F474767

General Info

Members Datasets Scaffolds Average Seq Length
680 240 1360 146

Family's Representative Sequence

Representative Sequence 3300009098|Ga0105245_10462082|Ga0105245_104620822
Length 172
Sequence VLGVGSSTATDDTPVAILRVLFGTLMISQVILSPELVAAELRPVLLRLARELRKETEQLGITARQATLLWLVKRSPGMSLAELASEEGISAPALSGHVDRLERAGLLERVRSSDDRRRVGLTLTSEGERLMRRIRARRTTWLADRLKSLDAGELEAVGAAIPALMSLVGAKA

Samples

Sample ID Description Type Environment
1 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
63 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
142 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
146 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
147 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
148 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
149 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
150 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
151 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
152 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
153 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
154 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
155 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
156 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
157 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
158 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
159 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
160 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
161 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
162 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
163 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
164 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
165 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
166 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
167 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
168 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
169 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
170 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
171 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
172 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
173 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
174 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
175 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
176 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
177 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
178 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
179 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
180 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
181 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
182 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
183 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
184 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
185 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
186 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
187 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
188 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
189 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
190 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
191 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
192 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
193 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
194 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
210 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
211 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
212 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
213 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
214 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
215 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
216 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
217 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
218 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
219 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
220 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
221 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
222 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
223 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
224 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
227 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
228 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
229 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
230 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
231 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
232 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
233 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
234 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
235 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
236 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
237 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
238 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
239 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
240 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.06
Rhizosphere 97.94
Stem 0
Stem Tuber 0
Unclassified 12.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105245_10462082 3300009098 Bacteria 1280
2 JGI24738J21930_10002914 3300002075 Bacteria 4378
3 Ga0070658_10008953 3300005327 Bacteria 8045
4 Ga0070676_10048475 3300005328 Bacteria 2484
5 Ga0070683_100004187 3300005329 Bacteria 11827
6 Ga0070683_100451548 3300005329 Bacteria 1226
7 Ga0070683_100474719 3300005329 Bacteria 1194
8 Ga0070683_101070465 3300005329 Unclassified 774
9 Ga0070690_100127372 3300005330 Bacteria 1716
10 Ga0070670_100052125 3300005331 Bacteria 3514
11 Ga0070670_100216317 3300005331 Unclassified 1667
12 Ga0070670_100754534 3300005331 Bacteria 877
13 Ga0068869_100113528 3300005334 Unclassified 2064
14 Ga0068869_100335729 3300005334 Bacteria 1229
15 Ga0070680_100094467 3300005336 Bacteria 2478
16 Ga0070680_100576172 3300005336 Bacteria 965
17 Ga0070682_100136559 3300005337 Bacteria 1666
18 Ga0068868_100006170 3300005338 Bacteria 8476
19 Ga0068868_100017104 3300005338 Bacteria 5396
20 Ga0068868_100234229 3300005338 Bacteria 1541
21 Ga0068868_100457663 3300005338 Bacteria 1111
22 Ga0070660_100005081 3300005339 Bacteria 9087
23 Ga0070660_100184898 3300005339 Bacteria 1687
24 Ga0070660_100220160 3300005339 Unclassified 1543
25 Ga0070660_100726663 3300005339 Bacteria 833
26 Ga0070660_101027965 3300005339 Bacteria 696
27 Ga0070689_100015612 3300005340 Bacteria 5542
28 Ga0070689_100037772 3300005340 Bacteria 3693
29 Ga0070691_10042238 3300005341 Bacteria 2157
30 Ga0070691_10046512 3300005341 Bacteria 2061
31 Ga0070661_100073894 3300005344 Bacteria 2510
32 Ga0070661_100195490 3300005344 Unclassified 1544
33 Ga0070692_10015033 3300005345 Bacteria 3651
34 Ga0070668_100628484 3300005347 Unclassified 942
35 Ga0070668_100651430 3300005347 Unclassified 925
36 Ga0070668_100935861 3300005347 Bacteria 776
37 Ga0070675_100008048 3300005354 Bacteria 8173
38 Ga0070675_100019931 3300005354 Bacteria 5350
39 Ga0070675_100028559 3300005354 Bacteria 4489
40 Ga0070675_100135430 3300005354 Bacteria 2102
41 Ga0070675_101468122 3300005354 Unclassified 629
42 Ga0070675_101542162 3300005354 Bacteria 613
43 Ga0070671_100463382 3300005355 Bacteria 1088
44 Ga0070671_101482448 3300005355 Unclassified 600
45 Ga0070674_100037955 3300005356 Bacteria 3243
46 Ga0070674_100058348 3300005356 Bacteria 2683
47 Ga0070674_100060473 3300005356 Bacteria 2640
48 Ga0070673_100232723 3300005364 Bacteria 1599
49 Ga0070673_100324684 3300005364 Bacteria 1360
50 Ga0070688_100031485 3300005365 Bacteria 3191
51 Ga0070688_100344516 3300005365 Bacteria 1089
