F474717
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 679 | 234 | 679 | 292 |
Family's Representative Sequence
| Representative Sequence | 3300021388|Ga0213875_10000163|Ga0213875_1000016322 |
| Length | 265 |
| Sequence | MLPLVDKPLIQYGVEEAVSSGIQTIIIVTGRGKSSIEDHFDVSFELEQLLESKKKTEMLSMVRLISDMIDVAYVRQKEALGLGHAVLRSKELVGAEPFAVVLSDDIIASQTPCLRQLLDVYEFYGTSVLALMEVPGDQISAYGVVDAELVLNGSDNRLFRIRNMVEKPRPRDAPSNLAIIGRYILTPQIFESIEAVEPGSGGEIQLTDGLKHMLRERPIYGLKFEGKRYDAGDKLGFLKATVEFALERPDLGRAFREYLNDLCKQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 3 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 4 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 5 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 10 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 25 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 28 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 34 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 36 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 37 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 38 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 39 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 40 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 41 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 42 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 43 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 44 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 45 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 46 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 50 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 51 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 52 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 53 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 79 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 80 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 81 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 82 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 128 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 129 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 130 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 131 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 132 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 133 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 134 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 135 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 136 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 137 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 138 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 139 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 140 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 141 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 142 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 143 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 144 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 145 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 146 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 147 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 148 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 149 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 150 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 151 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 152 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 153 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 154 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 155 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 156 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 157 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 158 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 159 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 160 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 161 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 162 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 163 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 164 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 165 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 166 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 198 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 199 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 200 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 201 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 202 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 203 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 204 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 205 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 206 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 207 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 208 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 209 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 210 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 211 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 212 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 213 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 214 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 215 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 216 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 217 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 218 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 219 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 220 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 221 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 222 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 223 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 224 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 225 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 226 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 227 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 228 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 229 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 230 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 231 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 232 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 233 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 234 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.15 |
| Nodule | 0 |
| Rhizoplane | 1.03 |
| Rhizosphere | 94.4 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.42 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_10009820 | 3300005327 | Bacteria | 7690 |
| 2 | Ga0070683_100000008 | 3300005329 | Bacteria | 329206 |
| 3 | Ga0070683_100058517 | 3300005329 | Bacteria | 3580 |
| 4 | Ga0070683_100089291 | 3300005329 | Bacteria | 2892 |
| 5 | Ga0070683_100199235 | 3300005329 | Bacteria | 1901 |
| 6 | Ga0070683_100613002 | 3300005329 | Bacteria | 1042 |
| 7 | Ga0070690_100290510 | 3300005330 | Bacteria | 1169 |
| 8 | Ga0070690_100307599 | 3300005330 | Bacteria | 1138 |
| 9 | Ga0068869_100256154 | 3300005334 | Bacteria | 1399 |
| 10 | Ga0068869_100380007 | 3300005334 | Bacteria | 1157 |
| 11 | Ga0070666_10000927 | 3300005335 | Bacteria | 17794 |
| 12 | Ga0070666_10158407 | 3300005335 | Bacteria | 1582 |
| 13 | Ga0070680_100007554 | 3300005336 | Bacteria | 8289 |
| 14 | Ga0070680_100085276 | 3300005336 | Bacteria | 2609 |
| 15 | Ga0070680_100142652 | 3300005336 | Bacteria | 2009 |
| 16 | Ga0070680_100186120 | 3300005336 | Bacteria | 1749 |
| 17 | Ga0068868_100023618 | 3300005338 | Bacteria | 4655 |
| 18 | Ga0068868_100075749 | 3300005338 | Bacteria | 2689 |
| 19 | Ga0068868_100093513 | 3300005338 | Bacteria | 2424 |
| 20 | Ga0068868_100119743 | 3300005338 | Bacteria | 2146 |
| 21 | Ga0070660_100002742 | 3300005339 | Bacteria | 12106 |
| 22 | Ga0070660_100032638 | 3300005339 | Bacteria | 3919 |
| 23 | Ga0070660_100375049 | 3300005339 | Bacteria | 1174 |
| 24 | Ga0070691_10002114 | 3300005341 | Bacteria | 8791 |
| 25 | Ga0070661_100129655 | 3300005344 | Bacteria | 1893 |
| 26 | Ga0070675_100337073 | 3300005354 | Bacteria | 1335 |
| 27 | Ga0070671_100018720 | 3300005355 | Bacteria | 5628 |
| 28 | Ga0070671_100267980 | 3300005355 | Bacteria | 1452 |
| 29 | Ga0070673_100123165 | 3300005364 | Bacteria | 2166 |
| 30 | Ga0070688_100150727 | 3300005365 | Bacteria | 1589 |
| 31 | Ga0070667_100055003 | 3300005367 | Bacteria | 3361 |
| 32 | Ga0070709_10030640 | 3300005434 | Bacteria | 3230 |
| 33 | Ga0070709_10063403 | 3300005434 | Bacteria | 2360 |
| 34 | Ga0070714_100003215 | 3300005435 | Bacteria | 12154 |
| 35 | Ga0070714_100058773 | 3300005435 | Bacteria | 3296 |
| 36 | Ga0070714_100064407 | 3300005435 | Bacteria | 3155 |
| 37 | Ga0070713_100167342 | 3300005436 | Bacteria | 1967 |
| 38 | Ga0070711_100042000 | 3300005439 | Bacteria | 3090 |
| 39 | Ga0070711_100090522 | 3300005439 | Bacteria | 2204 |
| 40 | Ga0070711_100318339 | 3300005439 | Bacteria | 1242 |
| 41 | Ga0070708_100284292 | 3300005445 | Bacteria | 1557 |
| 42 | Ga0070663_100060249 | 3300005455 | Bacteria | 2729 |
| 43 | Ga0070662_100043244 | 3300005457 | Bacteria | 3222 |
| 44 | Ga0070681_10006458 | 3300005458 | Bacteria | 11410 |
| 45 | Ga0070681_10009639 | 3300005458 | Bacteria | 9499 |
| 46 | Ga0070681_10063096 | 3300005458 | Bacteria | 3678 |
| 47 | Ga0070681_10089637 | 3300005458 | Bacteria | 3027 |
| 48 | Ga0070681_10090794 | 3300005458 | Bacteria | 3005 |
| 49 | Ga0070681_10097798 | 3300005458 | Bacteria | 2882 |
| 50 | Ga0070681_10123522 | 3300005458 | Bacteria | 2521 |
| 51 | Ga0068867_100046551 | 3300005459 | Bacteria | 3186 |
| 52 | Ga0070699_100268052 | 3300005518 | Bacteria | 1528 |
| 53 | Ga0070684_100000002 | 3300005535 | Bacteria | 257669 |
| 54 | Ga0070684_100002594 | 3300005535 | Bacteria | 13351 |
| 55 | Ga0070684_100078823 | 3300005535 | Bacteria | 2911 |
| 56 | Ga0070684_100094866 | 3300005535 | Bacteria | 2658 |
| 57 | Ga0070684_100098667 | 3300005535 | Bacteria | 2606 |
| 58 | Ga0070684_100225988 | 3300005535 | Bacteria | 1708 |
| 59 | Ga0068853_100003952 | 3300005539 | Bacteria | 11388 |
| 60 | Ga0068853_100016150 | 3300005539 | Bacteria | 6140 |
| 61 | Ga0068853_100592998 | 3300005539 | Bacteria | 1052 |
| 62 | Ga0070672_100269938 | 3300005543 | Bacteria | 1436 |
| 63 | Ga0070686_100037813 | 3300005544 | Bacteria | 2996 |
| 64 | Ga0070686_100283343 | 3300005544 | Bacteria | 1223 |
| 65 | Ga0070696_100008036 | 3300005546 | Bacteria | 7048 |
| 66 | Ga0070693_100071686 | 3300005547 | Bacteria | 2042 |
| 67 | Ga0070665_100013558 | 3300005548 | Bacteria | 8200 |
| 68 | Ga0070665_100051724 | 3300005548 | Bacteria | 4120 |
| 69 | Ga0070665_100078360 | 3300005548 | Bacteria | 3311 |
| 70 | Ga0070665_100179540 | 3300005548 | Bacteria | 2118 |
| 71 | Ga0068855_100005049 | 3300005563 | Bacteria | 16107 |
| 72 | Ga0068855_100009796 | 3300005563 | Bacteria | 11560 |
| 73 | Ga0068855_100014432 | 3300005563 | Bacteria | 9511 |
| 74 | Ga0068855_100023824 | 3300005563 | Bacteria | 7333 |
| 75 | Ga0068855_100051076 | 3300005563 | Bacteria | 4871 |
| 76 | Ga0068855_100146721 | 3300005563 | Bacteria | 2685 |
| 77 | Ga0068855_100149562 | 3300005563 | Bacteria | 2655 |
| 78 | Ga0068855_100184194 | 3300005563 | Bacteria | 2359 |
| 79 | Ga0068855_100268366 | 3300005563 | Bacteria | 1898 |
| 80 | Ga0068855_100416320 | 3300005563 | Bacteria | 1470 |
| 81 | Ga0068855_100489111 | 3300005563 | Bacteria | 1338 |
| 82 | Ga0068855_100536344 | 3300005563 | Bacteria | 1268 |
| 83 | Ga0070664_100058067 | 3300005564 | Bacteria | 3291 |
| 84 | Ga0070664_100069681 | 3300005564 | Bacteria | 3009 |
| 85 | Ga0070664_100105947 | 3300005564 | Bacteria | 2449 |
| 86 | Ga0068857_100011338 | 3300005577 | Bacteria | 7753 |
| 87 | Ga0068857_100015478 | 3300005577 | Bacteria | 6662 |
| 88 | Ga0068857_100041697 | 3300005577 | Bacteria | 4070 |
| 89 | Ga0068857_100101393 | 3300005577 | Bacteria | 2583 |
| 90 | Ga0068856_100003872 | 3300005614 | Bacteria | 15024 |
| 91 | Ga0068856_100004846 | 3300005614 | Bacteria | 13330 |
| 92 | Ga0068856_100033576 | 3300005614 | Bacteria | 5024 |
| 93 | Ga0068856_100035270 | 3300005614 | Bacteria | 4901 |
| 94 | Ga0068856_100051889 | 3300005614 | Bacteria | 4043 |
| 95 | Ga0068856_100058592 | 3300005614 | Bacteria | 3804 |
