049578 Ga0501042_0012267 Ga0501042_0012267_4526_4756 75
660 3300049586 Ga0501070_0420345 Ga0501070_0420345_671_898 75
661 3300049592 Ga0501076_1623212 Ga0501076_1623212_81_308 75
662 3300049743 Ga0501081_1414562 Ga0501081_1414562_84_311 75
663 3300049824 Ga0501045_1411418 Ga0501045_1411418_44_271 75
664 3300050515 nmdc:mga0a205_155_c1 nmdc:mga0a205_155_c1_20011_20238 75
665 3300053077 Ga0495601_0000169 Ga0495601_0000169_18892_19119 75
666 3300053077 Ga0495601_0012989 Ga0495601_0012989_3154_3381 75
667 3300053077 Ga0495601_0023415 Ga0495601_0023415_2341_2571 75
668 3300053077 Ga0495601_0103639 Ga0495601_0103639_741_968 75
669 3300053078 Ga0495612_0001003 Ga0495612_0001003_6627_6854 75
670 3300053078 Ga0495612_0017880 Ga0495612_0017880_1366_1596 75
671 3300053084 Ga0495595_0375146 Ga0495595_0375146_366_593 75
672 3300053085 Ga0495619_0000408 Ga0495619_0000408_27285_27512 75
673 3300053085 Ga0495619_0000758 Ga0495619_0000758_20089_20316 75
674 3300053085 Ga0495619_0007151 Ga0495619_0007151_3340_3567 75
675 3300053085 Ga0495619_0011996 Ga0495619_0011996_519_746 75
676 3300053085 Ga0495619_0040276 Ga0495619_0040276_1661_1888 75
677 3300053085 Ga0495619_0070764 Ga0495619_0070764_498_725 75
678 3300053085 Ga0495619_0346693 Ga0495619_0346693_619_846 75
679 3300053123 Ga0500614_000374 Ga0500614_000374_8184_8411 75
680 3300054114 Ga0501084_0572153 Ga0501084_0572153_525_752 75

Structural Annotation

Top 5 Hits

ID Description Score Start End
7pib-assembly1.cif.gz_v 70s ribosome with ef-g, a/p- and p/e-site trnas in spectinomycin-treated mycoplasma pneumoniae cells 0.7338 2 32
1yn4-assembly1.cif.gz_A crystal structures of eap domains from staphylococcus aureus reveal an unexpected homology to bacterial superantigens 0.7296 2 60
3m4g-assembly2.cif.gz_G h57a hfq from pseudomonas aeruginosa 0.701 5 60
4jrk-assembly1.cif.gz_B crystal structure of escherichia coli hfq surface mutant 0.7007 5 62
8bvj-assembly1.cif.gz_F hfq-crc-esta translation repression complex 0.7 5 60
ID Description Score Start End Superfamily
1yn4A00 Alpha Beta;Roll;Ubiquitin-like (UB roll); 0.7296 2 60 3.10.20.120
3hsbD00 Mainly Beta;Roll;SH3 type barrels.; 0.702 5 60 2.30.30.100
af_A0A0B4LG43_69_168_2.40.10.10 Mainly Beta;Beta Barrel;Thrombin, subunit H;Trypsin-like serine proteases 0.6995 6 21 2.40.10.10
af_Q2FWW2_1_96_3.10.20.120 Alpha Beta;Roll;Ubiquitin-like (UB roll); 0.6826 2 20 3.10.20.120
af_P45472_1_97_3.40.1440.10 Alpha Beta;3-Layer(aba) Sandwich;GIY-YIG endonuclease;GIY-YIG endonuclease 0.6817 1 36 3.40.1440.10
ID Description Score Start End GO Terms
AF-A5N2D3-F1-model_v4 HTH LytTR-type domain-containing protein 0.9126 5 60
AF-U7GB24-F1-model_v4 deleted 0.9043 4 62
AF-A0A317SPH4-F1-model_v4 Uncharacterized protein 0.8995 2 35
AF-A0A640Y943-F1-model_v4 Uncharacterized protein 0.8988 1 69
AF-A0A524J8P7-F1-model_v4 DUF3107 family protein 0.8968 1 70

Feature Viewer

pLDDT pTM Quality
86.63 0.71 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map