52 Ga0070688_100656484 3300005365 Unclassified 808
53 Ga0070659_100062306 3300005366 Bacteria 2948
54 Ga0070667_100628391 3300005367 Bacteria 991
55 Ga0070701_10034939 3300005438 Bacteria 2522
56 Ga0070701_10302795 3300005438 Bacteria 983
57 Ga0070711_101101764 3300005439 Bacteria 684
58 Ga0070700_100009619 3300005441 Bacteria 5312
59 Ga0070700_100645615 3300005441 Bacteria 835
60 Ga0070694_100746448 3300005444 Bacteria 799
61 Ga0070694_101117810 3300005444 Unclassified 658
62 Ga0070663_100046667 3300005455 Bacteria 3066
63 Ga0070663_100193100 3300005455 Bacteria 1585
64 Ga0070663_100908108 3300005455 Bacteria 761
65 Ga0070678_100235116 3300005456 Bacteria 1529
66 Ga0070678_100364995 3300005456 Bacteria 1245
67 Ga0070662_100049318 3300005457 Bacteria 3036
68 Ga0070662_100161746 3300005457 Bacteria 1751
69 Ga0070662_100615174 3300005457 Bacteria 914
70 Ga0070662_101289887 3300005457 Unclassified 628
71 Ga0070662_101301717 3300005457 Bacteria 625
72 Ga0070681_10376379 3300005458 Unclassified 1330
73 Ga0068867_100110441 3300005459 Bacteria 2112
74 Ga0068867_100131982 3300005459 Unclassified 1942
75 Ga0068867_100538417 3300005459 Bacteria 1009
76 Ga0068867_101014756 3300005459 Bacteria 753
77 Ga0068867_101134406 3300005459 Bacteria 715
78 Ga0070685_10001514 3300005466 Bacteria 12245
79 Ga0070685_10005222 3300005466 Bacteria 6585
80 Ga0070685_10059690 3300005466 Bacteria 2228
81 Ga0070685_10570346 3300005466 Unclassified 810
82 Ga0070706_100479946 3300005467 Bacteria 1157
83 Ga0070706_101524125 3300005467 Bacteria 611
84 Ga0070707_100968061 3300005468 Bacteria 816
85 Ga0070707_101153709 3300005468 Bacteria 741
86 Ga0070698_100092747 3300005471 Bacteria 3001
87 Ga0070698_100829670 3300005471 Bacteria 869
88 Ga0070698_100848250 3300005471 Bacteria 858
89 Ga0070684_100018666 3300005535 Bacteria 5719
90 Ga0070684_100073845 3300005535 Bacteria 3006
91 Ga0070684_100172207 3300005535 Bacteria 1966
92 Ga0070684_100811861 3300005535 Unclassified 875
93 Ga0068853_100033725 3300005539 Bacteria 4343
94 Ga0070672_100035683 3300005543 Bacteria 3781
95 Ga0070672_100071829 3300005543 Bacteria 2754
96 Ga0070672_100942024 3300005543 Bacteria 764
97 Ga0070686_100014994 3300005544 Bacteria 4479
98 Ga0070686_100049186 3300005544 Bacteria 2674
99 Ga0070686_100080946 3300005544 Bacteria 2150
100 Ga0070686_100305018 3300005544 Bacteria 1182
101 Ga0070696_100907570 3300005546 Bacteria 731
102 Ga0070693_100047111 3300005547 Bacteria 2451
103 Ga0070665_100014112 3300005548 Bacteria 8028
104 Ga0070665_100021434 3300005548 Bacteria 6499
105 Ga0070665_100618603 3300005548 Bacteria 1096
106 Ga0070665_100769979 3300005548 Unclassified 975
107 Ga0070704_100025779 3300005549 Bacteria 3874
108 Ga0070704_100212983 3300005549 Bacteria 1567
109 Ga0070704_100858263 3300005549 Bacteria 814
110 Ga0070704_101557364 3300005549 Unclassified 609
111 Ga0070664_100005918 3300005564 Bacteria 9875
112 Ga0070664_100165075 3300005564 Bacteria 1961
113 Ga0070664_100304160 3300005564 Unclassified 1441
114 Ga0068857_100027569 3300005577 Bacteria 5011
115 Ga0068857_100812535 3300005577 Bacteria 893
116 Ga0068854_100009127 3300005578 Bacteria 6394
117 Ga0068854_100152240 3300005578 Bacteria 1785
118 Ga0068854_100702648 3300005578 Bacteria 873
119 Ga0068856_100267623 3300005614 Bacteria 1725
120 Ga0070702_100002965 3300005615 Bacteria 7491
121 Ga0070702_100450822 3300005615 Bacteria 933
122 Ga0070702_100462912 3300005615 Unclassified 922
123 Ga0068852_100007290 3300005616 Bacteria 8063
124 Ga0068852_100027972 3300005616 Bacteria 4606
125 Ga0068859_100184526 3300005617 Bacteria 2169
126 Ga0068859_101175722 3300005617 Bacteria 845
127 Ga0068864_100012303 3300005618 Bacteria 7072
128 Ga0068864_100165246 3300005618 Bacteria 2014
129 Ga0068866_10081032 3300005718 Bacteria 1743
130 Ga0068866_10093363 3300005718 Bacteria 1644
131 Ga0068866_10220065 3300005718 Bacteria 1145
132 Ga0068861_100038628 3300005719 Bacteria 3557
133 Ga0068861_100267193 3300005719 Bacteria 1467
134 Ga0068851_10120748 3300005834 Bacteria 1408
135 Ga0068870_10000684 3300005840 Bacteria 12980
136 Ga0068870_10006288 3300005840 Bacteria 5231
137 Ga0068870_10035411 3300005840 Bacteria 2561
138 Ga0068870_10119102 3300005840 Bacteria 1518
139 Ga0068863_100166129 3300005841 Bacteria 2116
140 Ga0068858_100276798 3300005842 Bacteria 1597
141 Ga0068858_100798183 3300005842 Bacteria 921
142 Ga0068858_100910645 3300005842 Unclassified 860
143 Ga0068860_100309583 3300005843 Bacteria 1548
144 Ga0068860_101967689 3300005843 Bacteria 606
145 Ga0068862_100767938 3300005844 Bacteria 939
146 Ga0068862_101449729 3300005844 Bacteria 691
147 Ga0081538_10002218 3300005981 Bacteria 19247
148 Ga0075432_10050376 3300006058 Bacteria 1469
149 Ga0097621_100109828 3300006237 Bacteria 2329
150 Ga0097621_100117379 3300006237 Bacteria 2254
151 Ga0097621_100471107 3300006237 Bacteria 1134
152 Ga0068871_100471055 3300006358 Bacteria 1128
153 Ga0075428_100093251 3300006844 Bacteria 3283
154 Ga0075430_100021412 3300006846 Bacteria 5496
155 Ga0075430_100382724 3300006846 Archaea 1161
156 Ga0075431_100043068 3300006847 Bacteria 4658
157 Ga0075431_101600162 3300006847 Unclassified 609
158 Ga0075433_10403765 3300006852 Bacteria 1205
159 Ga0075429_100245737 3300006880 Bacteria 1567
160 Ga0075429_100436143 3300006880 Bacteria 1148
161 Ga0075429_100593184 3300006880 Archaea 971
162 Ga0068865_100002179 3300006881 Bacteria 11536
163 Ga0068865_100015212 3300006881 Bacteria 4903
164 Ga0068865_100021528 3300006881 Bacteria 4194
165 Ga0068865_100280197 3300006881 Bacteria 1327
166 Ga0097620_100184523 3300006931 Bacteria 2169
167 Ga0097620_101175667 3300006931 Bacteria 845
168 Ga0105244_10210055 3300009036 Bacteria 916
169 Ga0105240_11631370 3300009093 Unclassified 674
170 Ga0111539_10049725 3300009094 Bacteria 4998
171 Ga0111539_10052381 3300009094 Bacteria 4858
172 Ga0111539_10083649 3300009094 Bacteria 3752
173 Ga0111539_10100387 3300009094 Bacteria 3398
174 Ga0111539_10126409 3300009094 Bacteria 2995
175 Ga0111539_11108442 3300009094 Bacteria 920
176 Ga0111539_11420344 3300009094 Bacteria 805
177 Ga0111539_11730431 3300009094 Bacteria 725
178 Ga0111539_12472023 3300009094 Unclassified 602
179 Ga0105245_10042686 3300009098 Bacteria 4046
180 Ga0105245_10123720 3300009098 Bacteria 2419
181 Ga0105245_10423169 3300009098 Bacteria 1335
182 Ga0105245_10606648 3300009098 Bacteria 1121
183 Ga0114129_10312195 3300009147 Bacteria 2092
184 Ga0114129_10414160 3300009147 Unclassified 1774
185 Ga0114129_10564723 3300009147 Bacteria 1478
186 Ga0114129_10574584 3300009147 Unclassified 1463
187 Ga0114129_10864861 3300009147 Bacteria 1148
188 Ga0114129_11045777 3300009147 Bacteria 1025
189 Ga0114129_12454424 3300009147 Bacteria 624
190 Ga0105243_10003840 3300009148 Bacteria 12008
191 Ga0105243_10081916 3300009148 Bacteria 2636
192 Ga0105243_10545449 3300009148 Bacteria 1107
193 Ga0105243_10644056 3300009148 Bacteria 1026
194 Ga0105243_11510758 3300009148 Bacteria 696
195 Ga0105241_10176113 3300009174 Bacteria 1770
196 Ga0105242_10007369 3300009176 Bacteria 8470
197 Ga0105242_10041873 3300009176 Bacteria 3696
198 Ga0105242_10095928 3300009176 Bacteria 2504
199 Ga0105242_10372115 3300009176 Bacteria 1326
200 Ga0105248_10190924 3300009177 Bacteria 2308
201 Ga0105248_11137492 3300009177 Bacteria 882
202 Ga0105238_10010288 3300009551 Bacteria 9384
203 Ga0105238_10518133 3300009551 Bacteria 1195
204 Ga0105238_11069814 3300009551 Unclassified 829
205 Ga0105249_10279574 3300009553 Unclassified 1666
206 Ga0105249_10629673 3300009553 Unclassified 1129
207 Ga0105249_10820306 3300009553 Bacteria 995
208 Ga0105249_10963173 3300009553 Bacteria 921
209 Ga0105249_10981658 3300009553 Bacteria 913
210 Ga0105239_10117523 3300010375 Bacteria 2951