| 96 | Ga0068856_100196587 | 3300005614 | Bacteria | 2031 |
| 97 | Ga0068856_100246707 | 3300005614 | Bacteria | 1801 |
| 98 | Ga0068856_100332321 | 3300005614 | Bacteria | 1537 |
| 99 | Ga0068856_100340259 | 3300005614 | Bacteria | 1518 |
| 100 | Ga0068852_100022651 | 3300005616 | Bacteria | 5042 |
| 101 | Ga0068852_100256795 | 3300005616 | Bacteria | 1676 |
| 102 | Ga0068852_100303515 | 3300005616 | Bacteria | 1546 |
| 103 | Ga0068852_100339061 | 3300005616 | Bacteria | 1465 |
| 104 | Ga0068859_100036385 | 3300005617 | Bacteria | 4942 |
| 105 | Ga0068859_100232347 | 3300005617 | Bacteria | 1932 |
| 106 | Ga0068859_100260495 | 3300005617 | Bacteria | 1825 |
| 107 | Ga0068859_100795630 | 3300005617 | Bacteria | 1033 |
| 108 | Ga0068864_100186511 | 3300005618 | Bacteria | 1899 |
| 109 | Ga0068864_100221031 | 3300005618 | Bacteria | 1747 |
| 110 | Ga0068864_100430983 | 3300005618 | Bacteria | 1258 |
| 111 | Ga0068851_10045862 | 3300005834 | Bacteria | 2210 |
| 112 | Ga0068863_100031318 | 3300005841 | Bacteria | 5077 |
| 113 | Ga0068863_100039440 | 3300005841 | Bacteria | 4493 |
| 114 | Ga0068863_100130038 | 3300005841 | Bacteria | 2404 |
| 115 | Ga0068858_100007363 | 3300005842 | Bacteria | 10651 |
| 116 | Ga0068860_100011802 | 3300005843 | Bacteria | 8610 |
| 117 | Ga0068860_100115125 | 3300005843 | Bacteria | 2571 |
| 118 | Ga0068860_100182337 | 3300005843 | Bacteria | 2029 |
| 119 | Ga0068860_100632177 | 3300005843 | Bacteria | 1077 |
| 120 | Ga0081455_10022065 | 3300005937 | Bacteria | 5959 |
| 121 | Ga0081539_10031631 | 3300005985 | Bacteria | 3257 |
| 122 | Ga0070717_10072087 | 3300006028 | Bacteria | 2884 |
| 123 | Ga0070717_10156904 | 3300006028 | Bacteria | 1972 |
| 124 | Ga0070717_10204902 | 3300006028 | Bacteria | 1729 |
| 125 | Ga0070712_100083533 | 3300006175 | Bacteria | 2319 |
| 126 | Ga0097621_100002831 | 3300006237 | Bacteria | 11896 |
| 127 | Ga0097621_100026434 | 3300006237 | Bacteria | 4553 |
| 128 | Ga0097621_100080645 | 3300006237 | Bacteria | 2707 |
| 129 | Ga0097621_100127546 | 3300006237 | Bacteria | 2162 |
| 130 | Ga0097621_100142486 | 3300006237 | Bacteria | 2049 |
| 131 | Ga0097621_100176027 | 3300006237 | Bacteria | 1846 |
| 132 | Ga0097621_100255791 | 3300006237 | Bacteria | 1535 |
| 133 | Ga0097621_100276363 | 3300006237 | Bacteria | 1477 |
| 134 | Ga0097621_100363556 | 3300006237 | Bacteria | 1289 |
| 135 | Ga0068871_100024195 | 3300006358 | Bacteria | 4706 |
| 136 | Ga0068871_100033322 | 3300006358 | Bacteria | 4078 |
| 137 | Ga0068871_100046269 | 3300006358 | Bacteria | 3504 |
| 138 | Ga0068871_100112152 | 3300006358 | Bacteria | 2295 |
| 139 | Ga0068871_100217179 | 3300006358 | Bacteria | 1655 |
| 140 | Ga0075431_100002616 | 3300006847 | Bacteria | 17411 |
| 141 | Ga0068865_100020093 | 3300006881 | Bacteria | 4330 |
| 142 | Ga0068865_100096740 | 3300006881 | Bacteria | 2153 |
| 143 | Ga0068865_100247732 | 3300006881 | Bacteria | 1405 |
| 144 | Ga0068865_100251266 | 3300006881 | Bacteria | 1396 |
| 145 | Ga0075436_100003431 | 3300006914 | Bacteria | 10867 |
| 146 | Ga0097620_100036386 | 3300006931 | Bacteria | 4942 |
| 147 | Ga0097620_100232358 | 3300006931 | Bacteria | 1932 |
| 148 | Ga0097620_100260493 | 3300006931 | Bacteria | 1825 |
| 149 | Ga0097620_100795618 | 3300006931 | Bacteria | 1033 |
| 150 | Ga0105240_10000381 | 3300009093 | Bacteria | 83148 |
| 151 | Ga0105240_10000408 | 3300009093 | Bacteria | 79917 |
| 152 | Ga0105240_10002782 | 3300009093 | Bacteria | 27645 |
| 153 | Ga0105240_10002947 | 3300009093 | Bacteria | 26841 |
| 154 | Ga0105240_10006165 | 3300009093 | Bacteria | 17671 |
| 155 | Ga0105240_10035570 | 3300009093 | Bacteria | 6417 |
| 156 | Ga0105240_10069696 | 3300009093 | Bacteria | 4351 |
| 157 | Ga0105240_10075100 | 3300009093 | Bacteria | 4170 |
| 158 | Ga0105240_10187186 | 3300009093 | Bacteria | 2437 |
| 159 | Ga0105240_10197772 | 3300009093 | Bacteria | 2358 |
| 160 | Ga0105240_10208408 | 3300009093 | Bacteria | 2286 |
| 161 | Ga0105240_10402282 | 3300009093 | Bacteria | 1542 |
| 162 | Ga0105240_10505180 | 3300009093 | Bacteria | 1344 |
| 163 | Ga0105245_10013951 | 3300009098 | Bacteria | 6997 |
| 164 | Ga0105245_10025460 | 3300009098 | Bacteria | 5203 |
| 165 | Ga0105245_10025911 | 3300009098 | Bacteria | 5158 |
| 166 | Ga0105245_10035283 | 3300009098 | Bacteria | 4438 |
| 167 | Ga0105245_10038828 | 3300009098 | Bacteria | 4237 |
| 168 | Ga0105245_10040716 | 3300009098 | Bacteria | 4141 |
| 169 | Ga0105245_10061626 | 3300009098 | Bacteria | 3382 |
| 170 | Ga0105245_10482209 | 3300009098 | Bacteria | 1253 |
| 171 | Ga0105245_10580972 | 3300009098 | Bacteria | 1145 |
| 172 | Ga0114129_10044732 | 3300009147 | Bacteria | 6228 |
| 173 | Ga0114129_10462128 | 3300009147 | Bacteria | 1663 |
| 174 | Ga0105243_10059431 | 3300009148 | Bacteria | 3051 |
| 175 | Ga0105243_10190100 | 3300009148 | Bacteria | 1793 |
| 176 | Ga0105241_10019190 | 3300009174 | Bacteria | 5041 |
| 177 | Ga0105241_10050417 | 3300009174 | Bacteria | 3172 |
| 178 | Ga0105241_10056486 | 3300009174 | Bacteria | 3010 |
| 179 | Ga0105241_10130000 | 3300009174 | Bacteria | 2037 |
| 180 | Ga0105241_10214379 | 3300009174 | Bacteria | 1615 |
| 181 | Ga0105241_10386490 | 3300009174 | Bacteria | 1224 |
| 182 | Ga0105242_10006492 | 3300009176 | Bacteria | 9006 |
| 183 | Ga0105242_10076869 | 3300009176 | Bacteria | 2784 |
| 184 | Ga0105242_10193914 | 3300009176 | Bacteria | 1800 |
| 185 | Ga0105242_10311234 | 3300009176 | Bacteria | 1441 |
| 186 | Ga0105248_10008614 | 3300009177 | Bacteria | 11203 |
| 187 | Ga0105248_10020925 | 3300009177 | Bacteria | 7251 |
| 188 | Ga0105248_10031660 | 3300009177 | Bacteria | 5908 |
| 189 | Ga0105248_10048353 | 3300009177 | Bacteria | 4772 |
| 190 | Ga0105248_10084335 | 3300009177 | Bacteria | 3574 |
| 191 | Ga0105248_10239687 | 3300009177 | Bacteria | 2041 |
| 192 | Ga0105248_10615080 | 3300009177 | Bacteria | 1226 |
| 193 | Ga0105248_10639768 | 3300009177 | Unclassified | 1200 |
| 194 | Ga0105237_10004190 | 3300009545 | Bacteria | 16791 |
| 195 | Ga0105237_10028686 | 3300009545 | Bacteria | 5666 |
| 196 | Ga0105237_10028966 | 3300009545 | Bacteria | 5633 |
| 197 | Ga0105237_10045602 | 3300009545 | Bacteria | 4410 |
| 198 | Ga0105237_10158422 | 3300009545 | Bacteria | 2261 |
| 199 | Ga0105237_10239987 | 3300009545 | Bacteria | 1813 |
| 200 | Ga0105237_10491720 | 3300009545 | Bacteria | 1233 |
| 201 | Ga0105237_10575472 | 3300009545 | Bacteria | 1133 |
| 202 | Ga0105238_10002578 | 3300009551 | Bacteria | 18075 |
| 203 | Ga0105238_10026055 | 3300009551 | Bacteria | 5959 |
| 204 | Ga0105238_10036067 | 3300009551 | Bacteria | 5026 |
| 205 | Ga0105238_10038044 | 3300009551 | Bacteria | 4888 |
| 206 | Ga0105238_10049965 | 3300009551 | Bacteria | 4210 |
| 207 | Ga0105238_10095999 | 3300009551 | Bacteria | 2951 |
| 208 | Ga0105238_10165883 | 3300009551 | Bacteria | 2184 |
| 209 | Ga0105238_10264771 | 3300009551 | Bacteria | 1699 |
| 210 | Ga0105238_10614438 | 3300009551 | Bacteria | 1095 |
| 211 | Ga0105249_10002934 | 3300009553 | Bacteria | 14710 |
| 212 | Ga0105249_10014215 | 3300009553 | Bacteria | 7038 |
| 213 | Ga0105249_10074866 | 3300009553 | Bacteria | 3135 |
| 214 | Ga0105249_10150261 | 3300009553 | Bacteria | 2242 |
| 215 | Ga0105239_10007095 | 3300010375 | Bacteria | 12894 |
| 216 | Ga0105239_10009114 | 3300010375 | Bacteria | 11226 |
| 217 | Ga0105239_10030555 | 3300010375 | Bacteria | 5923 |
| 218 | Ga0105239_10121422 | 3300010375 | Bacteria | 2902 |
| 219 | Ga0105239_10126838 | 3300010375 | Bacteria | 2837 |
| 220 | Ga0105239_10164197 | 3300010375 | Bacteria | 2483 |
| 221 | Ga0105239_10175295 | 3300010375 | Bacteria | 2398 |
| 222 | Ga0105239_10913989 | 3300010375 | Bacteria | 1007 |
| 223 | Ga0105246_10006378 | 3300011119 | Bacteria | 7199 |
| 224 | Ga0105246_10089554 | 3300011119 | Bacteria | 2214 |
| 225 | Ga0105246_10400118 | 3300011119 | Bacteria | 1140 |
| 226 | Ga0157373_10165671 | 3300013100 | Bacteria | 1555 |
| 227 | Ga0157370_10001524 | 3300013104 | Bacteria | 28657 |
| 228 | Ga0157370_10003411 | 3300013104 | Bacteria | 18667 |
| 229 | Ga0157370_10155270 | 3300013104 | Bacteria | 2129 |
| 230 | Ga0157370_10232529 | 3300013104 | Bacteria | 1706 |
| 231 | Ga0157370_10278559 | 3300013104 | Bacteria | 1545 |
| 232 | Ga0157370_10349390 | 3300013104 | Bacteria | 1363 |
| 233 | Ga0157369_10001852 | 3300013105 | Bacteria | 25575 |
| 234 | Ga0157369_10012635 | 3300013105 | Bacteria | 9575 |
| 235 | Ga0157369_10061690 | 3300013105 | Bacteria | 4041 |
| 236 | Ga0157369_10110052 | 3300013105 | Bacteria | 2929 |
| 237 | Ga0157369_10117083 | 3300013105 | Bacteria | 2829 |
| 238 | Ga0157369_10118372 | 3300013105 | Bacteria | 2811 |
| 239 | Ga0157369_10250689 | 3300013105 | Bacteria | 1848 |
| 240 | Ga0157369_10267352 | 3300013105 | Bacteria | 1783 |
| 241 | Ga0157369_10737820 | 3300013105 | Bacteria | 1013 |
| 242 | Ga0157374_10021617 | 3300013296 | Bacteria | 5729 |
| 243 | Ga0157374_10036701 | 3300013296 | Bacteria | 4492 |
| 244 | Ga0157374_10076247 | 3300013296 | Bacteria | 3170 |
| 245 | Ga0157374_10076405 | 3300013296 | Bacteria | 3167 |
| 246 | Ga0157374_10363619 | 3300013296 | Bacteria | 1439 |
| 247 | Ga0157378_10023708 | 3300013297 | Bacteria | 5398 |
| 248 | Ga0157378_10057735 | 3300013297 | Bacteria | 3460 |
| 249 | Ga0157378_10089884 | 3300013297 | Bacteria | 2791 |
| 250 | Ga0157378_10200032 | 3300013297 | Bacteria | 1889 |
| 251 | Ga0157378_10249841 | 3300013297 | Bacteria | 1697 |
| 252 | Ga0163162_10153404 | 3300013306 | Bacteria | 2422 |
| 253 | Ga0163162_10213547 | 3300013306 | Bacteria | 2059 |
| 254 | Ga0163162_10426024 | 3300013306 | Bacteria | 1459 |
| 255 | Ga0163162_10591152 | 3300013306 | Bacteria | 1237 |
| 256 | Ga0163162_10707760 | 3300013306 | Bacteria | 1129 |
| 257 | Ga0163162_10783023 | 3300013306 | Bacteria | 1072 |
| 258 | Ga0157372_10064041 | 3300013307 | Bacteria | 4124 |
| 259 | Ga0157372_10118166 | 3300013307 | Bacteria | 3042 |
| 260 | Ga0157372_10190074 | 3300013307 | Bacteria | 2378 |
| 261 | Ga0157372_10211217 | 3300013307 | Bacteria | 2249 |
| 262 | Ga0157375_10008398 | 3300013308 | Bacteria | 9044 |
| 263 | Ga0157375_10360290 | 3300013308 | Bacteria | 1620 |
| 264 | Ga0157375_10413155 | 3300013308 | Bacteria | 1516 |
| 265 | Ga0157375_10591881 | 3300013308 | Bacteria | 1269 |
| 266 | Ga0163163_10000134 | 3300014325 | Bacteria | 76268 |
| 267 | Ga0163163_10023286 | 3300014325 | Bacteria | 5875 |
| 268 | Ga0163163_10038278 | 3300014325 | Bacteria | 4673 |
| 269 | Ga0163163_10110146 | 3300014325 | Bacteria | 2781 |
| 270 | Ga0163163_10187729 | 3300014325 | Bacteria | 2115 |
| 271 | Ga0163163_10250146 | 3300014325 | Bacteria | 1823 |
| 272 | Ga0163163_10400448 | 3300014325 | Bacteria | 1431 |
| 273 | Ga0157380_10056749 | 3300014326 | Bacteria | 3116 |
| 274 | Ga0157380_10348742 | 3300014326 | Bacteria | 1384 |
| 275 | Ga0157379_10269428 | 3300014968 | Bacteria | 1548 |
| 276 | Ga0157379_10360155 | 3300014968 | Bacteria | 1333 |
| 277 | Ga0157379_10442694 | 3300014968 | Bacteria | 1198 |
| 278 | Ga0157376_10004167 | 3300014969 | Bacteria | 10024 |
| 279 | Ga0157376_10080409 | 3300014969 | Bacteria | 2796 |
| 280 | Ga0157376_10442449 | 3300014969 | Bacteria | 1266 |
| 281 | Ga0213872_10001118 | 3300021361 | Bacteria | 18361 |
| 282 | Ga0213874_10054956 | 3300021377 | Bacteria | 1232 |
| 283 | Ga0213876_10005305 | 3300021384 | Bacteria | 7094 |
| 284 | Ga0213875_10000002 | 3300021388 | Bacteria | 921066 |
| 285 | Ga0213875_10000163 | 3300021388 | Bacteria | 69287 |
| 286 | Ga0213875_10013064 | 3300021388 | Bacteria | 4085 |
| 287 | Ga0213875_10016290 | 3300021388 | Bacteria | 3607 |
| 288 | Ga0213875_10022029 | 3300021388 | Bacteria | 3049 |
| 289 | Ga0213875_10049624 | 3300021388 | Bacteria | 1967 |
| 290 | Ga0207692_10030404 | 3300025898 | Bacteria | 2576 |
| 291 | Ga0207710_10124212 | 3300025900 | Bacteria | 1235 |
| 292 | Ga0207680_10005017 | 3300025903 | Bacteria | 6306 |
| 293 | Ga0207680_10171259 | 3300025903 | Bacteria | 1462 |
| 294 | Ga0207699_10221154 | 3300025906 | Bacteria | 1292 |
| 295 | Ga0207699_10295335 | 3300025906 | Bacteria | 1130 |
| 296 | Ga0207645_10061669 | 3300025907 | Bacteria | 2395 |
| 297 | Ga0207705_10096703 | 3300025909 | Bacteria | 2168 |
| 298 | Ga0207705_10117404 | 3300025909 | Bacteria | 1971 |
| 299 | Ga0207654_10002103 | 3300025911 | Bacteria | 10183 |