211 Ga0105239_10125199 3300010375 Bacteria 2856
212 Ga0105239_11673644 3300010375 Bacteria 736
213 Ga0105246_10070894 3300011119 Bacteria 2452
214 Ga0105246_10311278 3300011119 Unclassified 1276
215 Ga0105246_10385982 3300011119 Unclassified 1159
216 Ga0105246_10780565 3300011119 Bacteria 846
217 Ga0157316_1013431 3300012510 Bacteria 800
218 Ga0157371_10995004 3300013102 Unclassified 639
219 Ga0157370_10425233 3300013104 Bacteria 1222
220 Ga0157378_10260153 3300013297 Unclassified 1665
221 Ga0157378_10288663 3300013297 Unclassified 1584
222 Ga0157378_11265909 3300013297 Bacteria 778
223 Ga0163162_10048920 3300013306 Bacteria 4237
224 Ga0163162_10990025 3300013306 Bacteria 950
225 Ga0157372_10318636 3300013307 Bacteria 1810
226 Ga0157372_11999673 3300013307 Bacteria 666
227 Ga0157375_11109215 3300013308 Bacteria 926
228 Ga0157375_11210767 3300013308 Bacteria 886
229 Ga0157375_12499836 3300013308 Bacteria 617
230 Ga0163163_10302108 3300014325 Bacteria 1653
231 Ga0163163_10380007 3300014325 Bacteria 1470
232 Ga0163163_10755896 3300014325 Unclassified 1035
233 Ga0163163_11636868 3300014325 Unclassified 705
234 Ga0163163_12015562 3300014325 Bacteria 637
235 Ga0157380_10043297 3300014326 Bacteria 3524
236 Ga0157380_10086661 3300014326 Bacteria 2574
237 Ga0157380_10110280 3300014326 Bacteria 2311
238 Ga0157380_10150707 3300014326 Bacteria 2010
239 Ga0157380_10394787 3300014326 Bacteria 1310
240 Ga0157377_10006807 3300014745 Bacteria 5475
241 Ga0157377_10124908 3300014745 Bacteria 1564
242 Ga0157377_10229375 3300014745 Bacteria 1193
243 Ga0157377_10392356 3300014745 Bacteria 943
244 Ga0157376_10079144 3300014969 Bacteria 2817
245 Ga0157376_10266413 3300014969 Bacteria 1607
246 Ga0157376_12659120 3300014969 Unclassified 540
247 Ga0163161_10283251 3300017792 Unclassified 1301
248 Ga0207642_10023241 3300025899 Bacteria 2474
249 Ga0207642_10165325 3300025899 Bacteria 1192
250 Ga0207642_10574463 3300025899 Bacteria 699
251 Ga0207688_10000321 3300025901 Bacteria 22156
252 Ga0207688_10004897 3300025901 Bacteria 7288
253 Ga0207688_10043989 3300025901 Bacteria 2488
254 Ga0207645_10023446 3300025907 Bacteria 4012
255 Ga0207645_10051530 3300025907 Bacteria 2630
256 Ga0207643_10001573 3300025908 Bacteria 12943
257 Ga0207643_10017750 3300025908 Bacteria 3895
258 Ga0207643_10081031 3300025908 Bacteria 1881
259 Ga0207643_10405131 3300025908 Bacteria 863
260 Ga0207643_10410369 3300025908 Bacteria 857
261 Ga0207684_10521634 3300025910 Bacteria 1018
262 Ga0207707_10138058 3300025912 Bacteria 2131
263 Ga0207662_10418045 3300025918 Bacteria 912
264 Ga0207657_10014673 3300025919 Bacteria 7635
265 Ga0207657_10022361 3300025919 Bacteria 5918
266 Ga0207657_10187669 3300025919 Bacteria 1669
267 Ga0207657_10948891 3300025919 Unclassified 661
268 Ga0207649_10114324 3300025920 Unclassified 1809
269 Ga0207646_11029208 3300025922 Bacteria 727
270 Ga0207650_10006043 3300025925 Bacteria 8260
271 Ga0207650_10230001 3300025925 Bacteria 1495
272 Ga0207650_10992285 3300025925 Bacteria 714
273 Ga0207659_10095816 3300025926 Bacteria 2226
274 Ga0207659_10902868 3300025926 Bacteria 760
275 Ga0207659_11033073 3300025926 Bacteria 707
276 Ga0207687_10087822 3300025927 Bacteria 2261
277 Ga0207687_10110594 3300025927 Bacteria 2038
278 Ga0207687_10197645 3300025927 Bacteria 1569
279 Ga0207687_10496984 3300025927 Bacteria 1018
280 Ga0207644_10354083 3300025931 Bacteria 1193
281 Ga0207644_11348578 3300025931 Unclassified 599
282 Ga0207690_10090668 3300025932 Bacteria 2158
283 Ga0207690_10104049 3300025932 Unclassified 2033
284 Ga0207690_10163438 3300025932 Bacteria 1662
285 Ga0207706_10026019 3300025933 Bacteria 5239
286 Ga0207706_10073223 3300025933 Bacteria 3012
287 Ga0207706_10132339 3300025933 Bacteria 2194
288 Ga0207706_10789785 3300025933 Bacteria 807
289 Ga0207686_10193020 3300025934 Bacteria 1453
290 Ga0207686_10265765 3300025934 Bacteria 1260
291 Ga0207686_10552902 3300025934 Bacteria 900
292 Ga0207709_10008349 3300025935 Bacteria 5733
293 Ga0207709_10075588 3300025935 Bacteria 2153
294 Ga0207709_10184640 3300025935 Bacteria 1476
295 Ga0207709_10287545 3300025935 Bacteria 1217
296 Ga0207670_10213153 3300025936 Bacteria 1474
297 Ga0207669_10008922 3300025937 Bacteria 4739
298 Ga0207669_10060047 3300025937 Bacteria 2329
299 Ga0207669_10197784 3300025937 Bacteria 1456
300 Ga0207669_10215167 3300025937 Bacteria 1406
301 Ga0207669_11128624 3300025937 Unclassified 662
302 Ga0207704_10092787 3300025938 Unclassified 1988
303 Ga0207704_10101669 3300025938 Unclassified 1918
304 Ga0207704_10289300 3300025938 Bacteria 1249
305 Ga0207691_10002455 3300025940 Bacteria 18132
306 Ga0207691_10003824 3300025940 Bacteria 14604
307 Ga0207691_10023468 3300025940 Bacteria 5808
308 Ga0207691_10474770 3300025940 Bacteria 1063
309 Ga0207711_10425170 3300025941 Unclassified 1236
310 Ga0207689_10016523 3300025942 Bacteria 6247
311 Ga0207689_10113438 3300025942 Bacteria 2228
312 Ga0207661_10051572 3300025944 Bacteria 3283
313 Ga0207661_10188307 3300025944 Bacteria 1807
314 Ga0207661_10231368 3300025944 Bacteria 1637
315 Ga0207661_10355530 3300025944 Unclassified 1322
316 Ga0207679_10417942 3300025945 Bacteria 1183
317 Ga0207651_10757288 3300025960 Bacteria 859
318 Ga0207712_10699365 3300025961 Unclassified 885
319 Ga0207712_11040521 3300025961 Bacteria 727
320 Ga0207668_10120513 3300025972 Bacteria 1986
321 Ga0207668_10332040 3300025972 Bacteria 1265
322 Ga0207668_10396319 3300025972 Bacteria 1166
323 Ga0207640_10081631 3300025981 Bacteria 2211
324 Ga0207640_10116431 3300025981 Bacteria 1905
325 Ga0207640_10304286 3300025981 Bacteria 1262
326 Ga0207677_10333285 3300026023 Unclassified 1265
327 Ga0207677_10491221 3300026023 Bacteria 1059
328 Ga0207677_10716479 3300026023 Bacteria 889
329 Ga0207703_10169100 3300026035 Unclassified 1921
330 Ga0207703_10523340 3300026035 Bacteria 1116
331 Ga0207703_10904677 3300026035 Bacteria 845
332 Ga0207639_10115786 3300026041 Unclassified 2193
333 Ga0207639_10895494 3300026041 Bacteria 829
334 Ga0207678_10068902 3300026067 Bacteria 3034
335 Ga0207678_10125915 3300026067 Bacteria 2186
336 Ga0207678_11050727 3300026067 Bacteria 721
337 Ga0207708_10001776 3300026075 Bacteria 15919
338 Ga0207708_10053670 3300026075 Bacteria 3072
339 Ga0207708_10123036 3300026075 Bacteria 2022
340 Ga0207708_10691267 3300026075 Bacteria 871
341 Ga0207702_10402473 3300026078 Unclassified 1320
342 Ga0207702_10711096 3300026078 Bacteria 990
343 Ga0207641_10868243 3300026088 Bacteria 895
344 Ga0207641_11283224 3300026088 Unclassified 733
345 Ga0207648_10017114 3300026089 Bacteria 6605
346 Ga0207648_10019778 3300026089 Bacteria 6075
347 Ga0207648_10441237 3300026089 Bacteria 1184
348 Ga0207676_11477905 3300026095 Bacteria 676
349 Ga0207674_10026054 3300026116 Bacteria 6221
350 Ga0207674_10066203 3300026116 Bacteria 3640
351 Ga0207674_10732225 3300026116 Bacteria 954
352 Ga0207675_100015716 3300026118 Bacteria 7059
353 Ga0207675_101178475 3300026118 Bacteria 786
354 Ga0207675_101183513 3300026118 Unclassified 784
355 Ga0207683_10007575 3300026121 Bacteria 9300
356 Ga0207683_10008175 3300026121 Bacteria 8952
357 Ga0207683_10074962 3300026121 Bacteria 2994
358 Ga0207683_10183644 3300026121 Bacteria 1897
359 Ga0207683_10310441 3300026121 Bacteria 1443
360 Ga0207683_10630321 3300026121 Unclassified 993
361 Ga0207698_11109194 3300026142 Bacteria 804
362 Ga0209998_10055543 3300027717 Unclassified 924
363 Ga0207428_10003693 3300027907 Bacteria 14712
364 Ga0207428_10024475 3300027907 Bacteria 5069
365 Ga0268266_10085512 3300028379 Bacteria 2756
366 Ga0268266_10155933 3300028379 Bacteria 2062
367 Ga0268266_10266965 3300028379 Bacteria 1588
368 Ga0268265_10145412 3300028380 Bacteria 1991
369 Ga0268265_11129832 3300028380 Bacteria 779
370 Ga0268264_10032741 3300028381 Bacteria 4266
371 Ga0268264_11034594 3300028381 Unclassified 828
372 Ga0307408_100674464 3300031548 Bacteria 927
373 Ga0307413_11249362 3300031824 Bacteria 648
374 Ga0307410_10324890 3300031852 Bacteria 1222
375 Ga0307409_100039104 3300031995 Bacteria 3517
376 Ga0307409_100518244 3300031995 Unclassified 1164
377 Ga0307416_100156635 3300032002 Bacteria 2098
378 Ga0307416_100315355 3300032002 Unclassified 1563
379 Ga0307416_101911805 3300032002 Bacteria 697
380 Ga0307414_10872342 3300032004 Bacteria 824
381 Ga0307415_100862519 3300032126 Unclassified 832
382 Ga0307415_101087621 3300032126 Bacteria 748
383 Ga0373928_0022936 3300035084 Bacteria 1327
384 Ga0373929_0113601 3300035085 Unclassified 695
385 Ga0373952_0007630 3300035092 Bacteria 2034
386 Ga0373931_0008527 3300035691 Bacteria 4864
387 Ga0395899_0038654 3300037312 Bacteria 3574
388 Ga0395900_0005235 3300037418 Bacteria 13615
389 Ga0395898_0059543 3300037466 Bacteria 3714
390 Ga0395905_0156573 3300037471 Bacteria 2143
391 Ga0395905_1064574 3300037471 Bacteria 712
392 Ga0395901_0000659 3300038443 Bacteria 39725
393 Ga0395901_0116714 3300038443 Bacteria 2804
394 Ga0395901_0647867 3300038443 Bacteria 1060
395 Ga0439438_049808 3300041405 Bacteria 1068
396 Ga0439439_0008327 3300041406 Bacteria 2447
397 Ga0439461_0016205 3300041410 Bacteria 1436
398 Ga0439466_0010876 3300041411 Bacteria 3374
399 Ga0439465_0055182 3300041413 Bacteria 1308
400 Ga0439465_0125647 3300041413 Unclassified 902
401 Ga0451798_0024146 3300041458 Bacteria 1003
402 Ga0439449_0360455 3300042007 Bacteria 551
403 Ga0439452_075344 3300042010 Bacteria 740
404 Ga0439462_0017706 3300042015 Bacteria 1846
405 Ga0450920_002354 3300042122 Bacteria 3207
406 Ga0450920_004158 3300042122 Bacteria 2536
407 Ga0450920_020994 3300042122 Bacteria 1260
408 Ga0450920_025283 3300042122 Bacteria 1156
409 Ga0450906_017989 3300042145 Bacteria 1270
410 Ga0450910_023340 3300042147 Bacteria 945
411 Ga0439446_0007253 3300042156 Bacteria 2911
412 Ga0439446_0157972 3300042156 Bacteria 748
413 Ga0450909_004358 3300042185 Bacteria 2019
414 Ga0439434_0005017 3300042435 Bacteria 3870
415 Ga0439434_0005079 3300042435 Bacteria 3847
416 Ga0439434_0254190 3300042435 Bacteria 601
417 Ga0439460_0184736 3300042461 Bacteria 706
418 Ga0495603_0041851 3300046455 Bacteria 2739
419 Ga0495631_0233404 3300046518 Bacteria 785
420 Ga0495644_0103365 3300046523 Bacteria 1079
421 Ga0495659_0203433 3300046664 Bacteria 813
422 Ga0495589_0181165 3300046794 Bacteria 999
423 Ga0495581_0713179 3300047315 Bacteria 578
424 Ga0495615_0032142 3300048090 Bacteria 1264
425 Ga0496104_0007865 3300048907 Bacteria 9451
426 Ga0496106_0123252 3300048909 Bacteria 2028
427 Ga0496106_0868188 3300048909 Bacteria 713
428 Ga0496107_0106878 3300048910 Bacteria 2056
429 Ga0496108_0216255 3300048911 Bacteria 1664
430 Ga0496109_0263510 3300048912 Bacteria 1623
431 Ga0496110_0068525 3300048913 Bacteria 3140
432 Ga0496110_0078842 3300048913 Bacteria 2932
433 Ga0496110_0304762 3300048913 Bacteria 1451
434 Ga0496112_1449162 3300048915 Bacteria 601
435 Ga0496113_0290778 3300048916 Bacteria 1307
436 Ga0496114_0333390 3300048917 Bacteria 1341
437 Ga0496115_1048601 3300048918 Bacteria 621
438 Ga0501031_0008749 3300049568 Bacteria 6584
439 Ga0501031_0020239 3300049568 Bacteria 4338
440 Ga0501031_0053595 3300049568 Bacteria 2628
441 Ga0501031_0161252 3300049568 Bacteria 1466
442 Ga0501031_0186515 3300049568 Bacteria 1355
443 Ga0501031_0282861 3300049568 Bacteria 1076
444 Ga0501031_0323167 3300049568 Bacteria 999
445 Ga0501032_0024827 3300049569 Bacteria 4135
446 Ga0501032_0034648 3300049569 Bacteria 3455
447 Ga0501032_0220246 3300049569 Bacteria 1235
448 Ga0501033_0032936 3300049570 Bacteria 3891
449 Ga0501033_0128485 3300049570 Bacteria 1837
450 Ga0501033_0180090 3300049570 Unclassified 1515
451 Ga0501033_0250276 3300049570 Bacteria 1256
452 Ga0501034_0235456 3300049571 Bacteria 1779
453 Ga0501034_0566350 3300049571 Bacteria 1044
454 Ga0501036_0002266 3300049572 Bacteria 15035
455 Ga0501036_0013125 3300049572 Bacteria 6881
456 Ga0501036_0144632 3300049572 Bacteria 2006
457 Ga0501036_0312536 3300049572 Bacteria 1313
458 Ga0501036_1021287 3300049572 Unclassified 677
459 Ga0501037_0026871 3300049573 Bacteria 4251
460 Ga0501037_0350369 3300049573 Bacteria 1019
461 Ga0501037_0530202 3300049573 Unclassified 796
462 Ga0501038_0023552 3300049574 Bacteria 5502
463 Ga0501038_0059913 3300049574 Bacteria 3259
464 Ga0501038_0120017 3300049574 Bacteria 2169
465 Ga0501038_0178525 3300049574 Bacteria 1715
466 Ga0501038_0311843 3300049574 Bacteria 1232
467 Ga0501038_0736899 3300049574 Bacteria 736
468 Ga0501039_0004372 3300049575 Bacteria 10650
469 Ga0501039_0004706 3300049575 Bacteria 10331
470 Ga0501039_0100006 3300049575 Bacteria 2263
471 Ga0501039_0167286 3300049575 Bacteria 1728
472 Ga0501039_0234886 3300049575 Bacteria 1441
473 Ga0501040_0002727 3300049576 Bacteria 11377
474 Ga0501040_0019579 3300049576 Bacteria 4503
475 Ga0501040_0049767 3300049576 Bacteria 2866
476 Ga0501040_0060034 3300049576 Bacteria 2613
477 Ga0501040_0062425 3300049576 Bacteria 2563
478 Ga0501040_0107307 3300049576 Bacteria 1951
479 Ga0501041_0023374 3300049577 Bacteria 3707
480 Ga0501041_0094818 3300049577 Bacteria 1843
481 Ga0501041_0122737 3300049577 Bacteria 1615
482 Ga0501041_0238946 3300049577 Bacteria 1141
483 Ga0501041_0257644 3300049577 Bacteria 1097
484 Ga0501041_0559995 3300049577 Bacteria 729
485 Ga0501041_0709517 3300049577 Bacteria 644
486 Ga0501041_0841048 3300049577 Bacteria 589
487 Ga0501041_0841513 3300049577 Bacteria 589
488 Ga0501042_0007220 3300049578 Bacteria 7270
489 Ga0501042_0046745 3300049578 Bacteria 3085
490 Ga0501042_0073848 3300049578 Bacteria 2440
491 Ga0501042_0075047 3300049578 Bacteria 2419
492 Ga0501042_0217902 3300049578 Bacteria 1377
493 Ga0501042_0467968 3300049578 Bacteria 914
494 Ga0501042_1394286 3300049578 Unclassified 511
495 Ga0501043_0032024 3300049579 Bacteria 4133
496 Ga0501043_0046715 3300049579 Bacteria 3405
497 Ga0501046_0007542 3300049580 Bacteria 9543
498 Ga0501046_0020150 3300049580 Bacteria 5520
499 Ga0501046_0029494 3300049580 Bacteria 4459
500 Ga0501046_0060592 3300049580 Bacteria 2961
501 Ga0501046_0969773 3300049580 Bacteria 591
502 Ga0501047_0100411 3300049581 Bacteria 2773
503 Ga0501048_0012857 3300049582 Bacteria 6218
504 Ga0501048_0015584 3300049582 Bacteria 5613
505 Ga0501048_0082828 3300049582 Bacteria 2262
506 Ga0501048_0119389 3300049582 Bacteria 1863
507 Ga0501048_0168284 3300049582 Bacteria 1552
508 Ga0501048_0218228 3300049582 Bacteria 1352
509 Ga0501067_0030021 3300049583 Bacteria 3013
510 Ga0501067_0263651 3300049583 Bacteria 959
511 Ga0501067_0482135 3300049583 Unclassified 693
512 Ga0501068_0004345 3300049584 Bacteria 7701
513 Ga0501068_0031551 3300049584 Bacteria 3147
514 Ga0501068_0247467 3300049584 Unclassified 1135
515 Ga0501068_1115960 3300049584 Bacteria 522
516 Ga0501069_0019037 3300049585 Bacteria 3709
517 Ga0501069_0042254 3300049585 Bacteria 2521
518 Ga0501069_0118402 3300049585 Bacteria 1511
519 Ga0501069_0259980 3300049585 Bacteria 1013
520 Ga0501069_0341777 3300049585 Unclassified 881
521 Ga0501070_0005068 3300049586 Bacteria 11225
522 Ga0501070_0088614 3300049586 Bacteria 2561
523 Ga0501070_0118282 3300049586 Bacteria 2190
524 Ga0501070_0143859 3300049586 Bacteria 1969
525 Ga0501070_0270467 3300049586 Bacteria 1388
526 Ga0501070_0271262 3300049586 Bacteria 1385
527 Ga0501071_0001368 3300049587 Bacteria 13973
528 Ga0501071_0012048 3300049587 Bacteria 5846
529 Ga0501071_0018480 3300049587 Bacteria 4827
530 Ga0501071_0043444 3300049587 Bacteria 3222
531 Ga0501071_0082258 3300049587 Bacteria 2357
532 Ga0501071_0088094 3300049587 Bacteria 2278