| 300 | Ga0207654_10012829 | 3300025911 | Unclassified | 4300 |
| 301 | Ga0207654_10015126 | 3300025911 | Bacteria | 3997 |
| 302 | Ga0207654_10042271 | 3300025911 | Bacteria | 2578 |
| 303 | Ga0207654_10123534 | 3300025911 | Bacteria | 1629 |
| 304 | Ga0207654_10230952 | 3300025911 | Bacteria | 1232 |
| 305 | Ga0207654_10317753 | 3300025911 | Bacteria | 1064 |
| 306 | Ga0207707_10002717 | 3300025912 | Bacteria | 15796 |
| 307 | Ga0207707_10004495 | 3300025912 | Bacteria | 12268 |
| 308 | Ga0207707_10014579 | 3300025912 | Bacteria | 6847 |
| 309 | Ga0207707_10131025 | 3300025912 | Bacteria | 2193 |
| 310 | Ga0207707_10171437 | 3300025912 | Bacteria | 1896 |
| 311 | Ga0207707_10189991 | 3300025912 | Bacteria | 1792 |
| 312 | Ga0207707_10221541 | 3300025912 | Bacteria | 1647 |
| 313 | Ga0207695_10002192 | 3300025913 | Bacteria | 29480 |
| 314 | Ga0207695_10003003 | 3300025913 | Bacteria | 24250 |
| 315 | Ga0207695_10003666 | 3300025913 | Bacteria | 21419 |
| 316 | Ga0207695_10004712 | 3300025913 | Bacteria | 18475 |
| 317 | Ga0207695_10013398 | 3300025913 | Bacteria | 9781 |
| 318 | Ga0207695_10014068 | 3300025913 | Bacteria | 9502 |
| 319 | Ga0207695_10022587 | 3300025913 | Bacteria | 7136 |
| 320 | Ga0207695_10039952 | 3300025913 | Bacteria | 5038 |
| 321 | Ga0207695_10068023 | 3300025913 | Bacteria | 3651 |
| 322 | Ga0207695_10073747 | 3300025913 | Bacteria | 3477 |
| 323 | Ga0207695_10302113 | 3300025913 | Bacteria | 1492 |
| 324 | Ga0207695_10351049 | 3300025913 | Bacteria | 1362 |
| 325 | Ga0207695_10539223 | 3300025913 | Bacteria | 1048 |
| 326 | Ga0207671_10004955 | 3300025914 | Bacteria | 12488 |
| 327 | Ga0207671_10033998 | 3300025914 | Bacteria | 3791 |
| 328 | Ga0207671_10065230 | 3300025914 | Bacteria | 2708 |
| 329 | Ga0207671_10072450 | 3300025914 | Bacteria | 2571 |
| 330 | Ga0207671_10106904 | 3300025914 | Bacteria | 2125 |
| 331 | Ga0207671_10162569 | 3300025914 | Bacteria | 1730 |
| 332 | Ga0207671_10338395 | 3300025914 | Bacteria | 1192 |
| 333 | Ga0207693_10046663 | 3300025915 | Bacteria | 3404 |
| 334 | Ga0207663_10024932 | 3300025916 | Bacteria | 3450 |
| 335 | Ga0207663_10041675 | 3300025916 | Bacteria | 2800 |
| 336 | Ga0207663_10106456 | 3300025916 | Bacteria | 1895 |
| 337 | Ga0207663_10234007 | 3300025916 | Bacteria | 1344 |
| 338 | Ga0207663_10368999 | 3300025916 | Bacteria | 1091 |
| 339 | Ga0207660_10039937 | 3300025917 | Bacteria | 3282 |
| 340 | Ga0207660_10080437 | 3300025917 | Bacteria | 2393 |
| 341 | Ga0207660_10088407 | 3300025917 | Bacteria | 2291 |
| 342 | Ga0207660_10221286 | 3300025917 | Bacteria | 1486 |
| 343 | Ga0207660_10406466 | 3300025917 | Bacteria | 1097 |
| 344 | Ga0207662_10368967 | 3300025918 | Bacteria | 967 |
| 345 | Ga0207657_10045424 | 3300025919 | Bacteria | 3855 |
| 346 | Ga0207657_10073910 | 3300025919 | Bacteria | 2879 |
| 347 | Ga0207657_10173964 | 3300025919 | Bacteria | 1743 |
| 348 | Ga0207649_10040324 | 3300025920 | Bacteria | 2837 |
| 349 | Ga0207649_10108707 | 3300025920 | Bacteria | 1849 |
| 350 | Ga0207652_10001801 | 3300025921 | Bacteria | 18612 |
| 351 | Ga0207652_10116067 | 3300025921 | Bacteria | 2378 |
| 352 | Ga0207694_10003089 | 3300025924 | Bacteria | 13330 |
| 353 | Ga0207694_10004347 | 3300025924 | Bacteria | 11066 |
| 354 | Ga0207694_10006916 | 3300025924 | Bacteria | 8612 |
| 355 | Ga0207694_10011443 | 3300025924 | Bacteria | 6695 |
| 356 | Ga0207694_10059591 | 3300025924 | Bacteria | 2969 |
| 357 | Ga0207694_10089551 | 3300025924 | Bacteria | 2427 |
| 358 | Ga0207694_10175149 | 3300025924 | Bacteria | 1738 |
| 359 | Ga0207694_10270690 | 3300025924 | Bacteria | 1393 |
| 360 | Ga0207687_10002645 | 3300025927 | Bacteria | 12129 |
| 361 | Ga0207687_10008818 | 3300025927 | Bacteria | 6592 |
| 362 | Ga0207687_10014193 | 3300025927 | Bacteria | 5212 |
| 363 | Ga0207687_10103311 | 3300025927 | Bacteria | 2101 |
| 364 | Ga0207687_10144881 | 3300025927 | Bacteria | 1806 |
| 365 | Ga0207687_10469983 | 3300025927 | Bacteria | 1045 |
| 366 | Ga0207687_10570909 | 3300025927 | Bacteria | 951 |
| 367 | Ga0207700_10010690 | 3300025928 | Bacteria | 5808 |
| 368 | Ga0207700_10120764 | 3300025928 | Bacteria | 2124 |
| 369 | Ga0207700_10132296 | 3300025928 | Bacteria | 2038 |
| 370 | Ga0207700_10212239 | 3300025928 | Bacteria | 1637 |
| 371 | Ga0207664_10003958 | 3300025929 | Bacteria | 9971 |
| 372 | Ga0207664_10029249 | 3300025929 | Bacteria | 4195 |
| 373 | Ga0207664_10066895 | 3300025929 | Bacteria | 2882 |
| 374 | Ga0207644_10027535 | 3300025931 | Bacteria | 3927 |
| 375 | Ga0207644_10374041 | 3300025931 | Bacteria | 1161 |
| 376 | Ga0207706_10057352 | 3300025933 | Bacteria | 3431 |
| 377 | Ga0207686_10023433 | 3300025934 | Bacteria | 3566 |
| 378 | Ga0207686_10029010 | 3300025934 | Bacteria | 3259 |
| 379 | Ga0207686_10083789 | 3300025934 | Bacteria | 2087 |
| 380 | Ga0207686_10154251 | 3300025934 | Bacteria | 1602 |
| 381 | Ga0207686_10222716 | 3300025934 | Bacteria | 1363 |
| 382 | Ga0207704_10012304 | 3300025938 | Bacteria | 4246 |
| 383 | Ga0207704_10080995 | 3300025938 | Bacteria | 2098 |
| 384 | Ga0207704_10181941 | 3300025938 | Bacteria | 1520 |
| 385 | Ga0207691_10250013 | 3300025940 | Bacteria | 1531 |
| 386 | Ga0207711_10001276 | 3300025941 | Bacteria | 23865 |
| 387 | Ga0207711_10031573 | 3300025941 | Bacteria | 4472 |
| 388 | Ga0207711_10059986 | 3300025941 | Bacteria | 3277 |
| 389 | Ga0207711_10302391 | 3300025941 | Bacteria | 1476 |
| 390 | Ga0207689_10061765 | 3300025942 | Bacteria | 3081 |
| 391 | Ga0207689_10264612 | 3300025942 | Bacteria | 1423 |
| 392 | Ga0207661_10000008 | 3300025944 | Bacteria | 451211 |
| 393 | Ga0207661_10004308 | 3300025944 | Bacteria | 9961 |
| 394 | Ga0207661_10134053 | 3300025944 | Bacteria | 2125 |
| 395 | Ga0207661_10263666 | 3300025944 | Bacteria | 1535 |
| 396 | Ga0207679_10174093 | 3300025945 | Bacteria | 1775 |
| 397 | Ga0207679_10199707 | 3300025945 | Bacteria | 1669 |
| 398 | Ga0207667_10005708 | 3300025949 | Bacteria | 15179 |
| 399 | Ga0207667_10006005 | 3300025949 | Bacteria | 14776 |
| 400 | Ga0207667_10016739 | 3300025949 | Bacteria | 8271 |
| 401 | Ga0207667_10017798 | 3300025949 | Bacteria | 7989 |
| 402 | Ga0207667_10025374 | 3300025949 | Bacteria | 6488 |
| 403 | Ga0207667_10040313 | 3300025949 | Bacteria | 4973 |
| 404 | Ga0207667_10052037 | 3300025949 | Bacteria | 4315 |
| 405 | Ga0207667_10231227 | 3300025949 | Bacteria | 1893 |
| 406 | Ga0207667_10238675 | 3300025949 | Bacteria | 1861 |
| 407 | Ga0207667_10319842 | 3300025949 | Bacteria | 1585 |
| 408 | Ga0207667_10329228 | 3300025949 | Bacteria | 1560 |
| 409 | Ga0207667_10787819 | 3300025949 | Bacteria | 948 |
| 410 | Ga0207651_10033584 | 3300025960 | Bacteria | 3311 |
| 411 | Ga0207651_10097837 | 3300025960 | Bacteria | 2168 |
| 412 | Ga0207712_10027513 | 3300025961 | Bacteria | 3798 |
| 413 | Ga0207712_10129888 | 3300025961 | Bacteria | 1918 |
| 414 | Ga0207640_10175259 | 3300025981 | Bacteria | 1602 |
| 415 | Ga0207677_10031753 | 3300026023 | Bacteria | 3385 |
| 416 | Ga0207677_10145343 | 3300026023 | Bacteria | 1821 |
| 417 | Ga0207677_10155288 | 3300026023 | Bacteria | 1771 |
| 418 | Ga0207703_10027702 | 3300026035 | Bacteria | 4462 |
| 419 | Ga0207703_10068868 | 3300026035 | Bacteria | 2916 |
| 420 | Ga0207639_10029023 | 3300026041 | Bacteria | 4046 |
| 421 | Ga0207639_10041913 | 3300026041 | Bacteria | 3429 |
| 422 | Ga0207639_10058306 | 3300026041 | Bacteria | 2969 |
| 423 | Ga0207639_10393532 | 3300026041 | Bacteria | 1247 |
| 424 | Ga0207678_10040173 | 3300026067 | Bacteria | 4058 |
| 425 | Ga0207702_10010815 | 3300026078 | Bacteria | 7612 |
| 426 | Ga0207702_10019879 | 3300026078 | Bacteria | 5563 |
| 427 | Ga0207702_10035328 | 3300026078 | Unclassified | 4180 |
| 428 | Ga0207702_10076619 | 3300026078 | Bacteria | 2891 |
| 429 | Ga0207702_10099210 | 3300026078 | Bacteria | 2567 |
| 430 | Ga0207702_10127375 | 3300026078 | Bacteria | 2288 |
| 431 | Ga0207702_10127549 | 3300026078 | Bacteria | 2286 |
| 432 | Ga0207702_10217551 | 3300026078 | Bacteria | 1779 |
| 433 | Ga0207702_10405241 | 3300026078 | Bacteria | 1316 |
| 434 | Ga0207702_10507232 | 3300026078 | Bacteria | 1176 |
| 435 | Ga0207641_10028899 | 3300026088 | Unclassified | 4583 |
| 436 | Ga0207641_10345677 | 3300026088 | Bacteria | 1416 |
| 437 | Ga0207641_10522198 | 3300026088 | Bacteria | 1155 |
| 438 | Ga0207648_10052871 | 3300026089 | Bacteria | 3551 |
| 439 | Ga0207648_10054929 | 3300026089 | Bacteria | 3477 |
| 440 | Ga0207648_10700259 | 3300026089 | Bacteria | 939 |
| 441 | Ga0207674_10000300 | 3300026116 | Bacteria | 62723 |
| 442 | Ga0207674_10002626 | 3300026116 | Bacteria | 22497 |
| 443 | Ga0207674_10003738 | 3300026116 | Bacteria | 18570 |
| 444 | Ga0207674_10125874 | 3300026116 | Bacteria | 2528 |
| 445 | Ga0207674_10132882 | 3300026116 | Bacteria | 2451 |
| 446 | Ga0207674_10166575 | 3300026116 | Bacteria | 2158 |
| 447 | Ga0207674_10567598 | 3300026116 | Bacteria | 1096 |
| 448 | Ga0207698_10089594 | 3300026142 | Bacteria | 2513 |
| 449 | Ga0207698_10096422 | 3300026142 | Bacteria | 2437 |
| 450 | Ga0207698_10406672 | 3300026142 | Bacteria | 1302 |
| 451 | Ga0268266_10067430 | 3300028379 | Bacteria | 3097 |
| 452 | Ga0268266_10082747 | 3300028379 | Bacteria | 2800 |
| 453 | Ga0268266_10132312 | 3300028379 | Bacteria | 2232 |
| 454 | Ga0268266_10206487 | 3300028379 | Bacteria | 1800 |
| 455 | Ga0268264_10044237 | 3300028381 | Bacteria | 3693 |
| 456 | Ga0268264_10128194 | 3300028381 | Bacteria | 2245 |
| 457 | Ga0268264_10247249 | 3300028381 | Bacteria | 1655 |
| 458 | Ga0268264_10341417 | 3300028381 | Bacteria | 1423 |
| 459 | Ga0268264_10365122 | 3300028381 | Bacteria | 1378 |
| 460 | Ga0265336_10018772 | 3300028666 | Bacteria | 2237 |
| 461 | Ga0265338_10084456 | 3300028800 | Bacteria | 2650 |
| 462 | Ga0265332_10014399 | 3300031238 | Bacteria | 3498 |
| 463 | Ga0265332_10029721 | 3300031238 | Bacteria | 2388 |
| 464 | Ga0265320_10015146 | 3300031240 | Bacteria | 4365 |
| 465 | Ga0265325_10000825 | 3300031241 | Bacteria | 22507 |
| 466 | Ga0265325_10045341 | 3300031241 | Bacteria | 2285 |
| 467 | Ga0265340_10008185 | 3300031247 | Bacteria | 5654 |
| 468 | Ga0265331_10043088 | 3300031250 | Bacteria | 2187 |
| 469 | Ga0265316_10000602 | 3300031344 | Bacteria | 40145 |
| 470 | Ga0265316_10007613 | 3300031344 | Bacteria | 10177 |
| 471 | Ga0265316_10026066 | 3300031344 | Bacteria | 4871 |
| 472 | Ga0265316_10066091 | 3300031344 | Bacteria | 2799 |
| 473 | Ga0265316_10115093 | 3300031344 | Bacteria | 2033 |
| 474 | Ga0265316_10338629 | 3300031344 | Bacteria | 1090 |
| 475 | Ga0265313_10081514 | 3300031595 | Bacteria | 1469 |
| 476 | Ga0265314_10001370 | 3300031711 | Bacteria | 27380 |
| 477 | Ga0265314_10002485 | 3300031711 | Bacteria | 18841 |
| 478 | Ga0265314_10089931 | 3300031711 | Bacteria | 2001 |
| 479 | Ga0265314_10121116 | 3300031711 | Bacteria | 1647 |
| 480 | Ga0265314_10136026 | 3300031711 | Bacteria | 1526 |
| 481 | Ga0265342_10091894 | 3300031712 | Bacteria | 1739 |
| 482 | Ga0373926_0033761 | 3300035083 | Bacteria | 1810 |
| 483 | Ga0373934_0001407 | 3300035086 | Bacteria | 8793 |
| 484 | Ga0373934_0118508 | 3300035086 | Bacteria | 1076 |
| 485 | Ga0373923_0113053 | 3300035111 | Bacteria | 1207 |
| 486 | Ga0373923_0161598 | 3300035111 | Bacteria | 1022 |
| 487 | Ga0373954_0014223 | 3300035118 | Bacteria | 3549 |
| 488 | Ga0373954_0027116 | 3300035118 | Bacteria | 2627 |
| 489 | Ga0373956_0107010 | 3300035119 | Bacteria | 1300 |
| 490 | Ga0373957_0042118 | 3300035120 | Bacteria | 1722 |
| 491 | Ga0373943_0042920 | 3300035170 | Bacteria | 2194 |
| 492 | Ga0373955_0202519 | 3300035172 | Bacteria | 1182 |
| 493 | Ga0373935_0033838 | 3300035692 | Bacteria | 3183 |
| 494 | Ga0373935_0097891 | 3300035692 | Bacteria | 1930 |
| 495 | Ga0373935_0154645 | 3300035692 | Bacteria | 1559 |
| 496 | Ga0373927_0002301 | 3300035695 | Bacteria | 13965 |
| 497 | Ga0373927_0003249 | 3300035695 | Bacteria | 11693 |
| 498 | Ga0373927_0184075 | 3300035695 | Bacteria | 1370 |
| 499 | Ga0373933_0040306 | 3300035724 | Bacteria | 2751 |
| 500 | Ga0373947_0001408 | 3300035725 | Bacteria | 14812 |
| 501 | Ga0373947_0014552 | 3300035725 | Bacteria | 4514 |
| 502 | Ga0373947_0044627 | 3300035725 | Bacteria | 2650 |
| 503 | Ga0373947_0055565 | 3300035725 | Bacteria | 2391 |
| 504 | Ga0373937_0032111 | 3300036401 | Bacteria | 4761 |