533 Ga0501071_0522747 3300049587 Bacteria 911
534 Ga0501072_0001109 3300049588 Bacteria 20036
535 Ga0501072_0005801 3300049588 Bacteria 9405
536 Ga0501072_0006081 3300049588 Bacteria 9212
537 Ga0501072_0010709 3300049588 Bacteria 6984
538 Ga0501072_0088695 3300049588 Bacteria 2454
539 Ga0501072_0118008 3300049588 Bacteria 2114
540 Ga0501072_0161118 3300049588 Bacteria 1790
541 Ga0501072_0217550 3300049588 Bacteria 1522
542 Ga0501072_0290822 3300049588 Bacteria 1299
543 Ga0501072_0293564 3300049588 Bacteria 1292
544 Ga0501073_0442421 3300049589 Unclassified 898
545 Ga0501073_0573031 3300049589 Bacteria 780
546 Ga0501073_0595502 3300049589 Bacteria 764
547 Ga0501073_0641099 3300049589 Bacteria 733
548 Ga0501074_0003261 3300049590 Bacteria 11467
549 Ga0501074_0003374 3300049590 Bacteria 11313
550 Ga0501074_0005604 3300049590 Bacteria 9034
551 Ga0501074_0114992 3300049590 Bacteria 1925
552 Ga0501074_0482397 3300049590 Bacteria 879
553 Ga0501074_0761156 3300049590 Bacteria 683
554 Ga0501074_1300533 3300049590 Bacteria 509
555 Ga0501075_0001925 3300049591 Bacteria 13691
556 Ga0501075_0006051 3300049591 Bacteria 8298
557 Ga0501075_0043193 3300049591 Bacteria 3380
558 Ga0501075_0068557 3300049591 Bacteria 2680
559 Ga0501075_0087406 3300049591 Bacteria 2362
560 Ga0501075_0122505 3300049591 Bacteria 1979
561 Ga0501075_0130906 3300049591 Bacteria 1911
562 Ga0501075_0180456 3300049591 Bacteria 1611
563 Ga0501075_0342815 3300049591 Bacteria 1139
564 Ga0501076_0003998 3300049592 Bacteria 10417
565 Ga0501076_0004892 3300049592 Bacteria 9580
566 Ga0501076_0027310 3300049592 Bacteria 4426
567 Ga0501076_0103392 3300049592 Bacteria 2298
568 Ga0501076_0223015 3300049592 Bacteria 1540
569 Ga0501076_0344361 3300049592 Bacteria 1224
570 Ga0501076_0409696 3300049592 Unclassified 1115
571 Ga0501076_0595587 3300049592 Bacteria 912
572 Ga0501076_0595631 3300049592 Bacteria 912
573 Ga0501076_0701231 3300049592 Bacteria 835
574 Ga0501076_0949827 3300049592 Unclassified 708
575 Ga0501077_0002813 3300049593 Bacteria 10437
576 Ga0501077_0006440 3300049593 Bacteria 7207
577 Ga0501077_0061302 3300049593 Bacteria 2387
578 Ga0501077_0093532 3300049593 Bacteria 1906
579 Ga0501077_0094848 3300049593 Bacteria 1891
580 Ga0501077_0152776 3300049593 Bacteria 1465
581 Ga0501077_0177973 3300049593 Bacteria 1351
582 Ga0501077_0235309 3300049593 Bacteria 1164
583 Ga0501077_0526422 3300049593 Bacteria 758
584 Ga0501077_0904270 3300049593 Unclassified 568
585 Ga0501079_0040890 3300049741 Bacteria 3577
586 Ga0501079_0051422 3300049741 Bacteria 3182
587 Ga0501079_0086315 3300049741 Bacteria 2429
588 Ga0501079_0094536 3300049741 Bacteria 2316
589 Ga0501079_0154203 3300049741 Bacteria 1790
590 Ga0501079_0178146 3300049741 Bacteria 1658
591 Ga0501079_0545278 3300049741 Unclassified 912
592 Ga0501079_0706558 3300049741 Bacteria 794
593 Ga0501079_0822354 3300049741 Bacteria 731
594 Ga0501079_1220020 3300049741 Bacteria 592
595 Ga0501080_0007711 3300049742 Bacteria 9729
596 Ga0501080_0054681 3300049742 Bacteria 3717
597 Ga0501080_0134701 3300049742 Bacteria 2286
598 Ga0501080_0165383 3300049742 Bacteria 2042
599 Ga0501080_0385284 3300049742 Unclassified 1263
600 Ga0501081_0000659 3300049743 Bacteria 19786
601 Ga0501081_0030419 3300049743 Bacteria 3654
602 Ga0501081_0039578 3300049743 Bacteria 3227
603 Ga0501081_0043722 3300049743 Bacteria 3073
604 Ga0501081_0056586 3300049743 Bacteria 2710
605 Ga0501081_1251151 3300049743 Unclassified 562
606 Ga0501083_0013217 3300049744 Bacteria 5770
607 Ga0501083_0018855 3300049744 Bacteria 4804
608 Ga0501083_0195359 3300049744 Bacteria 1320
609 Ga0501083_0198130 3300049744 Bacteria 1310
610 Ga0501035_0003920 3300049822 Bacteria 14190
611 Ga0501035_0051265 3300049822 Bacteria 3695
612 Ga0501035_0074636 3300049822 Bacteria 3000
613 Ga0501035_0089310 3300049822 Bacteria 2714
614 Ga0501035_0291625 3300049822 Bacteria 1377
615 Ga0501035_0545318 3300049822 Unclassified 950
616 Ga0501044_0065581 3300049823 Bacteria 3703
617 Ga0501044_0167545 3300049823 Bacteria 2170
618 Ga0501044_0386508 3300049823 Bacteria 1314
619 Ga0501045_0001440 3300049824 Bacteria 15848
620 Ga0501045_0004368 3300049824 Bacteria 9745
621 Ga0501045_0116459 3300049824 Bacteria 1983
622 Ga0501045_0269930 3300049824 Bacteria 1266
623 Ga0501045_0434918 3300049824 Bacteria 976
624 Ga0501045_0588743 3300049824 Bacteria 824
625 Ga0501045_0608180 3300049824 Bacteria 809
626 Ga0501045_0743383 3300049824 Unclassified 723
627 Ga0501045_1064924 3300049824 Bacteria 592
628 nmdc:mga05p37_145852_c1 3300050507 Unclassified 2899
629 nmdc:mga05p37_2024221_c1 3300050507 Bacteria 544
630 nmdc:mga05p37_534865_c1 3300050507 Bacteria 1337
631 nmdc:mga05p37_70866_c1 3300050507 Bacteria 4288
632 nmdc:mga09592_104078_c1 3300050508 Bacteria 2432
633 nmdc:mga09592_9247_c1 3300050508 Bacteria 8017
634 nmdc:mga0qj67_234109_c1 3300050509 Bacteria 1490
635 nmdc:mga0qj67_42951_c1 3300050509 Bacteria 3560
636 nmdc:mga06r32_158580_c1 3300050510 Bacteria 2245
637 nmdc:mga08y16_120302_c1 3300050511 Bacteria 2733
638 nmdc:mga08y16_1296758_c1 3300050511 Bacteria 695
639 nmdc:mga08y16_79843_c1 3300050511 Bacteria 3410
640 nmdc:mga08y16_80689_c1 3300050511 Bacteria 3392
641 nmdc:mga08y16_91977_c1 3300050511 Bacteria 3161
642 nmdc:mga08y16_96558_c1 3300050511 Bacteria 3078
643 nmdc:mga0n895_1148019_c1 3300050512 Bacteria 752
644 nmdc:mga0n895_252549_c1 3300050512 Unclassified 1789
645 nmdc:mga0rr50_86301_c1 3300050513 Bacteria 2434
646 nmdc:mga08x19_538124_c1 3300050514 Unclassified 826
647 nmdc:mga08x19_70276_c1 3300050514 Bacteria 2281
648 nmdc:mga0a205_245644_c1 3300050515 Bacteria 1670
649 nmdc:mga0a205_24623_c1 3300050515 Bacteria 5727
650 nmdc:mga0a205_796266_c1 3300050515 Bacteria 793
651 Ga0501084_0058285 3300054114 Bacteria 3231
652 Ga0501084_0100142 3300054114 Bacteria 2433
653 Ga0501084_0106630 3300054114 Bacteria 2354
654 Ga0501084_0107017 3300054114 Bacteria 2349
655 Ga0501084_0114573 3300054114 Bacteria 2266
656 Ga0501084_0122606 3300054114 Bacteria 2186
657 Ga0501084_0132475 3300054114 Bacteria 2098
658 Ga0501084_0260858 3300054114 Bacteria 1463
659 Ga0501084_0354120 3300054114 Bacteria 1240
660 Ga0501084_0933183 3300054114 Bacteria 730
661 Ga0590075_004441 3300059424 Bacteria 3319
662 Ga0590077_012271 3300059426 Bacteria 1775
663 Ga0501082_0005563 3300060353 Bacteria 10941
664 Ga0501082_0008296 3300060353 Bacteria 8958
665 Ga0501082_0026873 3300060353 Bacteria 4958
666 Ga0501082_0086758 3300060353 Bacteria 2699
667 Ga0501082_0745454 3300060353 Bacteria 857
668 Ga0501082_0810597 3300060353 Bacteria 819
669 Ga0501082_0849521 3300060353 Bacteria 798
670 Ga0501082_1529243 3300060353 Unclassified 583
671 Ga0530510_0012444 3300061734 Bacteria 5977
672 Ga0530510_0055360 3300061734 Bacteria 2865
673 Ga0530510_0077973 3300061734 Bacteria 2408
674 Ga0530510_0200364 3300061734 Bacteria 1482
675 Ga0530510_0244950 3300061734 Bacteria 1335
676 Ga0530510_0422623 3300061734 Bacteria 1006
677 Ga0530510_0452711 3300061734 Bacteria 970
678 Ga0530510_0561324 3300061734 Bacteria 867
679 Ga0530510_0741725 3300061734 Bacteria 749
680 Ga0530510_0753129 3300061734 Bacteria 743
681 Ga0105245_10462082
682 JGI24738J21930_10002914
683 Ga0070658_10008953
684 Ga0070676_10048475
685 Ga0070683_100004187
686 Ga0070683_100451548
687 Ga0070683_100474719
688 Ga0070683_101070465
689 Ga0070690_100127372
690 Ga0070670_100052125
691 Ga0070670_100216317
692 Ga0070670_100754534
693 Ga0068869_100113528
694 Ga0068869_100335729
695 Ga0070680_100094467
696 Ga0070680_100576172
697 Ga0070682_100136559
698 Ga0068868_100006170
699 Ga0068868_100017104
700 Ga0068868_100234229
701 Ga0068868_100457663
702 Ga0070660_100005081
703 Ga0070660_100184898
704 Ga0070660_100220160