| 505 | Ga0373937_0038516 | 3300036401 | Bacteria | 4356 |
| 506 | Ga0373937_0062436 | 3300036401 | Bacteria | 3425 |
| 507 | Ga0373937_0083864 | 3300036401 | Bacteria | 2949 |
| 508 | Ga0373937_0136913 | 3300036401 | Bacteria | 2290 |
| 509 | Ga0373937_0137979 | 3300036401 | Bacteria | 2280 |
| 510 | Ga0373937_0237349 | 3300036401 | Bacteria | 1717 |
| 511 | Ga0373925_0000378 | 3300037068 | Bacteria | 46198 |
| 512 | Ga0373925_0003480 | 3300037068 | Bacteria | 12175 |
| 513 | Ga0373925_0006245 | 3300037068 | Bacteria | 8787 |
| 514 | Ga0373925_0014342 | 3300037068 | Bacteria | 5733 |
| 515 | Ga0373925_0143866 | 3300037068 | Bacteria | 1868 |
| 516 | Ga0373925_0167527 | 3300037068 | Bacteria | 1733 |
| 517 | Ga0395900_0704850 | 3300037418 | Bacteria | 943 |
| 518 | Ga0436364_0035509 | 3300037853 | Bacteria | 5220 |
| 519 | Ga0436364_0362933 | 3300037853 | Bacteria | 4399 |
| 520 | Ga0436364_0378137 | 3300037853 | Bacteria | 57218 |
| 521 | Ga0436364_0612043 | 3300037853 | Bacteria | 326330 |
| 522 | Ga0436364_0622297 | 3300037853 | Bacteria | 5348 |
| 523 | Ga0436364_0628087 | 3300037853 | Bacteria | 2896 |
| 524 | Ga0436364_0648475 | 3300037853 | Bacteria | 2047 |
| 525 | Ga0436364_0756434 | 3300037853 | Bacteria | 4244 |
| 526 | Ga0436364_0866914 | 3300037853 | Bacteria | 2033 |
| 527 | Ga0436364_0992705 | 3300037853 | Bacteria | 6507 |
| 528 | Ga0436364_1281089 | 3300037853 | Bacteria | 3166 |
| 529 | Ga0436364_1435313 | 3300037853 | Unclassified | 1922 |
| 530 | Ga0436364_1514273 | 3300037853 | Bacteria | 4146 |
| 531 | Ga0395901_0727805 | 3300038443 | Bacteria | 987 |
| 532 | Ga0436365_0158787 | 3300039437 | Bacteria | 6774 |
| 533 | Ga0436365_0240874 | 3300039437 | Bacteria | 1456 |
| 534 | Ga0436365_0330614 | 3300039437 | Bacteria | 1114 |
| 535 | Ga0436365_1109766 | 3300039437 | Bacteria | 1369 |
| 536 | Ga0436365_1200822 | 3300039437 | Bacteria | 15628 |
| 537 | Ga0436365_1637806 | 3300039437 | Bacteria | 2923 |
| 538 | Ga0436360_0581083 | 3300039438 | Bacteria | 4779 |
| 539 | Ga0436360_0589158 | 3300039438 | Bacteria | 1496 |
| 540 | Ga0436361_0510126 | 3300039447 | Bacteria | 27659 |
| 541 | Ga0436361_0938922 | 3300039447 | Bacteria | 958 |
| 542 | Ga0436363_0293846 | 3300039450 | Bacteria | 2256 |
| 543 | Ga0436363_0715765 | 3300039450 | Bacteria | 1393 |
| 544 | Ga0436362_0949689 | 3300039453 | Unclassified | 919 |
| 545 | Ga0436362_1115434 | 3300039453 | Bacteria | 1843 |
| 546 | Ga0436362_1227303 | 3300039453 | Bacteria | 1603 |
| 547 | Ga0466966_0045548 | 3300044684 | Bacteria | 2804 |
| 548 | Ga0466963_0418556 | 3300044694 | Bacteria | 945 |
| 549 | Ga0466959_0239771 | 3300045049 | Bacteria | 1253 |
| 550 | Ga0451576_0462789 | 3300045051 | Bacteria | 1332 |
| 551 | Ga0466958_0230756 | 3300045836 | Bacteria | 1182 |
| 552 | Ga0466967_0110332 | 3300045976 | Unclassified | 2527 |
| 553 | Ga0466967_0374964 | 3300045976 | Bacteria | 1381 |
| 554 | Ga0466967_0421749 | 3300045976 | Bacteria | 1301 |
| 555 | Ga0495592_0028742 | 3300046454 | Bacteria | 4208 |
| 556 | Ga0495592_0032053 | 3300046454 | Bacteria | 3969 |
| 557 | Ga0495592_0321929 | 3300046454 | Bacteria | 999 |
| 558 | Ga0495651_0006480 | 3300046462 | Bacteria | 8946 |
| 559 | Ga0495651_0199153 | 3300046462 | Bacteria | 1403 |
| 560 | Ga0495653_0032054 | 3300046463 | Bacteria | 4176 |
| 561 | Ga0495580_0003381 | 3300046472 | Bacteria | 13631 |
| 562 | Ga0495580_0008927 | 3300046472 | Bacteria | 7927 |
| 563 | Ga0495580_0067820 | 3300046472 | Bacteria | 2496 |
| 564 | Ga0495580_0069439 | 3300046472 | Bacteria | 2462 |
| 565 | Ga0495580_0079124 | 3300046472 | Bacteria | 2293 |
| 566 | Ga0495580_0099333 | 3300046472 | Bacteria | 2024 |
| 567 | Ga0495580_0162112 | 3300046472 | Bacteria | 1547 |
| 568 | Ga0495580_0188813 | 3300046472 | Bacteria | 1422 |
| 569 | Ga0495580_0235381 | 3300046472 | Bacteria | 1256 |
| 570 | Ga0495582_0004709 | 3300046473 | Bacteria | 7669 |
| 571 | Ga0495582_0068804 | 3300046473 | Bacteria | 1957 |
| 572 | Ga0495582_0159818 | 3300046473 | Bacteria | 1281 |
| 573 | Ga0495662_0003213 | 3300046476 | Bacteria | 8251 |
| 574 | Ga0495664_0043667 | 3300046477 | Bacteria | 2656 |
| 575 | Ga0495664_0159444 | 3300046477 | Bacteria | 1369 |
| 576 | Ga0495594_0045738 | 3300046499 | Bacteria | 2403 |
| 577 | Ga0495594_0172599 | 3300046499 | Bacteria | 1230 |
| 578 | Ga0495608_0077294 | 3300046511 | Bacteria | 2167 |
| 579 | Ga0495608_0079514 | 3300046511 | Bacteria | 2132 |
| 580 | Ga0495628_0048471 | 3300046516 | Bacteria | 3367 |
| 581 | Ga0495630_0017827 | 3300046517 | Bacteria | 5207 |
| 582 | Ga0495666_0153524 | 3300046526 | Bacteria | 1070 |
| 583 | Ga0495652_0021534 | 3300046529 | Bacteria | 5729 |
| 584 | Ga0495665_0025185 | 3300046531 | Bacteria | 3197 |
| 585 | Ga0495665_0075702 | 3300046531 | Bacteria | 1772 |
| 586 | Ga0495640_0114869 | 3300046533 | Bacteria | 1755 |
| 587 | Ga0495586_0230363 | 3300046535 | Bacteria | 1054 |
| 588 | Ga0495587_0000369 | 3300046536 | Bacteria | 32101 |
| 589 | Ga0495587_0069620 | 3300046536 | Bacteria | 2049 |
| 590 | Ga0495587_0072854 | 3300046536 | Bacteria | 1996 |
| 591 | Ga0495587_0170543 | 3300046536 | Bacteria | 1236 |
| 592 | Ga0495645_0007860 | 3300046543 | Bacteria | 7419 |
| 593 | Ga0495645_0149215 | 3300046543 | Bacteria | 1626 |
| 594 | Ga0495645_0300861 | 3300046543 | Bacteria | 1048 |
| 595 | Ga0495667_0007870 | 3300046559 | Bacteria | 7224 |
| 596 | Ga0495667_0228185 | 3300046559 | Bacteria | 1187 |
| 597 | Ga0495634_0015888 | 3300046642 | Bacteria | 5393 |
| 598 | Ga0495634_0106113 | 3300046642 | Bacteria | 1810 |
| 599 | Ga0495635_0094331 | 3300046663 | Bacteria | 2046 |
| 600 | Ga0495635_0166924 | 3300046663 | Bacteria | 1497 |
| 601 | Ga0495635_0223292 | 3300046663 | Bacteria | 1274 |
| 602 | Ga0495599_0064056 | 3300046678 | Bacteria | 2296 |
| 603 | Ga0495599_0148909 | 3300046678 | Bacteria | 1450 |
| 604 | Ga0495623_0045580 | 3300046679 | Bacteria | 2785 |
| 605 | Ga0495623_0058124 | 3300046679 | Bacteria | 2432 |
| 606 | Ga0495658_0074771 | 3300046683 | Bacteria | 1975 |
| 607 | Ga0495658_0152618 | 3300046683 | Bacteria | 1420 |
| 608 | Ga0495669_0171819 | 3300046684 | Bacteria | 1031 |
| 609 | Ga0495613_0019989 | 3300046689 | Bacteria | 4991 |
| 610 | Ga0495613_0051160 | 3300046689 | Bacteria | 3046 |
| 611 | Ga0495613_0155252 | 3300046689 | Bacteria | 1631 |
| 612 | Ga0495674_0016845 | 3300047319 | Bacteria | 6815 |
| 613 | Ga0495674_0034074 | 3300047319 | Bacteria | 4607 |
| 614 | Ga0495674_0045799 | 3300047319 | Bacteria | 3884 |
| 615 | Ga0495674_0143343 | 3300047319 | Bacteria | 2007 |
| 616 | Ga0495674_0195104 | 3300047319 | Bacteria | 1682 |
| 617 | Ga0495680_0008013 | 3300047322 | Bacteria | 9632 |
| 618 | Ga0495680_0259121 | 3300047322 | Bacteria | 1230 |
| 619 | Ga0495680_0401543 | 3300047322 | Bacteria | 946 |
| 620 | Ga0495684_0015364 | 3300047471 | Bacteria | 5892 |
| 621 | Ga0495684_0053527 | 3300047471 | Bacteria | 3079 |
| 622 | Ga0495593_0133090 | 3300047673 | Bacteria | 1262 |
| 623 | Ga0495602_0004609 | 3300048088 | Bacteria | 14379 |
| 624 | Ga0495602_0018093 | 3300048088 | Bacteria | 7048 |
| 625 | Ga0496100_0361467 | 3300048903 | Bacteria | 1099 |
| 626 | Ga0496102_0267405 | 3300048905 | Bacteria | 1612 |
| 627 | Ga0496104_0516043 | 3300048907 | Bacteria | 1106 |
| 628 | Ga0496106_0299299 | 3300048909 | Bacteria | 1290 |
| 629 | Ga0496112_0026195 | 3300048915 | Bacteria | 5608 |
| 630 | Ga0496115_0008018 | 3300048918 | Bacteria | 7795 |
| 631 | Ga0496115_0143296 | 3300048918 | Bacteria | 1971 |
| 632 | Ga0496126_0068125 | 3300048929 | Bacteria | 3179 |
| 633 | Ga0501031_0023494 | 3300049568 | Bacteria | 4019 |
| 634 | Ga0501032_0001165 | 3300049569 | Bacteria | 21094 |
| 635 | Ga0501032_0067914 | 3300049569 | Bacteria | 2381 |
| 636 | Ga0501034_0014757 | 3300049571 | Bacteria | 8041 |
| 637 | Ga0501034_0017376 | 3300049571 | Bacteria | 7378 |
| 638 | Ga0501034_0169336 | 3300049571 | Bacteria | 2152 |
| 639 | Ga0501036_0007493 | 3300049572 | Bacteria | 8900 |
| 640 | Ga0501037_0168254 | 3300049573 | Bacteria | 1559 |
| 641 | Ga0501038_0014476 | 3300049574 | Bacteria | 7187 |
| 642 | Ga0501039_0008248 | 3300049575 | Bacteria | 7939 |
| 643 | Ga0501043_0004312 | 3300049579 | Bacteria | 11577 |
| 644 | Ga0501046_0002931 | 3300049580 | Bacteria | 15788 |
| 645 | Ga0501046_0066720 | 3300049580 | Bacteria | 2804 |
| 646 | Ga0501047_0008796 | 3300049581 | Bacteria | 9526 |
| 647 | Ga0501047_0060307 | 3300049581 | Bacteria | 3661 |
| 648 | Ga0501047_0179672 | 3300049581 | Bacteria | 1982 |
| 649 | Ga0501047_0244580 | 3300049581 | Bacteria | 1644 |
| 650 | Ga0501067_0000907 | 3300049583 | Bacteria | 15936 |
| 651 | Ga0501068_0001120 | 3300049584 | Bacteria | 14174 |
| 652 | Ga0501069_0007271 | 3300049585 | Bacteria | 5808 |
| 653 | Ga0501070_0197493 | 3300049586 | Bacteria | 1652 |
| 654 | Ga0501072_0001993 | 3300049588 | Bacteria | 15211 |
| 655 | Ga0501073_0000471 | 3300049589 | Bacteria | 27854 |
| 656 | Ga0501073_0054455 | 3300049589 | Bacteria | 2801 |
| 657 | Ga0501074_0017378 | 3300049590 | Bacteria | 5218 |
| 658 | Ga0501076_0060938 | 3300049592 | Bacteria | 3003 |
| 659 | Ga0501077_0005967 | 3300049593 | Bacteria | 7441 |
| 660 | Ga0501079_0005210 | 3300049741 | Bacteria | 9660 |
| 661 | Ga0501080_0000006 | 3300049742 | Bacteria | 138444 |
| 662 | Ga0501083_0025741 | 3300049744 | Bacteria | 4072 |
| 663 | Ga0501035_0089298 | 3300049822 | Bacteria | 2714 |
| 664 | Ga0501035_0135646 | 3300049822 | Bacteria | 2143 |
| 665 | Ga0501044_0000814 | 3300049823 | Bacteria | 37495 |
| 666 | Ga0501044_0012973 | 3300049823 | Bacteria | 9022 |
| 667 | Ga0501044_0017662 | 3300049823 | Bacteria | 7651 |
| 668 | Ga0501044_0079518 | 3300049823 | Bacteria | 3322 |
| 669 | Ga0501044_0267766 | 3300049823 | Bacteria | 1645 |
| 670 | nmdc:mga05p37_130646_c1 | 3300050507 | Bacteria | 3081 |
| 671 | nmdc:mga05p37_180709_c1 | 3300050507 | Bacteria | 2566 |
| 672 | nmdc:mga05p37_294780_c1 | 3300050507 | Bacteria | 1929 |
| 673 | nmdc:mga0qj67_536406_c1 | 3300050509 | Bacteria | 939 |
| 674 | nmdc:mga06r32_52589_c1 | 3300050510 | Bacteria | 3901 |
| 675 | nmdc:mga08x19_974_c1 | 3300050514 | Bacteria | 11042 |
| 676 | Ga0500568_0000650 | 3300053139 | Bacteria | 25110 |
| 677 | Ga0501084_0000747 | 3300054114 | Bacteria | 24758 |
| 678 | Ga0501082_0000311 | 3300060353 | Bacteria | 43370 |
| 679 | Ga0501082_0016943 | 3300060353 | Bacteria | 6273 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046679 | Ga0495623_0058124 | Ga0495623_0058124_22_792 | 256 |
| 2 | 3300005539 | Ga0068853_100003952 | Ga0068853_1000039527 | 261 |
| 3 | 3300021388 | Ga0213875_10000163 | Ga0213875_1000016322 | 264 |
| 4 | 3300005329 | Ga0070683_100058517 | Ga0070683_1000585172 | 265 |
| 5 | 3300005336 | Ga0070680_100007554 | Ga0070680_1000075548 | 265 |
| 6 | 3300005339 | Ga0070660_100032638 | Ga0070660_1000326382 | 265 |
| 7 | 3300005355 | Ga0070671_100018720 | Ga0070671_1000187204 | 265 |
| 8 | 3300005457 | Ga0070662_100043244 | Ga0070662_1000432442 | 265 |
| 9 | 3300005535 | Ga0070684_100094866 | Ga0070684_1000948662 | 265 |
| 10 | 3300005535 | Ga0070684_100098667 | Ga0070684_1000986672 | 265 |
| 11 | 3300005547 | Ga0070693_100071686 | Ga0070693_1000716862 | 265 |
| 12 | 3300005548 | Ga0070665_100013558 | Ga0070665_1000135588 | 265 |
| 13 | 3300005563 | Ga0068855_100009796 | Ga0068855_1000097968 | 265 |
| 14 | 3300005563 | Ga0068855_100051076 | Ga0068855_1000510762 | 265 |
| 15 | 3300005563 | Ga0068855_100536344 | Ga0068855_1005363442 | 265 |
| 16 | 3300005564 | Ga0070664_100069681 | Ga0070664_1000696813 | 265 |
| 17 | 3300005614 | Ga0068856_100035270 | Ga0068856_1000352706 | 265 |
| 18 | 3300005616 | Ga0068852_100022651 | Ga0068852_1000226514 | 265 |
| 19 | 3300006028 | Ga0070717_10156904 | Ga0070717_101569042 | 265 |
| 20 | 3300006237 | Ga0097621_100127546 | Ga0097621_1001275462 | 265 |
| 21 | 3300006237 | Ga0097621_100276363 | Ga0097621_1002763631 | 265 |
| 22 | 3300009174 | Ga0105241_10050417 | Ga0105241_100504173 | 265 |
| 23 | 3300009545 | Ga0105237_10045602 | Ga0105237_100456026 | 265 |
| 24 | 3300009551 | Ga0105238_10038044 | Ga0105238_100380446 | 265 |
| 25 | 3300009553 | Ga0105249_10014215 | Ga0105249_100142154 | 265 |
| 26 | 3300010375 | Ga0105239_10007095 | Ga0105239_1000709513 | 265 |
| 27 | 3300013307 | Ga0157372_10190074 | Ga0157372_101900742 | 265 |