705 Ga0070660_100726663
706 Ga0070660_101027965
707 Ga0070689_100015612
708 Ga0070689_100037772
709 Ga0070691_10042238
710 Ga0070691_10046512
711 Ga0070661_100073894
712 Ga0070661_100195490
713 Ga0070692_10015033
714 Ga0070668_100628484
715 Ga0070668_100651430
716 Ga0070668_100935861
717 Ga0070675_100008048
718 Ga0070675_100019931
719 Ga0070675_100028559
720 Ga0070675_100135430
721 Ga0070675_101468122
722 Ga0070675_101542162
723 Ga0070671_100463382
724 Ga0070671_101482448
725 Ga0070674_100037955
726 Ga0070674_100058348
727 Ga0070674_100060473
728 Ga0070673_100232723
729 Ga0070673_100324684
730 Ga0070688_100031485
731 Ga0070688_100344516
732 Ga0070688_100656484
733 Ga0070659_100062306
734 Ga0070667_100628391
735 Ga0070701_10034939
736 Ga0070701_10302795
737 Ga0070711_101101764
738 Ga0070700_100009619
739 Ga0070700_100645615
740 Ga0070694_100746448
741 Ga0070694_101117810
742 Ga0070663_100046667
743 Ga0070663_100193100
744 Ga0070663_100908108
745 Ga0070678_100235116
746 Ga0070678_100364995
747 Ga0070662_100049318
748 Ga0070662_100161746
749 Ga0070662_100615174
750 Ga0070662_101289887
751 Ga0070662_101301717
752 Ga0070681_10376379
753 Ga0068867_100110441
754 Ga0068867_100131982
755 Ga0068867_100538417
756 Ga0068867_101014756
757 Ga0068867_101134406
758 Ga0070685_10001514
759 Ga0070685_10005222
760 Ga0070685_10059690
761 Ga0070685_10570346
762 Ga0070706_100479946
763 Ga0070706_101524125
764 Ga0070707_100968061
765 Ga0070707_101153709
766 Ga0070698_100092747
767 Ga0070698_100829670
768 Ga0070698_100848250
769 Ga0070684_100018666
770 Ga0070684_100073845
771 Ga0070684_100172207
772 Ga0070684_100811861
773 Ga0068853_100033725
774 Ga0070672_100035683
775 Ga0070672_100071829
776 Ga0070672_100942024
777 Ga0070686_100014994
778 Ga0070686_100049186
779 Ga0070686_100080946
780 Ga0070686_100305018
781 Ga0070696_100907570
782 Ga0070693_100047111
783 Ga0070665_100014112
784 Ga0070665_100021434
785 Ga0070665_100618603
786 Ga0070665_100769979
787 Ga0070704_100025779
788 Ga0070704_100212983
789 Ga0070704_100858263
790 Ga0070704_101557364
791 Ga0070664_100005918
792 Ga0070664_100165075
793 Ga0070664_100304160
794 Ga0068857_100027569
795 Ga0068857_100812535
796 Ga0068854_100009127
797 Ga0068854_100152240
798 Ga0068854_100702648
799 Ga0068856_100267623
800 Ga0070702_100002965
801 Ga0070702_100450822
802 Ga0070702_100462912
803 Ga0068852_100007290
804 Ga0068852_100027972
805 Ga0068859_100184526
806 Ga0068859_101175722
807 Ga0068864_100012303
808 Ga0068864_100165246
809 Ga0068866_10081032
810 Ga0068866_10093363
811 Ga0068866_10220065
812 Ga0068861_100038628
813 Ga0068861_100267193
814 Ga0068851_10120748
815 Ga0068870_10000684
816 Ga0068870_10006288
817 Ga0068870_10035411
818 Ga0068870_10119102
819 Ga0068863_100166129
820 Ga0068858_100276798
821 Ga0068858_100798183
822 Ga0068858_100910645
823 Ga0068860_100309583
824 Ga0068860_101967689
825 Ga0068862_100767938
826 Ga0068862_101449729
827 Ga0081538_10002218
828 Ga0075432_10050376
829 Ga0097621_100109828
830 Ga0097621_100117379
831 Ga0097621_100471107
832 Ga0068871_100471055
833 Ga0075428_100093251
834 Ga0075430_100021412
835 Ga0075430_100382724
836 Ga0075431_100043068
837 Ga0075431_101600162
838 Ga0075433_10403765
839 Ga0075429_100245737
840 Ga0075429_100436143
841 Ga0075429_100593184
842 Ga0068865_100002179
843 Ga0068865_100015212
844 Ga0068865_100021528
845 Ga0068865_100280197
846 Ga0097620_100184523
847 Ga0097620_101175667
848 Ga0105244_10210055
849 Ga0105240_11631370
850 Ga0111539_10049725
851 Ga0111539_10052381
852 Ga0111539_10083649
853 Ga0111539_10100387
854 Ga0111539_10126409
855 Ga0111539_11108442
856 Ga0111539_11420344
857 Ga0111539_11730431
858 Ga0111539_12472023
859 Ga0105245_10042686
860 Ga0105245_10123720
861 Ga0105245_10423169
862 Ga0105245_10606648
863 Ga0114129_10312195
864 Ga0114129_10414160
865 Ga0114129_10564723
866 Ga0114129_10574584
867 Ga0114129_10864861
868 Ga0114129_11045777
869 Ga0114129_12454424
870 Ga0105243_10003840
871 Ga0105243_10081916
872 Ga0105243_10545449
873 Ga0105243_10644056
874 Ga0105243_11510758
875 Ga0105241_10176113
876 Ga0105242_10007369
877 Ga0105242_10041873
878 Ga0105242_10095928
879 Ga0105242_10372115
880 Ga0105248_10190924
881 Ga0105248_11137492
882 Ga0105238_10010288
883 Ga0105238_10518133
884 Ga0105238_11069814
885 Ga0105249_10279574
886 Ga0105249_10629673
887 Ga0105249_10820306
888 Ga0105249_10963173
889 Ga0105249_10981658
890 Ga0105239_10117523
891 Ga0105239_10125199
892 Ga0105239_11673644
893 Ga0105246_10070894
894 Ga0105246_10311278
895 Ga0105246_10385982
896 Ga0105246_10780565
897 Ga0157316_1013431
898 Ga0157371_10995004
899 Ga0157370_10425233
900 Ga0157378_10260153
901 Ga0157378_10288663
902 Ga0157378_11265909
903 Ga0163162_10048920
904 Ga0163162_10990025
905 Ga0157372_10318636
906 Ga0157372_11999673
907 Ga0157375_11109215
908 Ga0157375_11210767
909 Ga0157375_12499836
910 Ga0163163_10302108
911 Ga0163163_10380007
912 Ga0163163_10755896
913 Ga0163163_11636868
914 Ga0163163_12015562
915 Ga0157380_10043297
916 Ga0157380_10086661
917 Ga0157380_10110280
918 Ga0157380_10150707
919 Ga0157380_10394787
920 Ga0157377_10006807
921 Ga0157377_10124908
922 Ga0157377_10229375
923 Ga0157377_10392356
924 Ga0157376_10079144
925 Ga0157376_10266413
926 Ga0157376_12659120
927 Ga0163161_10283251
928 Ga0207642_10023241
929 Ga0207642_10165325
930 Ga0207642_10574463
931 Ga0207688_10000321
932 Ga0207688_10004897
933 Ga0207688_10043989
934 Ga0207645_10023446
935 Ga0207645_10051530
936 Ga0207643_10001573
937 Ga0207643_10017750
938 Ga0207643_10081031
939 Ga0207643_10405131
940 Ga0207643_10410369
941 Ga0207684_10521634
942 Ga0207707_10138058
943 Ga0207662_10418045
944 Ga0207657_10014673
945 Ga0207657_10022361
946 Ga0207657_10187669
947 Ga0207657_10948891
948 Ga0207649_10114324
949 Ga0207646_11029208
950 Ga0207650_10006043
951 Ga0207650_10230001
952 Ga0207650_10992285
953 Ga0207659_10095816
954 Ga0207659_10902868
955 Ga0207659_11033073
956 Ga0207687_10087822
957 Ga0207687_10110594
958 Ga0207687_10197645
959 Ga0207687_10496984
960 Ga0207644_10354083
961 Ga0207644_11348578
962 Ga0207690_10090668
963 Ga0207690_10104049
964 Ga0207690_10163438
965 Ga0207706_10026019
966 Ga0207706_10073223
967 Ga0207706_10132339
968 Ga0207706_10789785
969 Ga0207686_10193020
970 Ga0207686_10265765
971 Ga0207686_10552902
972 Ga0207709_10008349
973 Ga0207709_10075588
974 Ga0207709_10184640
975 Ga0207709_10287545
976 Ga0207670_10213153
977 Ga0207669_10008922
978 Ga0207669_10060047
979 Ga0207669_10197784
980 Ga0207669_10215167
981 Ga0207669_11128624
982 Ga0207704_10092787
983 Ga0207704_10101669
984 Ga0207704_10289300
985 Ga0207691_10002455
986 Ga0207691_10003824
987 Ga0207691_10023468
988 Ga0207691_10474770
989 Ga0207711_10425170
990 Ga0207689_10016523
991 Ga0207689_10113438
992 Ga0207661_10051572
993 Ga0207661_10188307
994 Ga0207661_10231368
995 Ga0207661_10355530
996 Ga0207679_10417942
997 Ga0207651_10757288
998 Ga0207712_10699365
999 Ga0207712_11040521
1000 Ga0207668_10120513
1001 Ga0207668_10332040
1002 Ga0207668_10396319
1003 Ga0207640_10081631
1004 Ga0207640_10116431
1005 Ga0207640_10304286
1006 Ga0207677_10333285
1007 Ga0207677_10491221
1008 Ga0207677_10716479
1009 Ga0207703_10169100
1010 Ga0207703_10523340
1011 Ga0207703_10904677
1012 Ga0207639_10115786
1013 Ga0207639_10895494
1014 Ga0207678_10068902
1015 Ga0207678_10125915
1016 Ga0207678_11050727
1017 Ga0207708_10001776
1018 Ga0207708_10053670
1019 Ga0207708_10123036
1020 Ga0207708_10691267
1021 Ga0207702_10402473
1022 Ga0207702_10711096
1023 Ga0207641_10868243
1024 Ga0207641_11283224
1025 Ga0207648_10017114
1026 Ga0207648_10019778
1027 Ga0207648_10441237
1028 Ga0207676_11477905
1029 Ga0207674_10026054
1030 Ga0207674_10066203
1031 Ga0207674_10732225
1032 Ga0207675_100015716
1033 Ga0207675_101178475
1034 Ga0207675_101183513
1035 Ga0207683_10007575
1036 Ga0207683_10008175
1037 Ga0207683_10074962
1038 Ga0207683_10183644
1039 Ga0207683_10310441
1040 Ga0207683_10630321
1041 Ga0207698_11109194
1042 Ga0209998_10055543
1043 Ga0207428_10003693
1044 Ga0207428_10024475
1045 Ga0268266_10085512
1046 Ga0268266_10155933
1047 Ga0268266_10266965
1048 Ga0268265_10145412
1049 Ga0268265_11129832
1050 Ga0268264_10032741
1051 Ga0268264_11034594
1052 Ga0307408_100674464
1053 Ga0307413_11249362
1054 Ga0307410_10324890
1055 Ga0307409_100039104
1056 Ga0307409_100518244
1057 Ga0307416_100156635
1058 Ga0307416_100315355
1059 Ga0307416_101911805
1060 Ga0307414_10872342
1061 Ga0307415_100862519
1062 Ga0307415_101087621
1063 Ga0373928_0022936
1064 Ga0373929_0113601
1065 Ga0373952_0007630
1066 Ga0373931_0008527
1067 Ga0395899_0038654
1068 Ga0395900_0005235
1069 Ga0395898_0059543
1070 Ga0395905_0156573
1071 Ga0395905_1064574
1072 Ga0395901_0000659
1073 Ga0395901_0116714
1074 Ga0395901_0647867
1075 Ga0439438_049808
1076 Ga0439439_0008327
1077 Ga0439461_0016205
1078 Ga0439466_0010876
1079 Ga0439465_0055182
1080 Ga0439465_0125647
1081 Ga0451798_0024146
1082 Ga0439449_0360455
1083 Ga0439452_075344
1084 Ga0439462_0017706
1085 Ga0450920_002354
1086 Ga0450920_004158
1087 Ga0450920_020994
1088 Ga0450920_025283
1089 Ga0450906_017989
1090 Ga0450910_023340
1091 Ga0439446_0007253
1092 Ga0439446_0157972
1093 Ga0450909_004358
1094 Ga0439434_0005017
1095 Ga0439434_0005079
1096 Ga0439434_0254190
1097 Ga0439460_0184736
1098 Ga0495603_0041851
1099 Ga0495631_0233404
1100 Ga0495644_0103365
1101 Ga0495659_0203433
1102 Ga0495589_0181165
1103 Ga0495581_0713179
1104 Ga0495615_0032142
1105 Ga0496104_0007865
1106 Ga0496106_0123252
1107 Ga0496106_0868188
1108 Ga0496107_0106878
1109 Ga0496108_0216255
1110 Ga0496109_0263510
1111 Ga0496110_0068525
1112 Ga0496110_0078842
1113 Ga0496110_0304762
1114 Ga0496112_1449162
1115 Ga0496113_0290778
1116 Ga0496114_0333390
1117 Ga0496115_1048601
1118 Ga0501031_0008749
1119 Ga0501031_0020239
1120 Ga0501031_0053595
1121 Ga0501031_0161252
1122 Ga0501031_0186515
1123 Ga0501031_0282861
1124 Ga0501031_0323167
1125 Ga0501032_0024827
1126 Ga0501032_0034648
1127 Ga0501032_0220246
1128 Ga0501033_0032936
1129 Ga0501033_0128485
1130 Ga0501033_0180090
1131 Ga0501033_0250276
1132 Ga0501034_0235456
1133 Ga0501034_0566350
1134 Ga0501036_0002266
1135 Ga0501036_0013125
1136 Ga0501036_0144632
1137 Ga0501036_0312536
1138 Ga0501036_1021287
1139 Ga0501037_0026871
1140 Ga0501037_0350369
1141 Ga0501037_0530202
1142 Ga0501038_0023552
1143 Ga0501038_0059913
1144 Ga0501038_0120017
1145 Ga0501038_0178525
1146 Ga0501038_0311843
1147 Ga0501038_0736899
1148 Ga0501039_0004372
1149 Ga0501039_0004706
1150 Ga0501039_0100006
1151 Ga0501039_0167286
1152 Ga0501039_0234886
1153 Ga0501040_0002727
1154 Ga0501040_0019579
1155 Ga0501040_0049767
1156 Ga0501040_0060034
1157 Ga0501040_0062425
1158 Ga0501040_0107307
1159 Ga0501041_0023374
1160 Ga0501041_0094818
1161 Ga0501041_0122737
1162 Ga0501041_0238946
1163 Ga0501041_0257644
1164 Ga0501041_0559995
1165 Ga0501041_0709517
1166 Ga0501041_0841048
1167 Ga0501041_0841513
1168 Ga0501042_0007220
1169 Ga0501042_0046745
1170 Ga0501042_0073848
1171 Ga0501042_0075047
1172 Ga0501042_0217902
1173 Ga0501042_0467968
1174 Ga0501042_1394286
1175 Ga0501043_0032024
1176 Ga0501043_0046715
1177 Ga0501046_0007542
1178 Ga0501046_0020150
1179 Ga0501046_0029494
1180 Ga0501046_0060592
1181 Ga0501046_0969773
1182 Ga0501047_0100411
1183 Ga0501048_0012857
1184 Ga0501048_0015584
1185 Ga0501048_0082828
1186 Ga0501048_0119389
1187 Ga0501048_0168284
1188 Ga0501048_0218228
1189 Ga0501067_0030021
1190 Ga0501067_0263651
1191 Ga0501067_0482135
1192 Ga0501068_0004345
1193 Ga0501068_0031551
1194 Ga0501068_0247467
1195 Ga0501068_1115960
1196 Ga0501069_0019037
1197 Ga0501069_0042254
1198 Ga0501069_0118402
1199 Ga0501069_0259980
1200 Ga0501069_0341777
1201 Ga0501070_0005068
1202 Ga0501070_0088614
1203 Ga0501070_0118282
1204 Ga0501070_0143859
1205 Ga0501070_0270467
1206 Ga0501070_0271262
1207 Ga0501071_0001368
1208 Ga0501071_0012048
1209 Ga0501071_0018480
1210 Ga0501071_0043444
1211 Ga0501071_0082258
1212 Ga0501071_0088094
1213 Ga0501071_0522747
1214 Ga0501072_0001109
1215 Ga0501072_0005801
1216 Ga0501072_0006081
1217 Ga0501072_0010709
1218 Ga0501072_0088695
1219 Ga0501072_0118008
1220 Ga0501072_0161118
1221 Ga0501072_0217550
1222 Ga0501072_0290822
1223 Ga0501072_0293564
1224 Ga0501073_0442421
1225 Ga0501073_0573031
1226 Ga0501073_0595502
1227 Ga0501073_0641099
1228 Ga0501074_0003261
1229 Ga0501074_0003374
1230 Ga0501074_0005604
1231 Ga0501074_0114992
1232 Ga0501074_0482397
1233 Ga0501074_0761156
1234 Ga0501074_1300533
1235 Ga0501075_0001925
1236 Ga0501075_0006051
1237 Ga0501075_0043193
1238 Ga0501075_0068557
1239 Ga0501075_0087406
1240 Ga0501075_0122505
1241 Ga0501075_0130906
1242 Ga0501075_0180456
1243 Ga0501075_0342815
1244 Ga0501076_0003998
1245 Ga0501076_0004892
1246 Ga0501076_0027310
1247 Ga0501076_0103392
1248 Ga0501076_0223015
1249 Ga0501076_0344361
1250 Ga0501076_0409696
1251 Ga0501076_0595587
1252 Ga0501076_0595631
1253 Ga0501076_0701231
1254 Ga0501076_0949827
1255 Ga0501077_0002813
1256 Ga0501077_0006440
1257 Ga0501077_0061302
1258 Ga0501077_0093532
1259 Ga0501077_0094848
1260 Ga0501077_0152776
1261 Ga0501077_0177973
1262 Ga0501077_0235309
1263 Ga0501077_0526422
1264 Ga0501077_0904270
1265 Ga0501079_0040890
1266 Ga0501079_0051422
1267 Ga0501079_0086315
1268 Ga0501079_0094536
1269 Ga0501079_0154203
1270 Ga0501079_0178146
1271 Ga0501079_0545278
1272 Ga0501079_0706558
1273 Ga0501079_0822354
1274 Ga0501079_1220020
1275 Ga0501080_0007711
1276 Ga0501080_0054681
1277 Ga0501080_0134701
1278 Ga0501080_0165383
1279 Ga0501080_0385284
1280 Ga0501081_0000659
1281 Ga0501081_0030419
1282 Ga0501081_0039578
1283 Ga0501081_0043722
1284 Ga0501081_0056586
1285 Ga0501081_1251151
1286 Ga0501083_0013217
1287 Ga0501083_0018855
1288 Ga0501083_0195359
1289 Ga0501083_0198130
1290 Ga0501035_0003920
1291 Ga0501035_0051265
1292 Ga0501035_0074636
1293 Ga0501035_0089310
1294 Ga0501035_0291625
1295 Ga0501035_0545318
1296 Ga0501044_0065581
1297 Ga0501044_0167545
1298 Ga0501044_0386508
1299 Ga0501045_0001440
1300 Ga0501045_0004368
1301 Ga0501045_0116459
1302 Ga0501045_0269930
1303 Ga0501045_0434918
1304 Ga0501045_0588743
1305 Ga0501045_0608180
1306 Ga0501045_0743383
1307 Ga0501045_1064924
1308 nmdc:mga05p37_145852_c1
1309 nmdc:mga05p37_2024221_c1
1310 nmdc:mga05p37_534865_c1
1311 nmdc:mga05p37_70866_c1
1312 nmdc:mga09592_104078_c1
1313 nmdc:mga09592_9247_c1
1314 nmdc:mga0qj67_234109_c1
1315 nmdc:mga0qj67_42951_c1
1316 nmdc:mga06r32_158580_c1
1317 nmdc:mga08y16_120302_c1
1318 nmdc:mga08y16_1296758_c1
1319 nmdc:mga08y16_79843_c1
1320 nmdc:mga08y16_80689_c1
1321 nmdc:mga08y16_91977_c1
1322 nmdc:mga08y16_96558_c1
1323 nmdc:mga0n895_1148019_c1
1324 nmdc:mga0n895_252549_c1
1325 nmdc:mga0rr50_86301_c1
1326 nmdc:mga08x19_538124_c1
1327 nmdc:mga08x19_70276_c1
1328 nmdc:mga0a205_245644_c1
1329 nmdc:mga0a205_24623_c1
1330 nmdc:mga0a205_796266_c1
1331 Ga0501084_0058285
1332 Ga0501084_0100142
1333 Ga0501084_0106630
1334 Ga0501084_0107017
1335 Ga0501084_0114573
1336 Ga0501084_0122606
1337 Ga0501084_0132475
1338 Ga0501084_0260858
1339 Ga0501084_0354120
1340 Ga0501084_0933183
1341 Ga0590075_004441
1342 Ga0590077_012271
1343 Ga0501082_0005563
1344 Ga0501082_0008296
1345 Ga0501082_0026873
1346 Ga0501082_0086758
1347 Ga0501082_0745454
1348 Ga0501082_0810597
1349 Ga0501082_0849521
1350 Ga0501082_1529243
1351 Ga0530510_0012444
1352 Ga0530510_0055360
1353 Ga0530510_0077973
1354 Ga0530510_0200364
1355 Ga0530510_0244950
1356 Ga0530510_0422623
1357 Ga0530510_0452711
1358 Ga0530510_0561324
1359 Ga0530510_0741725
1360 Ga0530510_0753129