| 28 | 3300025913 | Ga0207695_10004712 | Ga0207695_100047124 | 265 |
| 29 | 3300025913 | Ga0207695_10014068 | Ga0207695_100140683 | 265 |
| 30 | 3300025917 | Ga0207660_10039937 | Ga0207660_100399371 | 265 |
| 31 | 3300025927 | Ga0207687_10144881 | Ga0207687_101448811 | 265 |
| 32 | 3300025929 | Ga0207664_10029249 | Ga0207664_100292495 | 265 |
| 33 | 3300025944 | Ga0207661_10134053 | Ga0207661_101340532 | 265 |
| 34 | 3300025949 | Ga0207667_10040313 | Ga0207667_100403135 | 265 |
| 35 | 3300025960 | Ga0207651_10033584 | Ga0207651_100335843 | 265 |
| 36 | 3300026142 | Ga0207698_10089594 | Ga0207698_100895942 | 265 |
| 37 | 3300028379 | Ga0268266_10067430 | Ga0268266_100674304 | 265 |
| 38 | 3300036401 | Ga0373937_0038516 | Ga0373937_0038516_3494_4291 | 265 |
| 39 | 3300037418 | Ga0395900_0704850 | Ga0395900_0704850_105_902 | 265 |
| 40 | 3300039437 | Ga0436365_0240874 | Ga0436365_0240874_37_834 | 265 |
| 41 | 3300039437 | Ga0436365_1109766 | Ga0436365_1109766_246_1046 | 265 |
| 42 | 3300039453 | Ga0436362_0949689 | Ga0436362_0949689_39_839 | 265 |
| 43 | 3300045976 | Ga0466967_0421749 | Ga0466967_0421749_437_1234 | 265 |
| 44 | 3300046472 | Ga0495580_0099333 | Ga0495580_0099333_1206_2003 | 265 |
| 45 | 3300046535 | Ga0495586_0230363 | Ga0495586_0230363_218_1015 | 265 |
| 46 | 3300046684 | Ga0495669_0171819 | Ga0495669_0171819_72_869 | 265 |
| 47 | 3300049581 | Ga0501047_0179672 | Ga0501047_0179672_477_1274 | 265 |
| 48 | 3300005548 | Ga0070665_100078360 | Ga0070665_1000783604 | 269 |
| 49 | 3300006237 | Ga0097621_100255791 | Ga0097621_1002557912 | 269 |
| 50 | 3300006358 | Ga0068871_100217179 | Ga0068871_1002171792 | 269 |
| 51 | 3300010375 | Ga0105239_10126838 | Ga0105239_101268383 | 269 |
| 52 | 3300013307 | Ga0157372_10211217 | Ga0157372_102112173 | 269 |
| 53 | 3300021388 | Ga0213875_10016290 | Ga0213875_100162904 | 269 |
| 54 | 3300025913 | Ga0207695_10039952 | Ga0207695_100399524 | 269 |
| 55 | 3300025921 | Ga0207652_10116067 | Ga0207652_101160673 | 269 |
| 56 | 3300025924 | Ga0207694_10089551 | Ga0207694_100895512 | 269 |
| 57 | 3300025934 | Ga0207686_10083789 | Ga0207686_100837892 | 269 |
| 58 | 3300026023 | Ga0207677_10031753 | Ga0207677_100317533 | 269 |
| 59 | 3300028379 | Ga0268266_10132312 | Ga0268266_101323121 | 269 |
| 60 | 3300031711 | Ga0265314_10002485 | Ga0265314_1000248511 | 269 |
| 61 | 3300050509 | nmdc:mga0qj67_536406_c1 | nmdc:mga0qj67_536406_c1_27_836 | 269 |
| 62 | 3300049588 | Ga0501072_0001993 | Ga0501072_0001993_33_875 | 280 |
| 63 | 3300039447 | Ga0436361_0938922 | Ga0436361_0938922_56_934 | 292 |
| 64 | 3300005354 | Ga0070675_100337073 | Ga0070675_1003370731 | 293 |
| 65 | 3300005617 | Ga0068859_100036385 | Ga0068859_1000363851 | 293 |
| 66 | 3300005618 | Ga0068864_100221031 | Ga0068864_1002210312 | 293 |
| 67 | 3300005843 | Ga0068860_100182337 | Ga0068860_1001823372 | 293 |
| 68 | 3300006358 | Ga0068871_100046269 | Ga0068871_1000462691 | 293 |
| 69 | 3300006881 | Ga0068865_100251266 | Ga0068865_1002512661 | 293 |
| 70 | 3300006931 | Ga0097620_100036386 | Ga0097620_1000363861 | 293 |
| 71 | 3300009148 | Ga0105243_10190100 | Ga0105243_101901001 | 293 |
| 72 | 3300013306 | Ga0163162_10591152 | Ga0163162_105911521 | 293 |
| 73 | 3300025898 | Ga0207692_10030404 | Ga0207692_100304041 | 293 |
| 74 | 3300025928 | Ga0207700_10010690 | Ga0207700_100106903 | 293 |
| 75 | 3300025938 | Ga0207704_10181941 | Ga0207704_101819412 | 293 |
| 76 | 3300026089 | Ga0207648_10052871 | Ga0207648_100528712 | 293 |
| 77 | 3300028381 | Ga0268264_10247249 | Ga0268264_102472491 | 293 |
| 78 | 3300035086 | Ga0373934_0118508 | Ga0373934_0118508_80_961 | 293 |
| 79 | 3300035170 | Ga0373943_0042920 | Ga0373943_0042920_160_1041 | 293 |
| 80 | 3300036401 | Ga0373937_0237349 | Ga0373937_0237349_67_948 | 293 |
| 81 | 3300037068 | Ga0373925_0014342 | Ga0373925_0014342_186_1067 | 293 |
| 82 | 3300037853 | Ga0436364_0378137 | Ga0436364_0378137_34653_35537 | 293 |
| 83 | 3300039437 | Ga0436365_0330614 | Ga0436365_0330614_148_1038 | 293 |
| 84 | 3300039453 | Ga0436362_1227303 | Ga0436362_1227303_562_1452 | 293 |
| 85 | 3300046454 | Ga0495592_0032053 | Ga0495592_0032053_268_1149 | 293 |
| 86 | 3300046477 | Ga0495664_0159444 | Ga0495664_0159444_142_1023 | 293 |
| 87 | 3300046536 | Ga0495587_0000369 | Ga0495587_0000369_6971_7852 | 293 |
| 88 | 3300046543 | Ga0495645_0149215 | Ga0495645_0149215_343_1224 | 293 |
| 89 | 3300046678 | Ga0495599_0148909 | Ga0495599_0148909_176_1057 | 293 |
| 90 | 3300048088 | Ga0495602_0004609 | Ga0495602_0004609_11632_12513 | 293 |
| 91 | 3300005329 | Ga0070683_100000008 | Ga0070683_100000008228 | 294 |
| 92 | 3300005329 | Ga0070683_100089291 | Ga0070683_1000892914 | 294 |
| 93 | 3300005329 | Ga0070683_100199235 | Ga0070683_1001992351 | 294 |
| 94 | 3300005329 | Ga0070683_100613002 | Ga0070683_1006130021 | 294 |
| 95 | 3300005330 | Ga0070690_100290510 | Ga0070690_1002905102 | 294 |
| 96 | 3300005330 | Ga0070690_100307599 | Ga0070690_1003075991 | 294 |
| 97 | 3300005334 | Ga0068869_100256154 | Ga0068869_1002561542 | 294 |
| 98 | 3300005334 | Ga0068869_100380007 | Ga0068869_1003800072 | 294 |
| 99 | 3300005335 | Ga0070666_10000927 | Ga0070666_100009276 | 294 |
| 100 | 3300005335 | Ga0070666_10158407 | Ga0070666_101584071 | 294 |
| 101 | 3300005336 | Ga0070680_100085276 | Ga0070680_1000852762 | 294 |
| 102 | 3300005336 | Ga0070680_100142652 | Ga0070680_1001426522 | 294 |
| 103 | 3300005336 | Ga0070680_100186120 | Ga0070680_1001861202 | 294 |
| 104 | 3300005338 | Ga0068868_100023618 | Ga0068868_1000236186 | 294 |
| 105 | 3300005338 | Ga0068868_100075749 | Ga0068868_1000757492 | 294 |
| 106 | 3300005338 | Ga0068868_100093513 | Ga0068868_1000935132 | 294 |
| 107 | 3300005338 | Ga0068868_100119743 | Ga0068868_1001197433 | 294 |
| 108 | 3300005339 | Ga0070660_100002742 | Ga0070660_1000027428 | 294 |
| 109 | 3300005339 | Ga0070660_100375049 | Ga0070660_1003750491 | 294 |
| 110 | 3300005341 | Ga0070691_10002114 | Ga0070691_100021141 | 294 |
| 111 | 3300005344 | Ga0070661_100129655 | Ga0070661_1001296552 | 294 |
| 112 | 3300005355 | Ga0070671_100267980 | Ga0070671_1002679801 | 294 |
| 113 | 3300005364 | Ga0070673_100123165 | Ga0070673_1001231652 | 294 |
| 114 | 3300005365 | Ga0070688_100150727 | Ga0070688_1001507272 | 294 |
| 115 | 3300005367 | Ga0070667_100055003 | Ga0070667_1000550032 | 294 |
| 116 | 3300005434 | Ga0070709_10030640 | Ga0070709_100306401 | 294 |
| 117 | 3300005434 | Ga0070709_10063403 | Ga0070709_100634033 | 294 |
| 118 | 3300005435 | Ga0070714_100003215 | Ga0070714_10000321510 | 294 |
| 119 | 3300005435 | Ga0070714_100058773 | Ga0070714_1000587733 | 294 |
| 120 | 3300005435 | Ga0070714_100064407 | Ga0070714_1000644072 | 294 |
| 121 | 3300005436 | Ga0070713_100167342 | Ga0070713_1001673422 | 294 |
| 122 | 3300005439 | Ga0070711_100042000 | Ga0070711_1000420002 | 294 |
| 123 | 3300005439 | Ga0070711_100090522 | Ga0070711_1000905222 | 294 |
| 124 | 3300005439 | Ga0070711_100318339 | Ga0070711_1003183392 | 294 |
| 125 | 3300005445 | Ga0070708_100284292 | Ga0070708_1002842922 | 294 |
| 126 | 3300005455 | Ga0070663_100060249 | Ga0070663_1000602493 | 294 |
| 127 | 3300005458 | Ga0070681_10006458 | Ga0070681_100064582 | 294 |
| 128 | 3300005458 | Ga0070681_10063096 | Ga0070681_100630962 | 294 |
| 129 | 3300005458 | Ga0070681_10089637 | Ga0070681_100896372 | 294 |
| 130 | 3300005458 | Ga0070681_10090794 | Ga0070681_100907942 | 294 |
| 131 | 3300005458 | Ga0070681_10097798 | Ga0070681_100977983 | 294 |
| 132 | 3300005458 | Ga0070681_10123522 | Ga0070681_101235224 | 294 |
| 133 | 3300005459 | Ga0068867_100046551 | Ga0068867_1000465513 | 294 |
| 134 | 3300005518 | Ga0070699_100268052 | Ga0070699_1002680522 | 294 |
| 135 | 3300005535 | Ga0070684_100000002 | Ga0070684_100000002218 | 294 |
| 136 | 3300005535 | Ga0070684_100002594 | Ga0070684_10000259413 | 294 |
| 137 | 3300005535 | Ga0070684_100078823 | Ga0070684_1000788233 | 294 |
| 138 | 3300005535 | Ga0070684_100225988 | Ga0070684_1002259882 | 294 |
| 139 | 3300005539 | Ga0068853_100016150 | Ga0068853_1000161507 | 294 |
| 140 | 3300005539 | Ga0068853_100592998 | Ga0068853_1005929981 | 294 |
| 141 | 3300005543 | Ga0070672_100269938 | Ga0070672_1002699382 | 294 |
| 142 | 3300005544 | Ga0070686_100037813 | Ga0070686_1000378134 | 294 |
| 143 | 3300005544 | Ga0070686_100283343 | Ga0070686_1002833432 | 294 |
| 144 | 3300005546 | Ga0070696_100008036 | Ga0070696_1000080365 | 294 |
| 145 | 3300005548 | Ga0070665_100051724 | Ga0070665_1000517242 | 294 |
| 146 | 3300005548 | Ga0070665_100179540 | Ga0070665_1001795404 | 294 |
| 147 | 3300005563 | Ga0068855_100014432 | Ga0068855_1000144322 | 294 |
| 148 | 3300005563 | Ga0068855_100023824 | Ga0068855_1000238248 | 294 |
| 149 | 3300005563 | Ga0068855_100146721 | Ga0068855_1001467214 | 294 |
| 150 | 3300005563 | Ga0068855_100149562 | Ga0068855_1001495623 | 294 |
| 151 | 3300005563 | Ga0068855_100184194 | Ga0068855_1001841943 | 294 |
| 152 | 3300005563 | Ga0068855_100268366 | Ga0068855_1002683662 | 294 |
| 153 | 3300005563 | Ga0068855_100416320 | Ga0068855_1004163202 | 294 |
| 154 | 3300005563 | Ga0068855_100489111 | Ga0068855_1004891112 | 294 |
| 155 | 3300005564 | Ga0070664_100058067 | Ga0070664_1000580674 | 294 |
| 156 | 3300005564 | Ga0070664_100105947 | Ga0070664_1001059471 | 294 |
| 157 | 3300005577 | Ga0068857_100011338 | Ga0068857_1000113388 | 294 |
| 158 | 3300005577 | Ga0068857_100015478 | Ga0068857_1000154787 | 294 |
| 159 | 3300005577 | Ga0068857_100041697 | Ga0068857_1000416971 | 294 |
| 160 | 3300005577 | Ga0068857_100101393 | Ga0068857_1001013933 | 294 |
| 161 | 3300005614 | Ga0068856_100003872 | Ga0068856_10000387213 | 294 |
| 162 | 3300005614 | Ga0068856_100004846 | Ga0068856_1000048462 | 294 |
| 163 | 3300005614 | Ga0068856_100033576 | Ga0068856_1000335765 | 294 |
| 164 | 3300005614 | Ga0068856_100058592 | Ga0068856_1000585922 | 294 |
| 165 | 3300005614 | Ga0068856_100196587 | Ga0068856_1001965872 | 294 |
| 166 | 3300005614 | Ga0068856_100332321 | Ga0068856_1003323211 | 294 |
| 167 | 3300005614 | Ga0068856_100340259 | Ga0068856_1003402593 | 294 |
| 168 | 3300005616 | Ga0068852_100256795 | Ga0068852_1002567952 | 294 |
| 169 | 3300005616 | Ga0068852_100339061 | Ga0068852_1003390612 | 294 |
| 170 | 3300005617 | Ga0068859_100232347 | Ga0068859_1002323472 | 294 |
| 171 | 3300005617 | Ga0068859_100260495 | Ga0068859_1002604953 | 294 |
| 172 | 3300005617 | Ga0068859_100795630 | Ga0068859_1007956301 | 294 |
| 173 | 3300005618 | Ga0068864_100186511 | Ga0068864_1001865112 | 294 |
| 174 | 3300005618 | Ga0068864_100430983 | Ga0068864_1004309832 | 294 |
| 175 | 3300005834 | Ga0068851_10045862 | Ga0068851_100458621 | 294 |
| 176 | 3300005841 | Ga0068863_100031318 | Ga0068863_1000313186 | 294 |
| 177 | 3300005841 | Ga0068863_100039440 | Ga0068863_1000394406 | 294 |
| 178 | 3300005841 | Ga0068863_100130038 | Ga0068863_1001300382 | 294 |
| 179 | 3300005842 | Ga0068858_100007363 | Ga0068858_1000073636 | 294 |
| 180 | 3300005843 | Ga0068860_100011802 | Ga0068860_1000118028 | 294 |
| 181 | 3300005843 | Ga0068860_100115125 | Ga0068860_1001151252 | 294 |
| 182 | 3300005843 | Ga0068860_100632177 | Ga0068860_1006321771 | 294 |
| 183 | 3300005937 | Ga0081455_10022065 | Ga0081455_100220652 | 294 |
| 184 | 3300005985 | Ga0081539_10031631 | Ga0081539_100316312 | 294 |
| 185 | 3300006028 | Ga0070717_10072087 | Ga0070717_100720873 | 294 |
| 186 | 3300006028 | Ga0070717_10204902 | Ga0070717_102049022 | 294 |
| 187 | 3300006175 | Ga0070712_100083533 | Ga0070712_1000835332 | 294 |
| 188 | 3300006237 | Ga0097621_100002831 | Ga0097621_1000028312 | 294 |
| 189 | 3300006237 | Ga0097621_100026434 | Ga0097621_1000264346 | 294 |
| 190 | 3300006237 | Ga0097621_100080645 | Ga0097621_1000806452 | 294 |
| 191 | 3300006237 | Ga0097621_100142486 | Ga0097621_1001424862 | 294 |
| 192 | 3300006237 | Ga0097621_100176027 | Ga0097621_1001760273 | 294 |
| 193 | 3300006237 | Ga0097621_100363556 | Ga0097621_1003635562 | 294 |
| 194 | 3300006358 | Ga0068871_100024195 | Ga0068871_1000241956 | 294 |
| 195 | 3300006358 | Ga0068871_100033322 | Ga0068871_1000333223 | 294 |
| 196 | 3300006358 | Ga0068871_100112152 | Ga0068871_1001121522 | 294 |
| 197 | 3300006847 | Ga0075431_100002616 | Ga0075431_10000261615 | 294 |
| 198 | 3300006881 | Ga0068865_100020093 | Ga0068865_1000200933 | 294 |
| 199 | 3300006881 | Ga0068865_100096740 | Ga0068865_1000967403 | 294 |
| 200 | 3300006881 | Ga0068865_100247732 | Ga0068865_1002477322 | 294 |
| 201 | 3300006914 | Ga0075436_100003431 | Ga0075436_1000034315 | 294 |
| 202 | 3300006931 | Ga0097620_100232358 | Ga0097620_1002323584 | 294 |
| 203 | 3300006931 | Ga0097620_100260493 | Ga0097620_1002604933 | 294 |
| 204 | 3300006931 | Ga0097620_100795618 | Ga0097620_1007956181 | 294 |
| 205 | 3300009093 | Ga0105240_10000381 | Ga0105240_1000038161 | 294 |
| 206 | 3300009093 | Ga0105240_10000408 | Ga0105240_100004082 | 294 |
| 207 | 3300009093 | Ga0105240_10002782 | Ga0105240_1000278217 | 294 |
| 208 | 3300009093 | Ga0105240_10006165 | Ga0105240_100061651 | 294 |
| 209 | 3300009093 | Ga0105240_10035570 | Ga0105240_100355703 | 294 |
| 210 | 3300009093 | Ga0105240_10069696 | Ga0105240_100696965 | 294 |
| 211 | 3300009093 | Ga0105240_10075100 | Ga0105240_100751002 | 294 |
| 212 | 3300009093 | Ga0105240_10187186 | Ga0105240_101871862 | 294 |
| 213 | 3300009093 | Ga0105240_10197772 | Ga0105240_101977722 | 294 |
| 214 | 3300009093 | Ga0105240_10208408 | Ga0105240_102084082 | 294 |
| 215 | 3300009093 | Ga0105240_10505180 | Ga0105240_105051802 | 294 |
| 216 | 3300009098 | Ga0105245_10013951 | Ga0105245_100139515 | 294 |
| 217 | 3300009098 | Ga0105245_10025460 | Ga0105245_100254606 | 294 |
| 218 | 3300009098 | Ga0105245_10025911 | Ga0105245_100259116 | 294 |
| 219 | 3300009098 | Ga0105245_10035283 | Ga0105245_100352836 | 294 |
| 220 | 3300009098 | Ga0105245_10038828 | Ga0105245_100388281 | 294 |
| 221 | 3300009098 | Ga0105245_10040716 | Ga0105245_100407161 | 294 |
| 222 | 3300009098 | Ga0105245_10061626 | Ga0105245_100616264 | 294 |
| 223 | 3300009098 | Ga0105245_10482209 | Ga0105245_104822092 | 294 |
| 224 | 3300009098 | Ga0105245_10580972 | Ga0105245_105809721 | 294 |
| 225 | 3300009147 | Ga0114129_10044732 | Ga0114129_100447327 | 294 |
| 226 | 3300009147 | Ga0114129_10462128 | Ga0114129_104621282 | 294 |
| 227 | 3300009148 | Ga0105243_10059431 | Ga0105243_100594313 | 294 |
| 228 | 3300009174 | Ga0105241_10019190 | Ga0105241_100191902 | 294 |
| 229 | 3300009174 | Ga0105241_10056486 | Ga0105241_100564863 | 294 |
| 230 | 3300009174 | Ga0105241_10130000 | Ga0105241_101300003 | 294 |
| 231 | 3300009174 | Ga0105241_10214379 | Ga0105241_102143792 | 294 |
| 232 | 3300009174 | Ga0105241_10386490 | Ga0105241_103864901 | 294 |
| 233 | 3300009176 | Ga0105242_10006492 | Ga0105242_100064927 | 294 |
| 234 | 3300009176 | Ga0105242_10076869 | Ga0105242_100768692 | 294 |
| 235 | 3300009176 | Ga0105242_10193914 | Ga0105242_101939143 | 294 |
| 236 | 3300009176 | Ga0105242_10311234 | Ga0105242_103112341 | 294 |
| 237 | 3300009177 | Ga0105248_10008614 | Ga0105248_100086142 | 294 |
| 238 | 3300009177 | Ga0105248_10020925 | Ga0105248_100209255 | 294 |
| 239 | 3300009177 | Ga0105248_10031660 | Ga0105248_100316607 | 294 |
| 240 | 3300009177 | Ga0105248_10048353 | Ga0105248_100483531 | 294 |
| 241 | 3300009177 | Ga0105248_10084335 | Ga0105248_100843352 | 294 |
| 242 | 3300009177 | Ga0105248_10239687 | Ga0105248_102396872 | 294 |
| 243 | 3300009177 | Ga0105248_10615080 | Ga0105248_106150802 | 294 |
| 244 | 3300009177 | Ga0105248_10639768 | Ga0105248_106397681 | 294 |
| 245 | 3300009545 | Ga0105237_10004190 | Ga0105237_1000419016 | 294 |
| 246 | 3300009545 | Ga0105237_10028686 | Ga0105237_100286864 | 294 |
| 247 | 3300009545 | Ga0105237_10028966 | Ga0105237_100289662 | 294 |
| 248 | 3300009545 | Ga0105237_10158422 | Ga0105237_101584223 | 294 |
| 249 | 3300009545 | Ga0105237_10239987 | Ga0105237_102399872 | 294 |
| 250 | 3300009545 | Ga0105237_10491720 | Ga0105237_104917201 | 294 |
| 251 | 3300009545 | Ga0105237_10575472 | Ga0105237_105754721 | 294 |
| 252 | 3300009551 | Ga0105238_10002578 | Ga0105238_100025781 | 294 |
| 253 | 3300009551 | Ga0105238_10026055 | Ga0105238_100260552 | 294 |
| 254 | 3300009551 | Ga0105238_10036067 | Ga0105238_100360676 | 294 |
| 255 | 3300009551 | Ga0105238_10049965 | Ga0105238_100499656 | 294 |
| 256 | 3300009551 | Ga0105238_10095999 | Ga0105238_100959995 | 294 |
| 257 | 3300009551 | Ga0105238_10165883 | Ga0105238_101658833 | 294 |
| 258 | 3300009551 | Ga0105238_10264771 | Ga0105238_102647712 | 294 |
| 259 | 3300009551 | Ga0105238_10614438 | Ga0105238_106144381 | 294 |
| 260 | 3300009553 | Ga0105249_10002934 | Ga0105249_100029346 | 294 |
| 261 | 3300009553 | Ga0105249_10074866 | Ga0105249_100748663 | 294 |
| 262 | 3300009553 | Ga0105249_10150261 | Ga0105249_101502611 | 294 |
| 263 | 3300010375 | Ga0105239_10009114 | Ga0105239_1000911411 | 294 |
| 264 | 3300010375 | Ga0105239_10030555 | Ga0105239_100305552 | 294 |
| 265 | 3300010375 | Ga0105239_10121422 | Ga0105239_101214224 | 294 |
| 266 | 3300010375 | Ga0105239_10164197 | Ga0105239_101641974 | 294 |
| 267 | 3300010375 | Ga0105239_10175295 | Ga0105239_101752952 | 294 |
| 268 | 3300011119 | Ga0105246_10006378 | Ga0105246_100063787 | 294 |
| 269 | 3300011119 | Ga0105246_10089554 | Ga0105246_100895542 | 294 |
| 270 | 3300011119 | Ga0105246_10400118 | Ga0105246_104001181 | 294 |
| 271 | 3300013100 | Ga0157373_10165671 | Ga0157373_101656712 | 294 |
| 272 | 3300013104 | Ga0157370_10003411 | Ga0157370_100034112 | 294 |
| 273 | 3300013104 | Ga0157370_10155270 | Ga0157370_101552701 | 294 |
| 274 | 3300013104 | Ga0157370_10232529 | Ga0157370_102325293 | 294 |
| 275 | 3300013104 | Ga0157370_10278559 | Ga0157370_102785591 | 294 |
| 276 | 3300013104 | Ga0157370_10349390 | Ga0157370_103493902 | 294 |
| 277 | 3300013105 | Ga0157369_10001852 | Ga0157369_1000185215 | 294 |
| 278 | 3300013105 | Ga0157369_10061690 | Ga0157369_100616905 | 294 |
| 279 | 3300013105 | Ga0157369_10110052 | Ga0157369_101100525 | 294 |
| 280 | 3300013105 | Ga0157369_10117083 | Ga0157369_101170832 | 294 |
| 281 | 3300013105 | Ga0157369_10118372 | Ga0157369_101183722 | 294 |
| 282 | 3300013105 | Ga0157369_10250689 | Ga0157369_102506892 | 294 |
| 283 | 3300013105 | Ga0157369_10267352 | Ga0157369_102673521 | 294 |
| 284 | 3300013105 | Ga0157369_10737820 | Ga0157369_107378201 | 294 |
| 285 | 3300013296 | Ga0157374_10021617 | Ga0157374_100216176 | 294 |
| 286 | 3300013296 | Ga0157374_10036701 | Ga0157374_100367012 | 294 |
| 287 | 3300013296 | Ga0157374_10076247 | Ga0157374_100762472 | 294 |
| 288 | 3300013296 | Ga0157374_10076405 | Ga0157374_100764052 | 294 |
| 289 | 3300013297 | Ga0157378_10023708 | Ga0157378_100237083 | 294 |
| 290 | 3300013297 | Ga0157378_10057735 | Ga0157378_100577353 | 294 |
| 291 | 3300013297 | Ga0157378_10089884 | Ga0157378_100898843 | 294 |
| 292 | 3300013297 | Ga0157378_10200032 | Ga0157378_102000322 | 294 |
| 293 | 3300013297 | Ga0157378_10249841 | Ga0157378_102498413 | 294 |
| 294 | 3300013306 | Ga0163162_10153404 | Ga0163162_101534042 | 294 |
| 295 | 3300013306 | Ga0163162_10213547 | Ga0163162_102135472 | 294 |
| 296 | 3300013306 | Ga0163162_10426024 | Ga0163162_104260241 | 294 |
| 297 | 3300013306 | Ga0163162_10707760 | Ga0163162_107077602 | 294 |
| 298 | 3300013306 | Ga0163162_10783023 | Ga0163162_107830231 | 294 |
| 299 | 3300013307 | Ga0157372_10064041 | Ga0157372_100640416 | 294 |
| 300 | 3300013307 | Ga0157372_10118166 | Ga0157372_101181664 | 294 |
| 301 | 3300013308 | Ga0157375_10008398 | Ga0157375_100083989 | 294 |
| 302 | 3300013308 | Ga0157375_10360290 | Ga0157375_103602902 | 294 |
| 303 | 3300013308 | Ga0157375_10413155 | Ga0157375_104131551 | 294 |
| 304 | 3300013308 | Ga0157375_10591881 | Ga0157375_105918812 | 294 |
| 305 | 3300014325 | Ga0163163_10000134 | Ga0163163_100001348 | 294 |
| 306 | 3300014325 | Ga0163163_10023286 | Ga0163163_100232863 | 294 |
| 307 | 3300014325 | Ga0163163_10038278 | Ga0163163_100382781 | 294 |
| 308 | 3300014325 | Ga0163163_10110146 | Ga0163163_101101462 | 294 |
| 309 | 3300014325 | Ga0163163_10187729 | Ga0163163_101877291 | 294 |
| 310 | 3300014325 | Ga0163163_10250146 | Ga0163163_102501463 | 294 |
| 311 | 3300014325 | Ga0163163_10400448 | Ga0163163_104004482 | 294 |
| 312 | 3300014326 | Ga0157380_10056749 | Ga0157380_100567493 | 294 |
| 313 | 3300014326 | Ga0157380_10348742 | Ga0157380_103487422 | 294 |
| 314 | 3300014968 | Ga0157379_10269428 | Ga0157379_102694282 | 294 |
| 315 | 3300014968 | Ga0157379_10360155 | Ga0157379_103601552 | 294 |
| 316 | 3300014968 | Ga0157379_10442694 | Ga0157379_104426941 | 294 |
| 317 | 3300014969 | Ga0157376_10004167 | Ga0157376_100041673 | 294 |
| 318 | 3300014969 | Ga0157376_10080409 | Ga0157376_100804093 | 294 |
| 319 | 3300014969 | Ga0157376_10442449 | Ga0157376_104424491 | 294 |
| 320 | 3300021361 | Ga0213872_10001118 | Ga0213872_1000111814 | 294 |
| 321 | 3300021377 | Ga0213874_10054956 | Ga0213874_100549562 | 294 |
| 322 | 3300021384 | Ga0213876_10005305 | Ga0213876_100053053 | 294 |
| 323 | 3300021388 | Ga0213875_10000002 | Ga0213875_1000000227 | 294 |
| 324 | 3300021388 | Ga0213875_10013064 | Ga0213875_100130642 | 294 |
| 325 | 3300021388 | Ga0213875_10022029 | Ga0213875_100220292 | 294 |
| 326 | 3300021388 | Ga0213875_10049624 | Ga0213875_100496242 | 294 |
| 327 | 3300025900 | Ga0207710_10124212 | Ga0207710_101242122 | 294 |
| 328 | 3300025903 | Ga0207680_10005017 | Ga0207680_100050172 | 294 |
| 329 | 3300025903 | Ga0207680_10171259 | Ga0207680_101712592 | 294 |
| 330 | 3300025906 | Ga0207699_10221154 | Ga0207699_102211541 | 294 |
| 331 | 3300025906 | Ga0207699_10295335 | Ga0207699_102953351 | 294 |
| 332 | 3300025907 | Ga0207645_10061669 | Ga0207645_100616693 | 294 |
| 333 | 3300025909 | Ga0207705_10096703 | Ga0207705_100967033 | 294 |
| 334 | 3300025909 | Ga0207705_10117404 | Ga0207705_101174043 | 294 |
| 335 | 3300025911 | Ga0207654_10002103 | Ga0207654_100021034 | 294 |
| 336 | 3300025911 | Ga0207654_10012829 | Ga0207654_100128291 | 294 |
| 337 | 3300025911 | Ga0207654_10015126 | Ga0207654_100151263 | 294 |
| 338 | 3300025911 | Ga0207654_10042271 | Ga0207654_100422712 | 294 |
| 339 | 3300025911 | Ga0207654_10123534 | Ga0207654_101235342 | 294 |
| 340 | 3300025911 | Ga0207654_10230952 | Ga0207654_102309521 | 294 |
| 341 | 3300025911 | Ga0207654_10317753 | Ga0207654_103177531 | 294 |
| 342 | 3300025912 | Ga0207707_10002717 | Ga0207707_1000271713 | 294 |
| 343 | 3300025912 | Ga0207707_10004495 | Ga0207707_100044956 | 294 |
| 344 | 3300025912 | Ga0207707_10131025 | Ga0207707_101310252 | 294 |
| 345 | 3300025912 | Ga0207707_10171437 | Ga0207707_101714372 | 294 |
| 346 | 3300025912 | Ga0207707_10189991 | Ga0207707_101899912 | 294 |
| 347 | 3300025912 | Ga0207707_10221541 | Ga0207707_102215412 | 294 |
| 348 | 3300025913 | Ga0207695_10002192 | Ga0207695_1000219215 | 294 |
| 349 | 3300025913 | Ga0207695_10003003 | Ga0207695_100030032 | 294 |
| 350 | 3300025913 | Ga0207695_10003666 | Ga0207695_1000366618 | 294 |
| 351 | 3300025913 | Ga0207695_10013398 | Ga0207695_100133986 | 294 |
| 352 | 3300025913 | Ga0207695_10022587 | Ga0207695_100225876 | 294 |
| 353 | 3300025913 | Ga0207695_10068023 | Ga0207695_100680235 | 294 |
| 354 | 3300025913 | Ga0207695_10073747 | Ga0207695_100737472 | 294 |
| 355 | 3300025913 | Ga0207695_10302113 | Ga0207695_103021131 | 294 |
| 356 | 3300025913 | Ga0207695_10351049 | Ga0207695_103510491 | 294 |
| 357 | 3300025913 | Ga0207695_10539223 | Ga0207695_105392231 | 294 |
| 358 | 3300025914 | Ga0207671_10004955 | Ga0207671_1000495512 | 294 |
| 359 | 3300025914 | Ga0207671_10033998 | Ga0207671_100339982 | 294 |
| 360 | 3300025914 | Ga0207671_10065230 | Ga0207671_100652303 | 294 |
| 361 | 3300025914 | Ga0207671_10072450 | Ga0207671_100724503 | 294 |
| 362 | 3300025914 | Ga0207671_10106904 | Ga0207671_101069043 | 294 |
| 363 | 3300025914 | Ga0207671_10162569 | Ga0207671_101625691 | 294 |
| 364 | 3300025914 | Ga0207671_10338395 | Ga0207671_103383951 | 294 |
| 365 | 3300025915 | Ga0207693_10046663 | Ga0207693_100466633 | 294 |
| 366 | 3300025916 | Ga0207663_10024932 | Ga0207663_100249323 | 294 |
| 367 | 3300025916 | Ga0207663_10041675 | Ga0207663_100416752 | 294 |
| 368 | 3300025916 | Ga0207663_10106456 | Ga0207663_101064562 | 294 |
| 369 | 3300025916 | Ga0207663_10234007 | Ga0207663_102340072 | 294 |
| 370 | 3300025916 | Ga0207663_10368999 | Ga0207663_103689991 | 294 |
| 371 | 3300025917 | Ga0207660_10080437 | Ga0207660_100804372 | 294 |
| 372 | 3300025917 | Ga0207660_10088407 | Ga0207660_100884072 | 294 |
| 373 | 3300025917 | Ga0207660_10221286 | Ga0207660_102212861 | 294 |
| 374 | 3300025917 | Ga0207660_10406466 | Ga0207660_104064661 | 294 |