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01047

MarR

MarR family

61

119

0.98

PF12802

MarR_2

MarR family

59

118

0.98

PF13463

HTH_27

Winged helix DNA-binding domain

61

127

0.97

PF13412

HTH_24

Winged helix-turn-helix DNA-binding

67

108

0.93

PF12840

HTH_20

Helix-turn-helix domain

65

110

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2wte-assembly1.cif.gz_B the structure of the crispr-associated protein, csa3, from sulfolobus solfataricus at 1.8 angstrom resolution. 0.9222 36 111
6wxq-assembly1.cif.gz_A crystal structure of crispr-associated transcription factor csa3 complexed with ca4 0.9178 36 107
4ija-assembly1.cif.gz_B structure of s. aureus methicillin resistance factor mecr2 0.9163 38 83
4yif-assembly2.cif.gz_D crystal structure of rv0880 0.9128 10 145
1z6r-assembly1.cif.gz_A crystal structure of mlc from escherichia coli 0.8901 40 83
ID Description Score Start End Superfamily
af_P15082_1_58_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9296 40 85 1.10.10.10
af_Q57693_7_69_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9209 41 107 1.10.10.10
4yifD00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9128 10 145 1.10.10.10
af_P76066_81_136_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9081 42 96 1.10.10.10
4u7bG02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9064 40 76 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A538CW33-F1-model_v4 MarR family transcriptional regulator 0.9654 22 143 GO:0003700
AF-A0A2X0ITT2-F1-model_v4 HTH marR-type domain-containing protein 0.9617 1 142 GO:0003700
AF-A0A538IA77-F1-model_v4 MarR family transcriptional regulator 0.9516 10 143 GO:0003700
AF-A0A498RRY6-F1-model_v4 deleted 0.944 1 142
AF-A0A6P2ND16-F1-model_v4 deleted 0.939 2 142

Map