| 375 | 3300025918 | Ga0207662_10368967 | Ga0207662_103689671 | 294 |
| 376 | 3300025919 | Ga0207657_10045424 | Ga0207657_100454243 | 294 |
| 377 | 3300025919 | Ga0207657_10073910 | Ga0207657_100739102 | 294 |
| 378 | 3300025919 | Ga0207657_10173964 | Ga0207657_101739642 | 294 |
| 379 | 3300025920 | Ga0207649_10040324 | Ga0207649_100403241 | 294 |
| 380 | 3300025920 | Ga0207649_10108707 | Ga0207649_101087072 | 294 |
| 381 | 3300025921 | Ga0207652_10001801 | Ga0207652_1000180116 | 294 |
| 382 | 3300025924 | Ga0207694_10003089 | Ga0207694_1000308913 | 294 |
| 383 | 3300025924 | Ga0207694_10004347 | Ga0207694_100043474 | 294 |
| 384 | 3300025924 | Ga0207694_10006916 | Ga0207694_100069169 | 294 |
| 385 | 3300025924 | Ga0207694_10011443 | Ga0207694_100114435 | 294 |
| 386 | 3300025924 | Ga0207694_10059591 | Ga0207694_100595912 | 294 |
| 387 | 3300025924 | Ga0207694_10175149 | Ga0207694_101751491 | 294 |
| 388 | 3300025924 | Ga0207694_10270690 | Ga0207694_102706902 | 294 |
| 389 | 3300025927 | Ga0207687_10002645 | Ga0207687_1000264512 | 294 |
| 390 | 3300025927 | Ga0207687_10008818 | Ga0207687_100088188 | 294 |
| 391 | 3300025927 | Ga0207687_10014193 | Ga0207687_100141934 | 294 |
| 392 | 3300025927 | Ga0207687_10103311 | Ga0207687_101033112 | 294 |
| 393 | 3300025927 | Ga0207687_10469983 | Ga0207687_104699831 | 294 |
| 394 | 3300025927 | Ga0207687_10570909 | Ga0207687_105709091 | 294 |
| 395 | 3300025928 | Ga0207700_10120764 | Ga0207700_101207643 | 294 |
| 396 | 3300025928 | Ga0207700_10132296 | Ga0207700_101322961 | 294 |
| 397 | 3300025928 | Ga0207700_10212239 | Ga0207700_102122392 | 294 |
| 398 | 3300025929 | Ga0207664_10003958 | Ga0207664_100039583 | 294 |
| 399 | 3300025929 | Ga0207664_10066895 | Ga0207664_100668952 | 294 |
| 400 | 3300025931 | Ga0207644_10027535 | Ga0207644_100275354 | 294 |
| 401 | 3300025931 | Ga0207644_10374041 | Ga0207644_103740411 | 294 |
| 402 | 3300025933 | Ga0207706_10057352 | Ga0207706_100573524 | 294 |
| 403 | 3300025934 | Ga0207686_10023433 | Ga0207686_100234333 | 294 |
| 404 | 3300025934 | Ga0207686_10029010 | Ga0207686_100290102 | 294 |
| 405 | 3300025934 | Ga0207686_10154251 | Ga0207686_101542512 | 294 |
| 406 | 3300025934 | Ga0207686_10222716 | Ga0207686_102227162 | 294 |
| 407 | 3300025938 | Ga0207704_10012304 | Ga0207704_100123043 | 294 |
| 408 | 3300025938 | Ga0207704_10080995 | Ga0207704_100809952 | 294 |
| 409 | 3300025940 | Ga0207691_10250013 | Ga0207691_102500132 | 294 |
| 410 | 3300025941 | Ga0207711_10001276 | Ga0207711_1000127618 | 294 |
| 411 | 3300025941 | Ga0207711_10031573 | Ga0207711_100315734 | 294 |
| 412 | 3300025941 | Ga0207711_10059986 | Ga0207711_100599863 | 294 |
| 413 | 3300025941 | Ga0207711_10302391 | Ga0207711_103023912 | 294 |
| 414 | 3300025942 | Ga0207689_10061765 | Ga0207689_100617653 | 294 |
| 415 | 3300025942 | Ga0207689_10264612 | Ga0207689_102646122 | 294 |
| 416 | 3300025944 | Ga0207661_10000008 | Ga0207661_10000008218 | 294 |
| 417 | 3300025944 | Ga0207661_10004308 | Ga0207661_1000430810 | 294 |
| 418 | 3300025944 | Ga0207661_10263666 | Ga0207661_102636662 | 294 |
| 419 | 3300025945 | Ga0207679_10174093 | Ga0207679_101740932 | 294 |
| 420 | 3300025945 | Ga0207679_10199707 | Ga0207679_101997072 | 294 |
| 421 | 3300025949 | Ga0207667_10005708 | Ga0207667_100057083 | 294 |
| 422 | 3300025949 | Ga0207667_10006005 | Ga0207667_1000600510 | 294 |
| 423 | 3300025949 | Ga0207667_10016739 | Ga0207667_100167396 | 294 |
| 424 | 3300025949 | Ga0207667_10017798 | Ga0207667_100177982 | 294 |
| 425 | 3300025949 | Ga0207667_10025374 | Ga0207667_100253743 | 294 |
| 426 | 3300025949 | Ga0207667_10052037 | Ga0207667_100520372 | 294 |
| 427 | 3300025949 | Ga0207667_10238675 | Ga0207667_102386752 | 294 |
| 428 | 3300025949 | Ga0207667_10319842 | Ga0207667_103198422 | 294 |
| 429 | 3300025949 | Ga0207667_10329228 | Ga0207667_103292281 | 294 |
| 430 | 3300025949 | Ga0207667_10787819 | Ga0207667_107878191 | 294 |
| 431 | 3300025960 | Ga0207651_10097837 | Ga0207651_100978372 | 294 |
| 432 | 3300025961 | Ga0207712_10027513 | Ga0207712_100275131 | 294 |
| 433 | 3300025961 | Ga0207712_10129888 | Ga0207712_101298883 | 294 |
| 434 | 3300025981 | Ga0207640_10175259 | Ga0207640_101752592 | 294 |
| 435 | 3300026023 | Ga0207677_10145343 | Ga0207677_101453433 | 294 |
| 436 | 3300026023 | Ga0207677_10155288 | Ga0207677_101552882 | 294 |
| 437 | 3300026035 | Ga0207703_10027702 | Ga0207703_100277024 | 294 |
| 438 | 3300026035 | Ga0207703_10068868 | Ga0207703_100688682 | 294 |
| 439 | 3300026041 | Ga0207639_10029023 | Ga0207639_100290232 | 294 |
| 440 | 3300026041 | Ga0207639_10041913 | Ga0207639_100419134 | 294 |
| 441 | 3300026041 | Ga0207639_10058306 | Ga0207639_100583063 | 294 |
| 442 | 3300026041 | Ga0207639_10393532 | Ga0207639_103935321 | 294 |
| 443 | 3300026067 | Ga0207678_10040173 | Ga0207678_100401731 | 294 |
| 444 | 3300026078 | Ga0207702_10010815 | Ga0207702_100108156 | 294 |
| 445 | 3300026078 | Ga0207702_10019879 | Ga0207702_100198795 | 294 |
| 446 | 3300026078 | Ga0207702_10035328 | Ga0207702_100353285 | 294 |
| 447 | 3300026078 | Ga0207702_10076619 | Ga0207702_100766194 | 294 |
| 448 | 3300026078 | Ga0207702_10099210 | Ga0207702_100992104 | 294 |
| 449 | 3300026078 | Ga0207702_10127549 | Ga0207702_101275492 | 294 |
| 450 | 3300026078 | Ga0207702_10217551 | Ga0207702_102175512 | 294 |
| 451 | 3300026078 | Ga0207702_10405241 | Ga0207702_104052412 | 294 |
| 452 | 3300026078 | Ga0207702_10507232 | Ga0207702_105072322 | 294 |
| 453 | 3300026088 | Ga0207641_10028899 | Ga0207641_100288993 | 294 |
| 454 | 3300026088 | Ga0207641_10345677 | Ga0207641_103456771 | 294 |
| 455 | 3300026088 | Ga0207641_10522198 | Ga0207641_105221982 | 294 |
| 456 | 3300026089 | Ga0207648_10054929 | Ga0207648_100549294 | 294 |
| 457 | 3300026089 | Ga0207648_10700259 | Ga0207648_107002591 | 294 |
| 458 | 3300026116 | Ga0207674_10000300 | Ga0207674_1000030023 | 294 |
| 459 | 3300026116 | Ga0207674_10002626 | Ga0207674_100026264 | 294 |
| 460 | 3300026116 | Ga0207674_10003738 | Ga0207674_100037385 | 294 |
| 461 | 3300026116 | Ga0207674_10125874 | Ga0207674_101258743 | 294 |
| 462 | 3300026116 | Ga0207674_10132882 | Ga0207674_101328823 | 294 |
| 463 | 3300026116 | Ga0207674_10166575 | Ga0207674_101665752 | 294 |
| 464 | 3300026116 | Ga0207674_10567598 | Ga0207674_105675981 | 294 |
| 465 | 3300026142 | Ga0207698_10096422 | Ga0207698_100964223 | 294 |
| 466 | 3300026142 | Ga0207698_10406672 | Ga0207698_104066721 | 294 |
| 467 | 3300028379 | Ga0268266_10082747 | Ga0268266_100827473 | 294 |
| 468 | 3300028379 | Ga0268266_10206487 | Ga0268266_102064872 | 294 |
| 469 | 3300028381 | Ga0268264_10044237 | Ga0268264_100442373 | 294 |
| 470 | 3300028381 | Ga0268264_10128194 | Ga0268264_101281942 | 294 |
| 471 | 3300028381 | Ga0268264_10341417 | Ga0268264_103414172 | 294 |
| 472 | 3300028381 | Ga0268264_10365122 | Ga0268264_103651222 | 294 |
| 473 | 3300028666 | Ga0265336_10018772 | Ga0265336_100187721 | 294 |
| 474 | 3300028800 | Ga0265338_10084456 | Ga0265338_100844563 | 294 |
| 475 | 3300031238 | Ga0265332_10014399 | Ga0265332_100143992 | 294 |
| 476 | 3300031238 | Ga0265332_10029721 | Ga0265332_100297212 | 294 |
| 477 | 3300031240 | Ga0265320_10015146 | Ga0265320_100151464 | 294 |
| 478 | 3300031241 | Ga0265325_10000825 | Ga0265325_1000082514 | 294 |
| 479 | 3300031241 | Ga0265325_10045341 | Ga0265325_100453411 | 294 |
| 480 | 3300031247 | Ga0265340_10008185 | Ga0265340_100081856 | 294 |
| 481 | 3300031250 | Ga0265331_10043088 | Ga0265331_100430881 | 294 |
| 482 | 3300031344 | Ga0265316_10000602 | Ga0265316_1000060225 | 294 |
| 483 | 3300031344 | Ga0265316_10007613 | Ga0265316_100076134 | 294 |
| 484 | 3300031344 | Ga0265316_10026066 | Ga0265316_100260665 | 294 |
| 485 | 3300031344 | Ga0265316_10066091 | Ga0265316_100660912 | 294 |
| 486 | 3300031344 | Ga0265316_10115093 | Ga0265316_101150934 | 294 |
| 487 | 3300031344 | Ga0265316_10338629 | Ga0265316_103386291 | 294 |
| 488 | 3300031595 | Ga0265313_10081514 | Ga0265313_100815142 | 294 |
| 489 | 3300031711 | Ga0265314_10001370 | Ga0265314_100013709 | 294 |
| 490 | 3300031711 | Ga0265314_10089931 | Ga0265314_100899313 | 294 |
| 491 | 3300031711 | Ga0265314_10121116 | Ga0265314_101211162 | 294 |
| 492 | 3300031711 | Ga0265314_10136026 | Ga0265314_101360262 | 294 |
| 493 | 3300031712 | Ga0265342_10091894 | Ga0265342_100918943 | 294 |
| 494 | 3300035083 | Ga0373926_0033761 | Ga0373926_0033761_507_1391 | 294 |
| 495 | 3300035086 | Ga0373934_0001407 | Ga0373934_0001407_1740_2624 | 294 |
| 496 | 3300035111 | Ga0373923_0113053 | Ga0373923_0113053_312_1196 | 294 |
| 497 | 3300035111 | Ga0373923_0161598 | Ga0373923_0161598_36_926 | 294 |
| 498 | 3300035118 | Ga0373954_0014223 | Ga0373954_0014223_1326_2210 | 294 |
| 499 | 3300035118 | Ga0373954_0027116 | Ga0373954_0027116_158_1042 | 294 |
| 500 | 3300035119 | Ga0373956_0107010 | Ga0373956_0107010_58_942 | 294 |
| 501 | 3300035120 | Ga0373957_0042118 | Ga0373957_0042118_188_1072 | 294 |
| 502 | 3300035172 | Ga0373955_0202519 | Ga0373955_0202519_49_933 | 294 |
| 503 | 3300035692 | Ga0373935_0033838 | Ga0373935_0033838_2094_3038 | 294 |
| 504 | 3300035692 | Ga0373935_0097891 | Ga0373935_0097891_871_1755 | 294 |
| 505 | 3300035692 | Ga0373935_0154645 | Ga0373935_0154645_361_1245 | 294 |
| 506 | 3300035695 | Ga0373927_0002301 | Ga0373927_0002301_489_1373 | 294 |
| 507 | 3300035695 | Ga0373927_0003249 | Ga0373927_0003249_3732_4616 | 294 |
| 508 | 3300035695 | Ga0373927_0184075 | Ga0373927_0184075_463_1347 | 294 |
| 509 | 3300035724 | Ga0373933_0040306 | Ga0373933_0040306_1136_2020 | 294 |
| 510 | 3300035725 | Ga0373947_0001408 | Ga0373947_0001408_1424_2308 | 294 |
| 511 | 3300035725 | Ga0373947_0014552 | Ga0373947_0014552_477_1361 | 294 |
| 512 | 3300035725 | Ga0373947_0044627 | Ga0373947_0044627_1733_2617 | 294 |
| 513 | 3300035725 | Ga0373947_0055565 | Ga0373947_0055565_289_1233 | 294 |
| 514 | 3300036401 | Ga0373937_0032111 | Ga0373937_0032111_3748_4632 | 294 |
| 515 | 3300036401 | Ga0373937_0062436 | Ga0373937_0062436_431_1315 | 294 |
| 516 | 3300036401 | Ga0373937_0083864 | Ga0373937_0083864_1101_1985 | 294 |
| 517 | 3300036401 | Ga0373937_0136913 | Ga0373937_0136913_987_1871 | 294 |
| 518 | 3300036401 | Ga0373937_0137979 | Ga0373937_0137979_939_1832 | 294 |
| 519 | 3300037068 | Ga0373925_0000378 | Ga0373925_0000378_27813_28697 | 294 |
| 520 | 3300037068 | Ga0373925_0003480 | Ga0373925_0003480_6658_7542 | 294 |
| 521 | 3300037068 | Ga0373925_0006245 | Ga0373925_0006245_2209_3093 | 294 |
| 522 | 3300037068 | Ga0373925_0143866 | Ga0373925_0143866_850_1734 | 294 |
| 523 | 3300037068 | Ga0373925_0167527 | Ga0373925_0167527_598_1482 | 294 |
| 524 | 3300037853 | Ga0436364_0035509 | Ga0436364_0035509_2515_3402 | 294 |
| 525 | 3300037853 | Ga0436364_0362933 | Ga0436364_0362933_2470_3357 | 294 |
| 526 | 3300037853 | Ga0436364_0612043 | Ga0436364_0612043_26263_27156 | 294 |
| 527 | 3300037853 | Ga0436364_0622297 | Ga0436364_0622297_2999_3883 | 294 |
| 528 | 3300037853 | Ga0436364_0648475 | Ga0436364_0648475_562_1446 | 294 |
| 529 | 3300037853 | Ga0436364_0756434 | Ga0436364_0756434_899_1786 | 294 |
| 530 | 3300037853 | Ga0436364_0866914 | Ga0436364_0866914_934_1833 | 294 |
| 531 | 3300037853 | Ga0436364_0992705 | Ga0436364_0992705_5603_6487 | 294 |
| 532 | 3300037853 | Ga0436364_1281089 | Ga0436364_1281089_1241_2128 | 294 |
| 533 | 3300037853 | Ga0436364_1435313 | Ga0436364_1435313_661_1563 | 294 |
| 534 | 3300037853 | Ga0436364_1514273 | Ga0436364_1514273_2920_3825 | 294 |
| 535 | 3300038443 | Ga0395901_0727805 | Ga0395901_0727805_20_904 | 294 |
| 536 | 3300039437 | Ga0436365_0158787 | Ga0436365_0158787_3164_4051 | 294 |
| 537 | 3300039437 | Ga0436365_1200822 | Ga0436365_1200822_9751_10635 | 294 |
| 538 | 3300039437 | Ga0436365_1637806 | Ga0436365_1637806_1327_2211 | 294 |
| 539 | 3300039438 | Ga0436360_0581083 | Ga0436360_0581083_729_1616 | 294 |
| 540 | 3300039438 | Ga0436360_0589158 | Ga0436360_0589158_411_1295 | 294 |
| 541 | 3300039447 | Ga0436361_0510126 | Ga0436361_0510126_12971_13855 | 294 |
| 542 | 3300039450 | Ga0436363_0293846 | Ga0436363_0293846_1316_2203 | 294 |
| 543 | 3300039450 | Ga0436363_0715765 | Ga0436363_0715765_401_1285 | 294 |
| 544 | 3300039453 | Ga0436362_1115434 | Ga0436362_1115434_545_1432 | 294 |
| 545 | 3300044684 | Ga0466966_0045548 | Ga0466966_0045548_1770_2654 | 294 |
| 546 | 3300044694 | Ga0466963_0418556 | Ga0466963_0418556_24_908 | 294 |
| 547 | 3300045049 | Ga0466959_0239771 | Ga0466959_0239771_326_1210 | 294 |
| 548 | 3300045051 | Ga0451576_0462789 | Ga0451576_0462789_349_1236 | 294 |
| 549 | 3300045836 | Ga0466958_0230756 | Ga0466958_0230756_64_948 | 294 |
| 550 | 3300045976 | Ga0466967_0110332 | Ga0466967_0110332_587_1471 | 294 |
| 551 | 3300045976 | Ga0466967_0374964 | Ga0466967_0374964_232_1119 | 294 |
| 552 | 3300046454 | Ga0495592_0028742 | Ga0495592_0028742_1088_1972 | 294 |
| 553 | 3300046454 | Ga0495592_0321929 | Ga0495592_0321929_78_962 | 294 |
| 554 | 3300046462 | Ga0495651_0006480 | Ga0495651_0006480_2596_3480 | 294 |
| 555 | 3300046462 | Ga0495651_0199153 | Ga0495651_0199153_419_1303 | 294 |
| 556 | 3300046463 | Ga0495653_0032054 | Ga0495653_0032054_3220_4104 | 294 |
| 557 | 3300046472 | Ga0495580_0003381 | Ga0495580_0003381_7082_7966 | 294 |
| 558 | 3300046472 | Ga0495580_0008927 | Ga0495580_0008927_6876_7760 | 294 |
| 559 | 3300046472 | Ga0495580_0067820 | Ga0495580_0067820_71_955 | 294 |
| 560 | 3300046472 | Ga0495580_0069439 | Ga0495580_0069439_369_1262 | 294 |
| 561 | 3300046472 | Ga0495580_0079124 | Ga0495580_0079124_110_994 | 294 |
| 562 | 3300046472 | Ga0495580_0162112 | Ga0495580_0162112_94_978 | 294 |
| 563 | 3300046472 | Ga0495580_0188813 | Ga0495580_0188813_71_955 | 294 |
| 564 | 3300046472 | Ga0495580_0235381 | Ga0495580_0235381_91_975 | 294 |
| 565 | 3300046473 | Ga0495582_0004709 | Ga0495582_0004709_2251_3135 | 294 |
| 566 | 3300046473 | Ga0495582_0068804 | Ga0495582_0068804_913_1797 | 294 |
| 567 | 3300046473 | Ga0495582_0159818 | Ga0495582_0159818_113_997 | 294 |
| 568 | 3300046476 | Ga0495662_0003213 | Ga0495662_0003213_4673_5557 | 294 |
| 569 | 3300046477 | Ga0495664_0043667 | Ga0495664_0043667_727_1611 | 294 |
| 570 | 3300046499 | Ga0495594_0045738 | Ga0495594_0045738_349_1233 | 294 |
| 571 | 3300046499 | Ga0495594_0172599 | Ga0495594_0172599_95_979 | 294 |
| 572 | 3300046511 | Ga0495608_0077294 | Ga0495608_0077294_59_943 | 294 |
| 573 | 3300046511 | Ga0495608_0079514 | Ga0495608_0079514_1230_2114 | 294 |
| 574 | 3300046516 | Ga0495628_0048471 | Ga0495628_0048471_2336_3220 | 294 |
| 575 | 3300046517 | Ga0495630_0017827 | Ga0495630_0017827_4236_5120 | 294 |
| 576 | 3300046526 | Ga0495666_0153524 | Ga0495666_0153524_110_994 | 294 |
| 577 | 3300046529 | Ga0495652_0021534 | Ga0495652_0021534_2335_3219 | 294 |
| 578 | 3300046531 | Ga0495665_0025185 | Ga0495665_0025185_1423_2307 | 294 |
| 579 | 3300046531 | Ga0495665_0075702 | Ga0495665_0075702_620_1504 | 294 |
| 580 | 3300046533 | Ga0495640_0114869 | Ga0495640_0114869_321_1205 | 294 |
| 581 | 3300046536 | Ga0495587_0069620 | Ga0495587_0069620_933_1817 | 294 |
| 582 | 3300046536 | Ga0495587_0072854 | Ga0495587_0072854_337_1221 | 294 |
| 583 | 3300046536 | Ga0495587_0170543 | Ga0495587_0170543_177_1061 | 294 |
| 584 | 3300046543 | Ga0495645_0007860 | Ga0495645_0007860_2801_3685 | 294 |
| 585 | 3300046543 | Ga0495645_0300861 | Ga0495645_0300861_140_1024 | 294 |
| 586 | 3300046559 | Ga0495667_0007870 | Ga0495667_0007870_3799_4683 | 294 |
| 587 | 3300046559 | Ga0495667_0228185 | Ga0495667_0228185_290_1174 | 294 |
| 588 | 3300046642 | Ga0495634_0015888 | Ga0495634_0015888_1903_2787 | 294 |
| 589 | 3300046642 | Ga0495634_0106113 | Ga0495634_0106113_61_945 | 294 |
| 590 | 3300046663 | Ga0495635_0094331 | Ga0495635_0094331_193_1077 | 294 |
| 591 | 3300046663 | Ga0495635_0166924 | Ga0495635_0166924_147_1031 | 294 |
| 592 | 3300046663 | Ga0495635_0223292 | Ga0495635_0223292_175_1068 | 294 |
| 593 | 3300046678 | Ga0495599_0064056 | Ga0495599_0064056_309_1193 | 294 |
| 594 | 3300046679 | Ga0495623_0045580 | Ga0495623_0045580_922_1806 | 294 |
| 595 | 3300046683 | Ga0495658_0074771 | Ga0495658_0074771_411_1295 | 294 |
| 596 | 3300046683 | Ga0495658_0152618 | Ga0495658_0152618_90_1034 | 294 |
| 597 | 3300046689 | Ga0495613_0019989 | Ga0495613_0019989_3096_3980 | 294 |
| 598 | 3300046689 | Ga0495613_0051160 | Ga0495613_0051160_67_951 | 294 |
| 599 | 3300046689 | Ga0495613_0155252 | Ga0495613_0155252_459_1343 | 294 |
| 600 | 3300047319 | Ga0495674_0016845 | Ga0495674_0016845_4345_5229 | 294 |
| 601 | 3300047319 | Ga0495674_0034074 | Ga0495674_0034074_3288_4181 | 294 |
| 602 | 3300047319 | Ga0495674_0045799 | Ga0495674_0045799_2768_3652 | 294 |
| 603 | 3300047319 | Ga0495674_0143343 | Ga0495674_0143343_351_1244 | 294 |
| 604 | 3300047319 | Ga0495674_0195104 | Ga0495674_0195104_766_1650 | 294 |
| 605 | 3300047322 | Ga0495680_0008013 | Ga0495680_0008013_4932_5816 | 294 |
| 606 | 3300047322 | Ga0495680_0259121 | Ga0495680_0259121_105_989 | 294 |
| 607 | 3300047322 | Ga0495680_0401543 | Ga0495680_0401543_40_924 | 294 |
| 608 | 3300047471 | Ga0495684_0015364 | Ga0495684_0015364_2814_3698 | 294 |
| 609 | 3300047471 | Ga0495684_0053527 | Ga0495684_0053527_1736_2620 | 294 |
| 610 | 3300047673 | Ga0495593_0133090 | Ga0495593_0133090_295_1179 | 294 |
| 611 | 3300048088 | Ga0495602_0018093 | Ga0495602_0018093_1284_2168 | 294 |
| 612 | 3300048903 | Ga0496100_0361467 | Ga0496100_0361467_170_1054 | 294 |
| 613 | 3300048905 | Ga0496102_0267405 | Ga0496102_0267405_393_1277 | 294 |
| 614 | 3300048907 | Ga0496104_0516043 | Ga0496104_0516043_132_1016 | 294 |
| 615 | 3300048909 | Ga0496106_0299299 | Ga0496106_0299299_221_1105 | 294 |
| 616 | 3300048915 | Ga0496112_0026195 | Ga0496112_0026195_1094_1984 | 294 |
| 617 | 3300048918 | Ga0496115_0008018 | Ga0496115_0008018_2741_3631 | 294 |
| 618 | 3300048918 | Ga0496115_0143296 | Ga0496115_0143296_783_1667 | 294 |
| 619 | 3300048929 | Ga0496126_0068125 | Ga0496126_0068125_1694_2578 | 294 |
| 620 | 3300049568 | Ga0501031_0023494 | Ga0501031_0023494_255_1142 | 294 |
| 621 | 3300049569 | Ga0501032_0001165 | Ga0501032_0001165_16858_17745 | 294 |
| 622 | 3300049569 | Ga0501032_0067914 | Ga0501032_0067914_589_1482 | 294 |
| 623 | 3300049571 | Ga0501034_0014757 | Ga0501034_0014757_923_1810 | 294 |
| 624 | 3300049571 | Ga0501034_0017376 | Ga0501034_0017376_2597_3490 | 294 |
| 625 | 3300049571 | Ga0501034_0169336 | Ga0501034_0169336_881_1765 | 294 |
| 626 | 3300049572 | Ga0501036_0007493 | Ga0501036_0007493_1782_2669 | 294 |
| 627 | 3300049573 | Ga0501037_0168254 | Ga0501037_0168254_552_1439 | 294 |
| 628 | 3300049574 | Ga0501038_0014476 | Ga0501038_0014476_197_1084 | 294 |
| 629 | 3300049575 | Ga0501039_0008248 | Ga0501039_0008248_1815_2702 | 294 |
| 630 | 3300049579 | Ga0501043_0004312 | Ga0501043_0004312_1808_2695 | 294 |
| 631 | 3300049580 | Ga0501046_0002931 | Ga0501046_0002931_14340_15227 | 294 |
| 632 | 3300049580 | Ga0501046_0066720 | Ga0501046_0066720_779_1672 | 294 |
| 633 | 3300049581 | Ga0501047_0008796 | Ga0501047_0008796_6730_7617 | 294 |
| 634 | 3300049581 | Ga0501047_0060307 | Ga0501047_0060307_2144_3037 | 294 |
| 635 | 3300049581 | Ga0501047_0244580 | Ga0501047_0244580_707_1591 | 294 |
| 636 | 3300049583 | Ga0501067_0000907 | Ga0501067_0000907_7107_7994 | 294 |
| 637 | 3300049584 | Ga0501068_0001120 | Ga0501068_0001120_9414_10301 | 294 |
| 638 | 3300049585 | Ga0501069_0007271 | Ga0501069_0007271_1674_2561 | 294 |
| 639 | 3300049586 | Ga0501070_0197493 | Ga0501070_0197493_243_1136 | 294 |
| 640 | 3300049589 | Ga0501073_0000471 | Ga0501073_0000471_6104_6991 | 294 |
| 641 | 3300049589 | Ga0501073_0054455 | Ga0501073_0054455_1489_2382 | 294 |
| 642 | 3300049590 | Ga0501074_0017378 | Ga0501074_0017378_831_1718 | 294 |
| 643 | 3300049592 | Ga0501076_0060938 | Ga0501076_0060938_307_1194 | 294 |
| 644 | 3300049593 | Ga0501077_0005967 | Ga0501077_0005967_341_1228 | 294 |
| 645 | 3300049741 | Ga0501079_0005210 | Ga0501079_0005210_5213_6100 | 294 |
| 646 | 3300049742 | Ga0501080_0000006 | Ga0501080_0000006_70567_71454 | 294 |
| 647 | 3300049744 | Ga0501083_0025741 | Ga0501083_0025741_1782_2669 | 294 |
| 648 | 3300049822 | Ga0501035_0089298 | Ga0501035_0089298_1404_2291 | 294 |
| 649 | 3300049822 | Ga0501035_0135646 | Ga0501035_0135646_955_1848 | 294 |
| 650 | 3300049823 | Ga0501044_0000814 | Ga0501044_0000814_15962_16846 | 294 |
| 651 | 3300049823 | Ga0501044_0012973 | Ga0501044_0012973_5079_5963 | 294 |
| 652 | 3300049823 | Ga0501044_0017662 | Ga0501044_0017662_5842_6729 | 294 |
| 653 | 3300049823 | Ga0501044_0079518 | Ga0501044_0079518_1958_2851 | 294 |
| 654 | 3300049823 | Ga0501044_0267766 | Ga0501044_0267766_270_1154 | 294 |
| 655 | 3300050507 | nmdc:mga05p37_130646_c1 | nmdc:mga05p37_130646_c1_855_1739 | 294 |
| 656 | 3300050507 | nmdc:mga05p37_180709_c1 | nmdc:mga05p37_180709_c1_564_1448 | 294 |
| 657 | 3300050507 | nmdc:mga05p37_294780_c1 | nmdc:mga05p37_294780_c1_23_907 | 294 |
| 658 | 3300050510 | nmdc:mga06r32_52589_c1 | nmdc:mga06r32_52589_c1_2733_3617 | 294 |
| 659 | 3300050514 | nmdc:mga08x19_974_c1 | nmdc:mga08x19_974_c1_7906_8790 | 294 |
| 660 | 3300053139 | Ga0500568_0000650 | Ga0500568_0000650_18817_19701 | 294 |
| 661 | 3300054114 | Ga0501084_0000747 | Ga0501084_0000747_14678_15565 | 294 |
| 662 | 3300060353 | Ga0501082_0000311 | Ga0501082_0000311_14390_15274 | 294 |
| 663 | 3300060353 | Ga0501082_0016943 | Ga0501082_0016943_1404_2291 | 294 |
| 664 | 3300005327 | Ga0070658_10009820 | Ga0070658_100098203 | 295 |
| 665 | 3300005458 | Ga0070681_10009639 | Ga0070681_100096394 | 295 |
| 666 | 3300005563 | Ga0068855_100005049 | Ga0068855_1000050494 | 295 |
| 667 | 3300005614 | Ga0068856_100051889 | Ga0068856_1000518894 | 295 |
| 668 | 3300005614 | Ga0068856_100246707 | Ga0068856_1002467072 | 295 |
| 669 | 3300005616 | Ga0068852_100303515 | Ga0068852_1003035152 | 295 |
| 670 | 3300009093 | Ga0105240_10002947 | Ga0105240_1000294719 | 295 |
| 671 | 3300009093 | Ga0105240_10402282 | Ga0105240_104022821 | 295 |
| 672 | 3300010375 | Ga0105239_10913989 | Ga0105239_109139891 | 295 |
| 673 | 3300013104 | Ga0157370_10001524 | Ga0157370_100015241 | 295 |
| 674 | 3300013105 | Ga0157369_10012635 | Ga0157369_100126355 | 295 |
| 675 | 3300013296 | Ga0157374_10363619 | Ga0157374_103636192 | 295 |
| 676 | 3300025912 | Ga0207707_10014579 | Ga0207707_100145796 | 295 |
| 677 | 3300025949 | Ga0207667_10231227 | Ga0207667_102312272 | 295 |
| 678 | 3300026078 | Ga0207702_10127375 | Ga0207702_101273753 | 295 |
| 679 | 3300037853 | Ga0436364_0628087 | Ga0436364_0628087_211_1098 | 295 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5i1f-assembly1.cif.gz_A-2 | crystal structure of utp-glucose-1-phosphate uridylyltransferase from burkholderia vietnamiensis in complex with uridine-5'-diphosphate-glucose | 0.8973 | 4 | 292 |
| 5j49-assembly1.cif.gz_A | crystal structure of udp-glucose pyrophosporylase / utp-glucose-1-phosphate uridylyltransferase from burkholderia xenovorans | 0.8961 | 5 | 291 |
| 3juk-assembly1.cif.gz_D | the crystal structure of udp-glucose pyrophosphorylase complexed with udp-glucose | 0.8826 | 5 | 279 |
| 5ve7-assembly1.cif.gz_A | crystal structure of utp-glucose-1-phosphate uridylyltransferase from burkholderia ambifaria in complex with utp | 0.881 | 5 | 293 |
| 3juk-assembly1.cif.gz_B | the crystal structure of udp-glucose pyrophosphorylase complexed with udp-glucose | 0.8804 | 5 | 279 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q58730_1_282_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8941 | 5 | 292 | 3.90.550.10 |
| 3jukA00 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8844 | 5 | 275 | 3.90.550.10 |
| af_Q58730_1_282_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8792 | 5 | 292 | 3.90.550.10 |
| af_Q2G1T6_1_286_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8766 | 5 | 293 | 3.90.550.10 |
| af_Q2G1T6_1_286_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8681 | 5 | 293 | 3.90.550.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D4LJV5-F1-model_v4 | UTP--glucose-1-phosphate uridylyltransferase (EC 2.7.7.9) | 0.9858 | 107 | 265 |
GO:0003983
GO:0006011 GO:0009058 |
| AF-A0A3B8P012-F1-model_v4 | UTP--glucose-1-phosphate uridylyltransferase (EC 2.7.7.9) | 0.9809 | 119 | 294 |
GO:0003983
GO:0006011 GO:0009058 |
| AF-I3RCX6-F1-model_v4 | UTP--glucose-1-phosphate uridylyltransferase (EC 2.7.7.9) | 0.9807 | 99 | 291 |
GO:0003983
GO:0006011 GO:0009058 |
| AF-T0XS77-F1-model_v4 | UTP--glucose-1-phosphate uridylyltransferase (EC 2.7.7.9) | 0.9806 | 100 | 292 |
GO:0003983
GO:0006011 GO:0009058 |
| AF-T0E8M6-F1-model_v4 | deleted | 0.9793 | 99 | 292 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar