F474717

General Info

Members Datasets Scaffolds Average Seq Length
679 234 679 292

Family's Representative Sequence

Representative Sequence 3300021388|Ga0213875_10000163|Ga0213875_1000016322
Length 265
Sequence MLPLVDKPLIQYGVEEAVSSGIQTIIIVTGRGKSSIEDHFDVSFELEQLLESKKKTEMLSMVRLISDMIDVAYVRQKEALGLGHAVLRSKELVGAEPFAVVLSDDIIASQTPCLRQLLDVYEFYGTSVLALMEVPGDQISAYGVVDAELVLNGSDNRLFRIRNMVEKPRPRDAPSNLAIIGRYILTPQIFESIEAVEPGSGGEIQLTDGLKHMLRERPIYGLKFEGKRYDAGDKLGFLKATVEFALERPDLGRAFREYLNDLCKQ

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
79 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
80 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
81 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
82 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
128 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
129 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
130 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
131 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
132 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
133 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
134 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
135 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
136 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
137 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
138 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
139 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
140 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
141 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
142 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
143 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
144 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
145 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
146 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
147 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
148 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
149 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
150 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
151 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
152 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
153 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
154 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
155 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
156 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
157 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
158 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
159 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
160 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
161 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
162 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
163 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
164 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
165 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
166 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
167 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
168 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
169 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
170 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
171 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
172 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
173 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
174 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
175 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
176 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
177 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
178 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
179 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
180 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
181 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
182 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
183 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
184 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
185 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
186 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
187 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
188 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
189 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
190 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
191 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
192 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
193 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
194 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
195 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
196 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
197 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
198 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
199 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
200 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
201 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
202 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
203 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
204 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
215 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
216 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
217 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
218 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
219 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
220 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
221 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
222 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
223 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
224 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
225 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
226 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
228 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
229 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
230 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
231 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
232 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
233 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
234 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.15
Nodule 0
Rhizoplane 1.03
Rhizosphere 94.4
Stem 0
Stem Tuber 0
Unclassified 4.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10009820 3300005327 Bacteria 7690
2 Ga0070683_100000008 3300005329 Bacteria 329206
3 Ga0070683_100058517 3300005329 Bacteria 3580
4 Ga0070683_100089291 3300005329 Bacteria 2892
5 Ga0070683_100199235 3300005329 Bacteria 1901
6 Ga0070683_100613002 3300005329 Bacteria 1042
7 Ga0070690_100290510 3300005330 Bacteria 1169
8 Ga0070690_100307599 3300005330 Bacteria 1138
9 Ga0068869_100256154 3300005334 Bacteria 1399
10 Ga0068869_100380007 3300005334 Bacteria 1157
11 Ga0070666_10000927 3300005335 Bacteria 17794
12 Ga0070666_10158407 3300005335 Bacteria 1582
13 Ga0070680_100007554 3300005336 Bacteria 8289
14 Ga0070680_100085276 3300005336 Bacteria 2609
15 Ga0070680_100142652 3300005336 Bacteria 2009
16 Ga0070680_100186120 3300005336 Bacteria 1749
17 Ga0068868_100023618 3300005338 Bacteria 4655
18 Ga0068868_100075749 3300005338 Bacteria 2689
19 Ga0068868_100093513 3300005338 Bacteria 2424
20 Ga0068868_100119743 3300005338 Bacteria 2146
21 Ga0070660_100002742 3300005339 Bacteria 12106
22 Ga0070660_100032638 3300005339 Bacteria 3919
23 Ga0070660_100375049 3300005339 Bacteria 1174
24 Ga0070691_10002114 3300005341 Bacteria 8791
25 Ga0070661_100129655 3300005344 Bacteria 1893
26 Ga0070675_100337073 3300005354 Bacteria 1335
27 Ga0070671_100018720 3300005355 Bacteria 5628
28 Ga0070671_100267980 3300005355 Bacteria 1452
29 Ga0070673_100123165 3300005364 Bacteria 2166
30 Ga0070688_100150727 3300005365 Bacteria 1589
31 Ga0070667_100055003 3300005367 Bacteria 3361
32 Ga0070709_10030640 3300005434 Bacteria 3230
33 Ga0070709_10063403 3300005434 Bacteria 2360
34 Ga0070714_100003215 3300005435 Bacteria 12154
35 Ga0070714_100058773 3300005435 Bacteria 3296
36 Ga0070714_100064407 3300005435 Bacteria 3155
37 Ga0070713_100167342 3300005436 Bacteria 1967
38 Ga0070711_100042000 3300005439 Bacteria 3090
39 Ga0070711_100090522 3300005439 Bacteria 2204
40 Ga0070711_100318339 3300005439 Bacteria 1242
41 Ga0070708_100284292 3300005445 Bacteria 1557
42 Ga0070663_100060249 3300005455 Bacteria 2729
43 Ga0070662_100043244 3300005457 Bacteria 3222
44 Ga0070681_10006458 3300005458 Bacteria 11410
45 Ga0070681_10009639 3300005458 Bacteria 9499
46 Ga0070681_10063096 3300005458 Bacteria 3678
47 Ga0070681_10089637 3300005458 Bacteria 3027
48 Ga0070681_10090794 3300005458 Bacteria 3005
49 Ga0070681_10097798 3300005458 Bacteria 2882
50 Ga0070681_10123522 3300005458 Bacteria 2521
51 Ga0068867_100046551 3300005459 Bacteria 3186
52 Ga0070699_100268052 3300005518 Bacteria 1528
53 Ga0070684_100000002 3300005535 Bacteria 257669
54 Ga0070684_100002594 3300005535 Bacteria 13351
55 Ga0070684_100078823 3300005535 Bacteria 2911
56 Ga0070684_100094866 3300005535 Bacteria 2658
57 Ga0070684_100098667 3300005535 Bacteria 2606
58 Ga0070684_100225988 3300005535 Bacteria 1708
59 Ga0068853_100003952 3300005539 Bacteria 11388
60 Ga0068853_100016150 3300005539 Bacteria 6140
61 Ga0068853_100592998 3300005539 Bacteria 1052
62 Ga0070672_100269938 3300005543 Bacteria 1436
63 Ga0070686_100037813 3300005544 Bacteria 2996
64 Ga0070686_100283343 3300005544 Bacteria 1223
65 Ga0070696_100008036 3300005546 Bacteria 7048
66 Ga0070693_100071686 3300005547 Bacteria 2042
67 Ga0070665_100013558 3300005548 Bacteria 8200
68 Ga0070665_100051724 3300005548 Bacteria 4120
69 Ga0070665_100078360 3300005548 Bacteria 3311
70 Ga0070665_100179540 3300005548 Bacteria 2118
71 Ga0068855_100005049 3300005563 Bacteria 16107
72 Ga0068855_100009796 3300005563 Bacteria 11560
73 Ga0068855_100014432 3300005563 Bacteria 9511
74 Ga0068855_100023824 3300005563 Bacteria 7333
75 Ga0068855_100051076 3300005563 Bacteria 4871
76 Ga0068855_100146721 3300005563 Bacteria 2685
77 Ga0068855_100149562 3300005563 Bacteria 2655
78 Ga0068855_100184194 3300005563 Bacteria 2359
79 Ga0068855_100268366 3300005563 Bacteria 1898
80 Ga0068855_100416320 3300005563 Bacteria 1470
81 Ga0068855_100489111 3300005563 Bacteria 1338
82 Ga0068855_100536344 3300005563 Bacteria 1268
83 Ga0070664_100058067 3300005564 Bacteria 3291
84 Ga0070664_100069681 3300005564 Bacteria 3009
85 Ga0070664_100105947 3300005564 Bacteria 2449
86 Ga0068857_100011338 3300005577 Bacteria 7753
87 Ga0068857_100015478 3300005577 Bacteria 6662
88 Ga0068857_100041697 3300005577 Bacteria 4070
89 Ga0068857_100101393 3300005577 Bacteria 2583
90 Ga0068856_100003872 3300005614 Bacteria 15024
91 Ga0068856_100004846 3300005614 Bacteria 13330
92 Ga0068856_100033576 3300005614 Bacteria 5024
93 Ga0068856_100035270 3300005614 Bacteria 4901
94 Ga0068856_100051889 3300005614 Bacteria 4043
95 Ga0068856_100058592 3300005614 Bacteria 3804
96 Ga0068856_100196587 3300005614 Bacteria 2031
97 Ga0068856_100246707 3300005614 Bacteria 1801
98 Ga0068856_100332321 3300005614 Bacteria 1537
99 Ga0068856_100340259 3300005614 Bacteria 1518
100 Ga0068852_100022651 3300005616 Bacteria 5042
101 Ga0068852_100256795 3300005616 Bacteria 1676
102 Ga0068852_100303515 3300005616 Bacteria 1546
103 Ga0068852_100339061 3300005616 Bacteria 1465
104 Ga0068859_100036385 3300005617 Bacteria 4942
105 Ga0068859_100232347 3300005617 Bacteria 1932
106 Ga0068859_100260495 3300005617 Bacteria 1825
107 Ga0068859_100795630 3300005617 Bacteria 1033
108 Ga0068864_100186511 3300005618 Bacteria 1899
109 Ga0068864_100221031 3300005618 Bacteria 1747
110 Ga0068864_100430983 3300005618 Bacteria 1258
111 Ga0068851_10045862 3300005834 Bacteria 2210
112 Ga0068863_100031318 3300005841 Bacteria 5077
113 Ga0068863_100039440 3300005841 Bacteria 4493
114 Ga0068863_100130038 3300005841 Bacteria 2404
115 Ga0068858_100007363 3300005842 Bacteria 10651
116 Ga0068860_100011802 3300005843 Bacteria 8610
117 Ga0068860_100115125 3300005843 Bacteria 2571
118 Ga0068860_100182337 3300005843 Bacteria 2029
119 Ga0068860_100632177 3300005843 Bacteria 1077
120 Ga0081455_10022065 3300005937 Bacteria 5959
121 Ga0081539_10031631 3300005985 Bacteria 3257
122 Ga0070717_10072087 3300006028 Bacteria 2884
123 Ga0070717_10156904 3300006028 Bacteria 1972
124 Ga0070717_10204902 3300006028 Bacteria 1729
125 Ga0070712_100083533 3300006175 Bacteria 2319
126 Ga0097621_100002831 3300006237 Bacteria 11896
127 Ga0097621_100026434 3300006237 Bacteria 4553
128 Ga0097621_100080645 3300006237 Bacteria 2707
129 Ga0097621_100127546 3300006237 Bacteria 2162
130 Ga0097621_100142486 3300006237 Bacteria 2049
131 Ga0097621_100176027 3300006237 Bacteria 1846
132 Ga0097621_100255791 3300006237 Bacteria 1535
133 Ga0097621_100276363 3300006237 Bacteria 1477
134 Ga0097621_100363556 3300006237 Bacteria 1289
135 Ga0068871_100024195 3300006358 Bacteria 4706
136 Ga0068871_100033322 3300006358 Bacteria 4078
137 Ga0068871_100046269 3300006358 Bacteria 3504
138 Ga0068871_100112152 3300006358 Bacteria 2295
139 Ga0068871_100217179 3300006358 Bacteria 1655
140 Ga0075431_100002616 3300006847 Bacteria 17411
141 Ga0068865_100020093 3300006881 Bacteria 4330
142 Ga0068865_100096740 3300006881 Bacteria 2153
143 Ga0068865_100247732 3300006881 Bacteria 1405
144 Ga0068865_100251266 3300006881 Bacteria 1396
145 Ga0075436_100003431 3300006914 Bacteria 10867
146 Ga0097620_100036386 3300006931 Bacteria 4942
147 Ga0097620_100232358 3300006931 Bacteria 1932
148 Ga0097620_100260493 3300006931 Bacteria 1825
149 Ga0097620_100795618 3300006931 Bacteria 1033
150 Ga0105240_10000381 3300009093 Bacteria 83148
151 Ga0105240_10000408 3300009093 Bacteria 79917
152 Ga0105240_10002782 3300009093 Bacteria 27645
153 Ga0105240_10002947 3300009093 Bacteria 26841
154 Ga0105240_10006165 3300009093 Bacteria 17671
155 Ga0105240_10035570 3300009093 Bacteria 6417
156 Ga0105240_10069696 3300009093 Bacteria 4351
157 Ga0105240_10075100 3300009093 Bacteria 4170
158 Ga0105240_10187186 3300009093 Bacteria 2437
159 Ga0105240_10197772 3300009093 Bacteria 2358
160 Ga0105240_10208408 3300009093 Bacteria 2286
161 Ga0105240_10402282 3300009093 Bacteria 1542
162 Ga0105240_10505180 3300009093 Bacteria 1344
163 Ga0105245_10013951 3300009098 Bacteria 6997
164 Ga0105245_10025460 3300009098 Bacteria 5203
165 Ga0105245_10025911 3300009098 Bacteria 5158
166 Ga0105245_10035283 3300009098 Bacteria 4438
167 Ga0105245_10038828 3300009098 Bacteria 4237
168 Ga0105245_10040716 3300009098 Bacteria 4141
169 Ga0105245_10061626 3300009098 Bacteria 3382
170 Ga0105245_10482209 3300009098 Bacteria 1253
171 Ga0105245_10580972 3300009098 Bacteria 1145
172 Ga0114129_10044732 3300009147 Bacteria 6228
173 Ga0114129_10462128 3300009147 Bacteria 1663
174 Ga0105243_10059431 3300009148 Bacteria 3051
175 Ga0105243_10190100 3300009148 Bacteria 1793
176 Ga0105241_10019190 3300009174 Bacteria 5041
177 Ga0105241_10050417 3300009174 Bacteria 3172
178 Ga0105241_10056486 3300009174 Bacteria 3010
179 Ga0105241_10130000 3300009174 Bacteria 2037
180 Ga0105241_10214379 3300009174 Bacteria 1615
181 Ga0105241_10386490 3300009174 Bacteria 1224
182 Ga0105242_10006492 3300009176 Bacteria 9006
183 Ga0105242_10076869 3300009176 Bacteria 2784
184 Ga0105242_10193914 3300009176 Bacteria 1800
185 Ga0105242_10311234 3300009176 Bacteria 1441
186 Ga0105248_10008614 3300009177 Bacteria 11203
187 Ga0105248_10020925 3300009177 Bacteria 7251
188 Ga0105248_10031660 3300009177 Bacteria 5908
189 Ga0105248_10048353 3300009177 Bacteria 4772
190 Ga0105248_10084335 3300009177 Bacteria 3574
191 Ga0105248_10239687 3300009177 Bacteria 2041
192 Ga0105248_10615080 3300009177 Bacteria 1226
193 Ga0105248_10639768 3300009177 Unclassified 1200
194 Ga0105237_10004190 3300009545 Bacteria 16791
195 Ga0105237_10028686 3300009545 Bacteria 5666
196 Ga0105237_10028966 3300009545 Bacteria 5633
197 Ga0105237_10045602 3300009545 Bacteria 4410
198 Ga0105237_10158422 3300009545 Bacteria 2261
199 Ga0105237_10239987 3300009545 Bacteria 1813
200 Ga0105237_10491720 3300009545 Bacteria 1233
201 Ga0105237_10575472 3300009545 Bacteria 1133
202 Ga0105238_10002578 3300009551 Bacteria 18075
203 Ga0105238_10026055 3300009551 Bacteria 5959
204 Ga0105238_10036067 3300009551 Bacteria 5026
205 Ga0105238_10038044 3300009551 Bacteria 4888
206 Ga0105238_10049965 3300009551 Bacteria 4210
207 Ga0105238_10095999 3300009551 Bacteria 2951
208 Ga0105238_10165883 3300009551 Bacteria 2184
209 Ga0105238_10264771 3300009551 Bacteria 1699
210 Ga0105238_10614438 3300009551 Bacteria 1095
211 Ga0105249_10002934 3300009553 Bacteria 14710
212 Ga0105249_10014215 3300009553 Bacteria 7038
213 Ga0105249_10074866 3300009553 Bacteria 3135
214 Ga0105249_10150261 3300009553 Bacteria 2242
215 Ga0105239_10007095 3300010375 Bacteria 12894
216 Ga0105239_10009114 3300010375 Bacteria 11226
217 Ga0105239_10030555 3300010375 Bacteria 5923
218 Ga0105239_10121422 3300010375 Bacteria 2902
219 Ga0105239_10126838 3300010375 Bacteria 2837
220 Ga0105239_10164197 3300010375 Bacteria 2483
221 Ga0105239_10175295 3300010375 Bacteria 2398
222 Ga0105239_10913989 3300010375 Bacteria 1007
223 Ga0105246_10006378 3300011119 Bacteria 7199
224 Ga0105246_10089554 3300011119 Bacteria 2214
225 Ga0105246_10400118 3300011119 Bacteria 1140
226 Ga0157373_10165671 3300013100 Bacteria 1555
227 Ga0157370_10001524 3300013104 Bacteria 28657
228 Ga0157370_10003411 3300013104 Bacteria 18667
229 Ga0157370_10155270 3300013104 Bacteria 2129
230 Ga0157370_10232529 3300013104 Bacteria 1706
231 Ga0157370_10278559 3300013104 Bacteria 1545
232 Ga0157370_10349390 3300013104 Bacteria 1363
233 Ga0157369_10001852 3300013105 Bacteria 25575
234 Ga0157369_10012635 3300013105 Bacteria 9575
235 Ga0157369_10061690 3300013105 Bacteria 4041
236 Ga0157369_10110052 3300013105 Bacteria 2929
237 Ga0157369_10117083 3300013105 Bacteria 2829
238 Ga0157369_10118372 3300013105 Bacteria 2811
239 Ga0157369_10250689 3300013105 Bacteria 1848
240 Ga0157369_10267352 3300013105 Bacteria 1783
241 Ga0157369_10737820 3300013105 Bacteria 1013
242 Ga0157374_10021617 3300013296 Bacteria 5729
243 Ga0157374_10036701 3300013296 Bacteria 4492
244 Ga0157374_10076247 3300013296 Bacteria 3170
245 Ga0157374_10076405 3300013296 Bacteria 3167
246 Ga0157374_10363619 3300013296 Bacteria 1439
247 Ga0157378_10023708 3300013297 Bacteria 5398
248 Ga0157378_10057735 3300013297 Bacteria 3460
249 Ga0157378_10089884 3300013297 Bacteria 2791
250 Ga0157378_10200032 3300013297 Bacteria 1889
251 Ga0157378_10249841 3300013297 Bacteria 1697
252 Ga0163162_10153404 3300013306 Bacteria 2422
253 Ga0163162_10213547 3300013306 Bacteria 2059
254 Ga0163162_10426024 3300013306 Bacteria 1459
255 Ga0163162_10591152 3300013306 Bacteria 1237
256 Ga0163162_10707760 3300013306 Bacteria 1129
257 Ga0163162_10783023 3300013306 Bacteria 1072
258 Ga0157372_10064041 3300013307 Bacteria 4124
259 Ga0157372_10118166 3300013307 Bacteria 3042
260 Ga0157372_10190074 3300013307 Bacteria 2378
261 Ga0157372_10211217 3300013307 Bacteria 2249
262 Ga0157375_10008398 3300013308 Bacteria 9044
263 Ga0157375_10360290 3300013308 Bacteria 1620
264 Ga0157375_10413155 3300013308 Bacteria 1516
265 Ga0157375_10591881 3300013308 Bacteria 1269
266 Ga0163163_10000134 3300014325 Bacteria 76268
267 Ga0163163_10023286 3300014325 Bacteria 5875
268 Ga0163163_10038278 3300014325 Bacteria 4673
269 Ga0163163_10110146 3300014325 Bacteria 2781
270 Ga0163163_10187729 3300014325 Bacteria 2115
271 Ga0163163_10250146 3300014325 Bacteria 1823
272 Ga0163163_10400448 3300014325 Bacteria 1431
273 Ga0157380_10056749 3300014326 Bacteria 3116
274 Ga0157380_10348742 3300014326 Bacteria 1384
275 Ga0157379_10269428 3300014968 Bacteria 1548
276 Ga0157379_10360155 3300014968 Bacteria 1333
277 Ga0157379_10442694 3300014968 Bacteria 1198
278 Ga0157376_10004167 3300014969 Bacteria 10024
279 Ga0157376_10080409 3300014969 Bacteria 2796
280 Ga0157376_10442449 3300014969 Bacteria 1266
281 Ga0213872_10001118 3300021361 Bacteria 18361
282 Ga0213874_10054956 3300021377 Bacteria 1232
283 Ga0213876_10005305 3300021384 Bacteria 7094
284 Ga0213875_10000002 3300021388 Bacteria 921066
285 Ga0213875_10000163 3300021388 Bacteria 69287
286 Ga0213875_10013064 3300021388 Bacteria 4085
287 Ga0213875_10016290 3300021388 Bacteria 3607
288 Ga0213875_10022029 3300021388 Bacteria 3049
289 Ga0213875_10049624 3300021388 Bacteria 1967
290 Ga0207692_10030404 3300025898 Bacteria 2576
291 Ga0207710_10124212 3300025900 Bacteria 1235
292 Ga0207680_10005017 3300025903 Bacteria 6306
293 Ga0207680_10171259 3300025903 Bacteria 1462
294 Ga0207699_10221154 3300025906 Bacteria 1292
295 Ga0207699_10295335 3300025906 Bacteria 1130
296 Ga0207645_10061669 3300025907 Bacteria 2395
297 Ga0207705_10096703 3300025909 Bacteria 2168
298 Ga0207705_10117404 3300025909 Bacteria 1971
299 Ga0207654_10002103 3300025911 Bacteria 10183
300 Ga0207654_10012829 3300025911 Unclassified 4300
301 Ga0207654_10015126 3300025911 Bacteria 3997
302 Ga0207654_10042271 3300025911 Bacteria 2578
303 Ga0207654_10123534 3300025911 Bacteria 1629
304 Ga0207654_10230952 3300025911 Bacteria 1232
305 Ga0207654_10317753 3300025911 Bacteria 1064
306 Ga0207707_10002717 3300025912 Bacteria 15796
307 Ga0207707_10004495 3300025912 Bacteria 12268
308 Ga0207707_10014579 3300025912 Bacteria 6847
309 Ga0207707_10131025 3300025912 Bacteria 2193
310 Ga0207707_10171437 3300025912 Bacteria 1896
311 Ga0207707_10189991 3300025912 Bacteria 1792
312 Ga0207707_10221541 3300025912 Bacteria 1647
313 Ga0207695_10002192 3300025913 Bacteria 29480
314 Ga0207695_10003003 3300025913 Bacteria 24250
315 Ga0207695_10003666 3300025913 Bacteria 21419
316 Ga0207695_10004712 3300025913 Bacteria 18475
317 Ga0207695_10013398 3300025913 Bacteria 9781
318 Ga0207695_10014068 3300025913 Bacteria 9502
319 Ga0207695_10022587 3300025913 Bacteria 7136
320 Ga0207695_10039952 3300025913 Bacteria 5038
321 Ga0207695_10068023 3300025913 Bacteria 3651
322 Ga0207695_10073747 3300025913 Bacteria 3477
323 Ga0207695_10302113 3300025913 Bacteria 1492
324 Ga0207695_10351049 3300025913 Bacteria 1362
325 Ga0207695_10539223 3300025913 Bacteria 1048
326 Ga0207671_10004955 3300025914 Bacteria 12488
327 Ga0207671_10033998 3300025914 Bacteria 3791
328 Ga0207671_10065230 3300025914 Bacteria 2708
329 Ga0207671_10072450 3300025914 Bacteria 2571
330 Ga0207671_10106904 3300025914 Bacteria 2125
331 Ga0207671_10162569 3300025914 Bacteria 1730
332 Ga0207671_10338395 3300025914 Bacteria 1192
333 Ga0207693_10046663 3300025915 Bacteria 3404
334 Ga0207663_10024932 3300025916 Bacteria 3450
335 Ga0207663_10041675 3300025916 Bacteria 2800
336 Ga0207663_10106456 3300025916 Bacteria 1895
337 Ga0207663_10234007 3300025916 Bacteria 1344
338 Ga0207663_10368999 3300025916 Bacteria 1091
339 Ga0207660_10039937 3300025917 Bacteria 3282
340 Ga0207660_10080437 3300025917 Bacteria 2393
341 Ga0207660_10088407 3300025917 Bacteria 2291
342 Ga0207660_10221286 3300025917 Bacteria 1486
343 Ga0207660_10406466 3300025917 Bacteria 1097
344 Ga0207662_10368967 3300025918 Bacteria 967
345 Ga0207657_10045424 3300025919 Bacteria 3855
346 Ga0207657_10073910 3300025919 Bacteria 2879
347 Ga0207657_10173964 3300025919 Bacteria 1743
348 Ga0207649_10040324 3300025920 Bacteria 2837
349 Ga0207649_10108707 3300025920 Bacteria 1849
350 Ga0207652_10001801 3300025921 Bacteria 18612
351 Ga0207652_10116067 3300025921 Bacteria 2378
352 Ga0207694_10003089 3300025924 Bacteria 13330
353 Ga0207694_10004347 3300025924 Bacteria 11066
354 Ga0207694_10006916 3300025924 Bacteria 8612
355 Ga0207694_10011443 3300025924 Bacteria 6695
356 Ga0207694_10059591 3300025924 Bacteria 2969
357 Ga0207694_10089551 3300025924 Bacteria 2427
358 Ga0207694_10175149 3300025924 Bacteria 1738
359 Ga0207694_10270690 3300025924 Bacteria 1393
360 Ga0207687_10002645 3300025927 Bacteria 12129
361 Ga0207687_10008818 3300025927 Bacteria 6592
362 Ga0207687_10014193 3300025927 Bacteria 5212
363 Ga0207687_10103311 3300025927 Bacteria 2101
364 Ga0207687_10144881 3300025927 Bacteria 1806
365 Ga0207687_10469983 3300025927 Bacteria 1045
366 Ga0207687_10570909 3300025927 Bacteria 951
367 Ga0207700_10010690 3300025928 Bacteria 5808
368 Ga0207700_10120764 3300025928 Bacteria 2124
369 Ga0207700_10132296 3300025928 Bacteria 2038
370 Ga0207700_10212239 3300025928 Bacteria 1637
371 Ga0207664_10003958 3300025929 Bacteria 9971
372 Ga0207664_10029249 3300025929 Bacteria 4195
373 Ga0207664_10066895 3300025929 Bacteria 2882
374 Ga0207644_10027535 3300025931 Bacteria 3927
375 Ga0207644_10374041 3300025931 Bacteria 1161
376 Ga0207706_10057352 3300025933 Bacteria 3431
377 Ga0207686_10023433 3300025934 Bacteria 3566
378 Ga0207686_10029010 3300025934 Bacteria 3259
379 Ga0207686_10083789 3300025934 Bacteria 2087
380 Ga0207686_10154251 3300025934 Bacteria 1602
381 Ga0207686_10222716 3300025934 Bacteria 1363
382 Ga0207704_10012304 3300025938 Bacteria 4246
383 Ga0207704_10080995 3300025938 Bacteria 2098
384 Ga0207704_10181941 3300025938 Bacteria 1520
385 Ga0207691_10250013 3300025940 Bacteria 1531
386 Ga0207711_10001276 3300025941 Bacteria 23865
387 Ga0207711_10031573 3300025941 Bacteria 4472
388 Ga0207711_10059986 3300025941 Bacteria 3277
389 Ga0207711_10302391 3300025941 Bacteria 1476
390 Ga0207689_10061765 3300025942 Bacteria 3081
391 Ga0207689_10264612 3300025942 Bacteria 1423
392 Ga0207661_10000008 3300025944 Bacteria 451211
393 Ga0207661_10004308 3300025944 Bacteria 9961
394 Ga0207661_10134053 3300025944 Bacteria 2125
395 Ga0207661_10263666 3300025944 Bacteria 1535
396 Ga0207679_10174093 3300025945 Bacteria 1775
397 Ga0207679_10199707 3300025945 Bacteria 1669
398 Ga0207667_10005708 3300025949 Bacteria 15179
399 Ga0207667_10006005 3300025949 Bacteria 14776
400 Ga0207667_10016739 3300025949 Bacteria 8271
401 Ga0207667_10017798 3300025949 Bacteria 7989
402 Ga0207667_10025374 3300025949 Bacteria 6488
403 Ga0207667_10040313 3300025949 Bacteria 4973
404 Ga0207667_10052037 3300025949 Bacteria 4315
405 Ga0207667_10231227 3300025949 Bacteria 1893
406 Ga0207667_10238675 3300025949 Bacteria 1861
407 Ga0207667_10319842 3300025949 Bacteria 1585
408 Ga0207667_10329228 3300025949 Bacteria 1560
409 Ga0207667_10787819 3300025949 Bacteria 948
410 Ga0207651_10033584 3300025960 Bacteria 3311
411 Ga0207651_10097837 3300025960 Bacteria 2168
412 Ga0207712_10027513 3300025961 Bacteria 3798
413 Ga0207712_10129888 3300025961 Bacteria 1918
414 Ga0207640_10175259 3300025981 Bacteria 1602
415 Ga0207677_10031753 3300026023 Bacteria 3385
416 Ga0207677_10145343 3300026023 Bacteria 1821
417 Ga0207677_10155288 3300026023 Bacteria 1771
418 Ga0207703_10027702 3300026035 Bacteria 4462
419 Ga0207703_10068868 3300026035 Bacteria 2916
420 Ga0207639_10029023 3300026041 Bacteria 4046
421 Ga0207639_10041913 3300026041 Bacteria 3429
422 Ga0207639_10058306 3300026041 Bacteria 2969
423 Ga0207639_10393532 3300026041 Bacteria 1247
424 Ga0207678_10040173 3300026067 Bacteria 4058
425 Ga0207702_10010815 3300026078 Bacteria 7612
426 Ga0207702_10019879 3300026078 Bacteria 5563
427 Ga0207702_10035328 3300026078 Unclassified 4180
428 Ga0207702_10076619 3300026078 Bacteria 2891
429 Ga0207702_10099210 3300026078 Bacteria 2567
430 Ga0207702_10127375 3300026078 Bacteria 2288
431 Ga0207702_10127549 3300026078 Bacteria 2286
432 Ga0207702_10217551 3300026078 Bacteria 1779
433 Ga0207702_10405241 3300026078 Bacteria 1316
434 Ga0207702_10507232 3300026078 Bacteria 1176
435 Ga0207641_10028899 3300026088 Unclassified 4583
436 Ga0207641_10345677 3300026088 Bacteria 1416
437 Ga0207641_10522198 3300026088 Bacteria 1155
438 Ga0207648_10052871 3300026089 Bacteria 3551
439 Ga0207648_10054929 3300026089 Bacteria 3477
440 Ga0207648_10700259 3300026089 Bacteria 939
441 Ga0207674_10000300 3300026116 Bacteria 62723
442 Ga0207674_10002626 3300026116 Bacteria 22497
443 Ga0207674_10003738 3300026116 Bacteria 18570
444 Ga0207674_10125874 3300026116 Bacteria 2528
445 Ga0207674_10132882 3300026116 Bacteria 2451
446 Ga0207674_10166575 3300026116 Bacteria 2158
447 Ga0207674_10567598 3300026116 Bacteria 1096
448 Ga0207698_10089594 3300026142 Bacteria 2513
449 Ga0207698_10096422 3300026142 Bacteria 2437
450 Ga0207698_10406672 3300026142 Bacteria 1302
451 Ga0268266_10067430 3300028379 Bacteria 3097
452 Ga0268266_10082747 3300028379 Bacteria 2800
453 Ga0268266_10132312 3300028379 Bacteria 2232
454 Ga0268266_10206487 3300028379 Bacteria 1800
455 Ga0268264_10044237 3300028381 Bacteria 3693
456 Ga0268264_10128194 3300028381 Bacteria 2245
457 Ga0268264_10247249 3300028381 Bacteria 1655
458 Ga0268264_10341417 3300028381 Bacteria 1423
459 Ga0268264_10365122 3300028381 Bacteria 1378
460 Ga0265336_10018772 3300028666 Bacteria 2237
461 Ga0265338_10084456 3300028800 Bacteria 2650
462 Ga0265332_10014399 3300031238 Bacteria 3498
463 Ga0265332_10029721 3300031238 Bacteria 2388
464 Ga0265320_10015146 3300031240 Bacteria 4365
465 Ga0265325_10000825 3300031241 Bacteria 22507
466 Ga0265325_10045341 3300031241 Bacteria 2285
467 Ga0265340_10008185 3300031247 Bacteria 5654
468 Ga0265331_10043088 3300031250 Bacteria 2187
469 Ga0265316_10000602 3300031344 Bacteria 40145
470 Ga0265316_10007613 3300031344 Bacteria 10177
471 Ga0265316_10026066 3300031344 Bacteria 4871
472 Ga0265316_10066091 3300031344 Bacteria 2799
473 Ga0265316_10115093 3300031344 Bacteria 2033
474 Ga0265316_10338629 3300031344 Bacteria 1090
475 Ga0265313_10081514 3300031595 Bacteria 1469
476 Ga0265314_10001370 3300031711 Bacteria 27380
477 Ga0265314_10002485 3300031711 Bacteria 18841
478 Ga0265314_10089931 3300031711 Bacteria 2001
479 Ga0265314_10121116 3300031711 Bacteria 1647
480 Ga0265314_10136026 3300031711 Bacteria 1526
481 Ga0265342_10091894 3300031712 Bacteria 1739
482 Ga0373926_0033761 3300035083 Bacteria 1810
483 Ga0373934_0001407 3300035086 Bacteria 8793
484 Ga0373934_0118508 3300035086 Bacteria 1076
485 Ga0373923_0113053 3300035111 Bacteria 1207
486 Ga0373923_0161598 3300035111 Bacteria 1022
487 Ga0373954_0014223 3300035118 Bacteria 3549
488 Ga0373954_0027116 3300035118 Bacteria 2627
489 Ga0373956_0107010 3300035119 Bacteria 1300
490 Ga0373957_0042118 3300035120 Bacteria 1722
491 Ga0373943_0042920 3300035170 Bacteria 2194
492 Ga0373955_0202519 3300035172 Bacteria 1182
493 Ga0373935_0033838 3300035692 Bacteria 3183
494 Ga0373935_0097891 3300035692 Bacteria 1930
495 Ga0373935_0154645 3300035692 Bacteria 1559
496 Ga0373927_0002301 3300035695 Bacteria 13965
497 Ga0373927_0003249 3300035695 Bacteria 11693
498 Ga0373927_0184075 3300035695 Bacteria 1370
499 Ga0373933_0040306 3300035724 Bacteria 2751
500 Ga0373947_0001408 3300035725 Bacteria 14812
501 Ga0373947_0014552 3300035725 Bacteria 4514
502 Ga0373947_0044627 3300035725 Bacteria 2650
503 Ga0373947_0055565 3300035725 Bacteria 2391
504 Ga0373937_0032111 3300036401 Bacteria 4761
505 Ga0373937_0038516 3300036401 Bacteria 4356
506 Ga0373937_0062436 3300036401 Bacteria 3425
507 Ga0373937_0083864 3300036401 Bacteria 2949
508 Ga0373937_0136913 3300036401 Bacteria 2290
509 Ga0373937_0137979 3300036401 Bacteria 2280
510 Ga0373937_0237349 3300036401 Bacteria 1717
511 Ga0373925_0000378 3300037068 Bacteria 46198
512 Ga0373925_0003480 3300037068 Bacteria 12175
513 Ga0373925_0006245 3300037068 Bacteria 8787
514 Ga0373925_0014342 3300037068 Bacteria 5733
515 Ga0373925_0143866 3300037068 Bacteria 1868
516 Ga0373925_0167527 3300037068 Bacteria 1733
517 Ga0395900_0704850 3300037418 Bacteria 943
518 Ga0436364_0035509 3300037853 Bacteria 5220
519 Ga0436364_0362933 3300037853 Bacteria 4399
520 Ga0436364_0378137 3300037853 Bacteria 57218
521 Ga0436364_0612043 3300037853 Bacteria 326330
522 Ga0436364_0622297 3300037853 Bacteria 5348
523 Ga0436364_0628087 3300037853 Bacteria 2896
524 Ga0436364_0648475 3300037853 Bacteria 2047
525 Ga0436364_0756434 3300037853 Bacteria 4244
526 Ga0436364_0866914 3300037853 Bacteria 2033
527 Ga0436364_0992705 3300037853 Bacteria 6507
528 Ga0436364_1281089 3300037853 Bacteria 3166
529 Ga0436364_1435313 3300037853 Unclassified 1922
530 Ga0436364_1514273 3300037853 Bacteria 4146
531 Ga0395901_0727805 3300038443 Bacteria 987
532 Ga0436365_0158787 3300039437 Bacteria 6774
533 Ga0436365_0240874 3300039437 Bacteria 1456
534 Ga0436365_0330614 3300039437 Bacteria 1114
535 Ga0436365_1109766 3300039437 Bacteria 1369
536 Ga0436365_1200822 3300039437 Bacteria 15628
537 Ga0436365_1637806 3300039437 Bacteria 2923
538 Ga0436360_0581083 3300039438 Bacteria 4779
539 Ga0436360_0589158 3300039438 Bacteria 1496
540 Ga0436361_0510126 3300039447 Bacteria 27659
541 Ga0436361_0938922 3300039447 Bacteria 958
542 Ga0436363_0293846 3300039450 Bacteria 2256
543 Ga0436363_0715765 3300039450 Bacteria 1393
544 Ga0436362_0949689 3300039453 Unclassified 919
545 Ga0436362_1115434 3300039453 Bacteria 1843
546 Ga0436362_1227303 3300039453 Bacteria 1603
547 Ga0466966_0045548 3300044684 Bacteria 2804
548 Ga0466963_0418556 3300044694 Bacteria 945
549 Ga0466959_0239771 3300045049 Bacteria 1253
550 Ga0451576_0462789 3300045051 Bacteria 1332
551 Ga0466958_0230756 3300045836 Bacteria 1182
552 Ga0466967_0110332 3300045976 Unclassified 2527
553 Ga0466967_0374964 3300045976 Bacteria 1381
554 Ga0466967_0421749 3300045976 Bacteria 1301
555 Ga0495592_0028742 3300046454 Bacteria 4208
556 Ga0495592_0032053 3300046454 Bacteria 3969
557 Ga0495592_0321929 3300046454 Bacteria 999
558 Ga0495651_0006480 3300046462 Bacteria 8946
559 Ga0495651_0199153 3300046462 Bacteria 1403
560 Ga0495653_0032054 3300046463 Bacteria 4176
561 Ga0495580_0003381 3300046472 Bacteria 13631
562 Ga0495580_0008927 3300046472 Bacteria 7927
563 Ga0495580_0067820 3300046472 Bacteria 2496
564 Ga0495580_0069439 3300046472 Bacteria 2462
565 Ga0495580_0079124 3300046472 Bacteria 2293
566 Ga0495580_0099333 3300046472 Bacteria 2024
567 Ga0495580_0162112 3300046472 Bacteria 1547
568 Ga0495580_0188813 3300046472 Bacteria 1422
569 Ga0495580_0235381 3300046472 Bacteria 1256
570 Ga0495582_0004709 3300046473 Bacteria 7669
571 Ga0495582_0068804 3300046473 Bacteria 1957
572 Ga0495582_0159818 3300046473 Bacteria 1281
573 Ga0495662_0003213 3300046476 Bacteria 8251
574 Ga0495664_0043667 3300046477 Bacteria 2656
575 Ga0495664_0159444 3300046477 Bacteria 1369
576 Ga0495594_0045738 3300046499 Bacteria 2403
577 Ga0495594_0172599 3300046499 Bacteria 1230
578 Ga0495608_0077294 3300046511 Bacteria 2167
579 Ga0495608_0079514 3300046511 Bacteria 2132
580 Ga0495628_0048471 3300046516 Bacteria 3367
581 Ga0495630_0017827 3300046517 Bacteria 5207
582 Ga0495666_0153524 3300046526 Bacteria 1070
583 Ga0495652_0021534 3300046529 Bacteria 5729
584 Ga0495665_0025185 3300046531 Bacteria 3197
585 Ga0495665_0075702 3300046531 Bacteria 1772
586 Ga0495640_0114869 3300046533 Bacteria 1755
587 Ga0495586_0230363 3300046535 Bacteria 1054
588 Ga0495587_0000369 3300046536 Bacteria 32101
589 Ga0495587_0069620 3300046536 Bacteria 2049
590 Ga0495587_0072854 3300046536 Bacteria 1996
591 Ga0495587_0170543 3300046536 Bacteria 1236
592 Ga0495645_0007860 3300046543 Bacteria 7419
593 Ga0495645_0149215 3300046543 Bacteria 1626
594 Ga0495645_0300861 3300046543 Bacteria 1048
595 Ga0495667_0007870 3300046559 Bacteria 7224
596 Ga0495667_0228185 3300046559 Bacteria 1187
597 Ga0495634_0015888 3300046642 Bacteria 5393
598 Ga0495634_0106113 3300046642 Bacteria 1810
599 Ga0495635_0094331 3300046663 Bacteria 2046
600 Ga0495635_0166924 3300046663 Bacteria 1497
601 Ga0495635_0223292 3300046663 Bacteria 1274
602 Ga0495599_0064056 3300046678 Bacteria 2296
603 Ga0495599_0148909 3300046678 Bacteria 1450
604 Ga0495623_0045580 3300046679 Bacteria 2785
605 Ga0495623_0058124 3300046679 Bacteria 2432
606 Ga0495658_0074771 3300046683 Bacteria 1975
607 Ga0495658_0152618 3300046683 Bacteria 1420
608 Ga0495669_0171819 3300046684 Bacteria 1031
609 Ga0495613_0019989 3300046689 Bacteria 4991
610 Ga0495613_0051160 3300046689 Bacteria 3046
611 Ga0495613_0155252 3300046689 Bacteria 1631
612 Ga0495674_0016845 3300047319 Bacteria 6815
613 Ga0495674_0034074 3300047319 Bacteria 4607
614 Ga0495674_0045799 3300047319 Bacteria 3884
615 Ga0495674_0143343 3300047319 Bacteria 2007
616 Ga0495674_0195104 3300047319 Bacteria 1682
617 Ga0495680_0008013 3300047322 Bacteria 9632
618 Ga0495680_0259121 3300047322 Bacteria 1230
619 Ga0495680_0401543 3300047322 Bacteria 946
620 Ga0495684_0015364 3300047471 Bacteria 5892
621 Ga0495684_0053527 3300047471 Bacteria 3079
622 Ga0495593_0133090 3300047673 Bacteria 1262
623 Ga0495602_0004609 3300048088 Bacteria 14379
624 Ga0495602_0018093 3300048088 Bacteria 7048
625 Ga0496100_0361467 3300048903 Bacteria 1099
626 Ga0496102_0267405 3300048905 Bacteria 1612
627 Ga0496104_0516043 3300048907 Bacteria 1106
628 Ga0496106_0299299 3300048909 Bacteria 1290
629 Ga0496112_0026195 3300048915 Bacteria 5608
630 Ga0496115_0008018 3300048918 Bacteria 7795
631 Ga0496115_0143296 3300048918 Bacteria 1971
632 Ga0496126_0068125 3300048929 Bacteria 3179
633 Ga0501031_0023494 3300049568 Bacteria 4019
634 Ga0501032_0001165 3300049569 Bacteria 21094
635 Ga0501032_0067914 3300049569 Bacteria 2381
636 Ga0501034_0014757 3300049571 Bacteria 8041
637 Ga0501034_0017376 3300049571 Bacteria 7378
638 Ga0501034_0169336 3300049571 Bacteria 2152
639 Ga0501036_0007493 3300049572 Bacteria 8900
640 Ga0501037_0168254 3300049573 Bacteria 1559
641 Ga0501038_0014476 3300049574 Bacteria 7187
642 Ga0501039_0008248 3300049575 Bacteria 7939
643 Ga0501043_0004312 3300049579 Bacteria 11577
644 Ga0501046_0002931 3300049580 Bacteria 15788
645 Ga0501046_0066720 3300049580 Bacteria 2804
646 Ga0501047_0008796 3300049581 Bacteria 9526
647 Ga0501047_0060307 3300049581 Bacteria 3661
648 Ga0501047_0179672 3300049581 Bacteria 1982
649 Ga0501047_0244580 3300049581 Bacteria 1644
650 Ga0501067_0000907 3300049583 Bacteria 15936
651 Ga0501068_0001120 3300049584 Bacteria 14174
652 Ga0501069_0007271 3300049585 Bacteria 5808
653 Ga0501070_0197493 3300049586 Bacteria 1652
654 Ga0501072_0001993 3300049588 Bacteria 15211
655 Ga0501073_0000471 3300049589 Bacteria 27854
656 Ga0501073_0054455 3300049589 Bacteria 2801
657 Ga0501074_0017378 3300049590 Bacteria 5218
658 Ga0501076_0060938 3300049592 Bacteria 3003
659 Ga0501077_0005967 3300049593 Bacteria 7441
660 Ga0501079_0005210 3300049741 Bacteria 9660
661 Ga0501080_0000006 3300049742 Bacteria 138444
662 Ga0501083_0025741 3300049744 Bacteria 4072
663 Ga0501035_0089298 3300049822 Bacteria 2714
664 Ga0501035_0135646 3300049822 Bacteria 2143
665 Ga0501044_0000814 3300049823 Bacteria 37495
666 Ga0501044_0012973 3300049823 Bacteria 9022
667 Ga0501044_0017662 3300049823 Bacteria 7651
668 Ga0501044_0079518 3300049823 Bacteria 3322
669 Ga0501044_0267766 3300049823 Bacteria 1645
670 nmdc:mga05p37_130646_c1 3300050507 Bacteria 3081
671 nmdc:mga05p37_180709_c1 3300050507 Bacteria 2566
672 nmdc:mga05p37_294780_c1 3300050507 Bacteria 1929
673 nmdc:mga0qj67_536406_c1 3300050509 Bacteria 939
674 nmdc:mga06r32_52589_c1 3300050510 Bacteria 3901
675 nmdc:mga08x19_974_c1 3300050514 Bacteria 11042
676 Ga0500568_0000650 3300053139 Bacteria 25110
677 Ga0501084_0000747 3300054114 Bacteria 24758
678 Ga0501082_0000311 3300060353 Bacteria 43370
679 Ga0501082_0016943 3300060353 Bacteria 6273

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046679 Ga0495623_0058124 Ga0495623_0058124_22_792 256
2 3300005539 Ga0068853_100003952 Ga0068853_1000039527 261
3 3300021388 Ga0213875_10000163 Ga0213875_1000016322 264
4 3300005329 Ga0070683_100058517 Ga0070683_1000585172 265
5 3300005336 Ga0070680_100007554 Ga0070680_1000075548 265
6 3300005339 Ga0070660_100032638 Ga0070660_1000326382 265
7 3300005355 Ga0070671_100018720 Ga0070671_1000187204 265
8 3300005457 Ga0070662_100043244 Ga0070662_1000432442 265
9 3300005535 Ga0070684_100094866 Ga0070684_1000948662 265
10 3300005535 Ga0070684_100098667 Ga0070684_1000986672 265
11 3300005547 Ga0070693_100071686 Ga0070693_1000716862 265
12 3300005548 Ga0070665_100013558 Ga0070665_1000135588 265
13 3300005563 Ga0068855_100009796 Ga0068855_1000097968 265
14 3300005563 Ga0068855_100051076 Ga0068855_1000510762 265
15 3300005563 Ga0068855_100536344 Ga0068855_1005363442 265
16 3300005564 Ga0070664_100069681 Ga0070664_1000696813 265
17 3300005614 Ga0068856_100035270 Ga0068856_1000352706 265
18 3300005616 Ga0068852_100022651 Ga0068852_1000226514 265
19 3300006028 Ga0070717_10156904 Ga0070717_101569042 265
20 3300006237 Ga0097621_100127546 Ga0097621_1001275462 265
21 3300006237 Ga0097621_100276363 Ga0097621_1002763631 265
22 3300009174 Ga0105241_10050417 Ga0105241_100504173 265
23 3300009545 Ga0105237_10045602 Ga0105237_100456026 265
24 3300009551 Ga0105238_10038044 Ga0105238_100380446 265
25 3300009553 Ga0105249_10014215 Ga0105249_100142154 265
26 3300010375 Ga0105239_10007095 Ga0105239_1000709513 265
27 3300013307 Ga0157372_10190074 Ga0157372_101900742 265
28 3300025913 Ga0207695_10004712 Ga0207695_100047124 265
29 3300025913 Ga0207695_10014068 Ga0207695_100140683 265
30 3300025917 Ga0207660_10039937 Ga0207660_100399371 265
31 3300025927 Ga0207687_10144881 Ga0207687_101448811 265
32 3300025929 Ga0207664_10029249 Ga0207664_100292495 265
33 3300025944 Ga0207661_10134053 Ga0207661_101340532 265
34 3300025949 Ga0207667_10040313 Ga0207667_100403135 265
35 3300025960 Ga0207651_10033584 Ga0207651_100335843 265
36 3300026142 Ga0207698_10089594 Ga0207698_100895942 265
37 3300028379 Ga0268266_10067430 Ga0268266_100674304 265
38 3300036401 Ga0373937_0038516 Ga0373937_0038516_3494_4291 265
39 3300037418 Ga0395900_0704850 Ga0395900_0704850_105_902 265
40 3300039437 Ga0436365_0240874 Ga0436365_0240874_37_834 265
41 3300039437 Ga0436365_1109766 Ga0436365_1109766_246_1046 265
42 3300039453 Ga0436362_0949689 Ga0436362_0949689_39_839 265
43 3300045976 Ga0466967_0421749 Ga0466967_0421749_437_1234 265
44 3300046472 Ga0495580_0099333 Ga0495580_0099333_1206_2003 265
45 3300046535 Ga0495586_0230363 Ga0495586_0230363_218_1015 265
46 3300046684 Ga0495669_0171819 Ga0495669_0171819_72_869 265
47 3300049581 Ga0501047_0179672 Ga0501047_0179672_477_1274 265
48 3300005548 Ga0070665_100078360 Ga0070665_1000783604 269
49 3300006237 Ga0097621_100255791 Ga0097621_1002557912 269
50 3300006358 Ga0068871_100217179 Ga0068871_1002171792 269
51 3300010375 Ga0105239_10126838 Ga0105239_101268383 269
52 3300013307 Ga0157372_10211217 Ga0157372_102112173 269
53 3300021388 Ga0213875_10016290 Ga0213875_100162904 269
54 3300025913 Ga0207695_10039952 Ga0207695_100399524 269
55 3300025921 Ga0207652_10116067 Ga0207652_101160673 269
56 3300025924 Ga0207694_10089551 Ga0207694_100895512 269
57 3300025934 Ga0207686_10083789 Ga0207686_100837892 269
58 3300026023 Ga0207677_10031753 Ga0207677_100317533 269
59 3300028379 Ga0268266_10132312 Ga0268266_101323121 269
60 3300031711 Ga0265314_10002485 Ga0265314_1000248511 269
61 3300050509 nmdc:mga0qj67_536406_c1 nmdc:mga0qj67_536406_c1_27_836 269
62 3300049588 Ga0501072_0001993 Ga0501072_0001993_33_875 280
63 3300039447 Ga0436361_0938922 Ga0436361_0938922_56_934 292
64 3300005354 Ga0070675_100337073 Ga0070675_1003370731 293
65 3300005617 Ga0068859_100036385 Ga0068859_1000363851 293
66 3300005618 Ga0068864_100221031 Ga0068864_1002210312 293
67 3300005843 Ga0068860_100182337 Ga0068860_1001823372 293
68 3300006358 Ga0068871_100046269 Ga0068871_1000462691 293
69 3300006881 Ga0068865_100251266 Ga0068865_1002512661 293
70 3300006931 Ga0097620_100036386 Ga0097620_1000363861 293
71 3300009148 Ga0105243_10190100 Ga0105243_101901001 293
72 3300013306 Ga0163162_10591152 Ga0163162_105911521 293
73 3300025898 Ga0207692_10030404 Ga0207692_100304041 293
74 3300025928 Ga0207700_10010690 Ga0207700_100106903 293
75 3300025938 Ga0207704_10181941 Ga0207704_101819412 293
76 3300026089 Ga0207648_10052871 Ga0207648_100528712 293
77 3300028381 Ga0268264_10247249 Ga0268264_102472491 293
78 3300035086 Ga0373934_0118508 Ga0373934_0118508_80_961 293
79 3300035170 Ga0373943_0042920 Ga0373943_0042920_160_1041 293
80 3300036401 Ga0373937_0237349 Ga0373937_0237349_67_948 293
81 3300037068 Ga0373925_0014342 Ga0373925_0014342_186_1067 293
82 3300037853 Ga0436364_0378137 Ga0436364_0378137_34653_35537 293
83 3300039437 Ga0436365_0330614 Ga0436365_0330614_148_1038 293
84 3300039453 Ga0436362_1227303 Ga0436362_1227303_562_1452 293
85 3300046454 Ga0495592_0032053 Ga0495592_0032053_268_1149 293
86 3300046477 Ga0495664_0159444 Ga0495664_0159444_142_1023 293
87 3300046536 Ga0495587_0000369 Ga0495587_0000369_6971_7852 293
88 3300046543 Ga0495645_0149215 Ga0495645_0149215_343_1224 293
89 3300046678 Ga0495599_0148909 Ga0495599_0148909_176_1057 293
90 3300048088 Ga0495602_0004609 Ga0495602_0004609_11632_12513 293
91 3300005329 Ga0070683_100000008 Ga0070683_100000008228 294
92 3300005329 Ga0070683_100089291 Ga0070683_1000892914 294
93 3300005329 Ga0070683_100199235 Ga0070683_1001992351 294
94 3300005329 Ga0070683_100613002 Ga0070683_1006130021 294
95 3300005330 Ga0070690_100290510 Ga0070690_1002905102 294
96 3300005330 Ga0070690_100307599 Ga0070690_1003075991 294
97 3300005334 Ga0068869_100256154 Ga0068869_1002561542 294
98 3300005334 Ga0068869_100380007 Ga0068869_1003800072 294
99 3300005335 Ga0070666_10000927 Ga0070666_100009276 294
100 3300005335 Ga0070666_10158407 Ga0070666_101584071 294
101 3300005336 Ga0070680_100085276 Ga0070680_1000852762 294
102 3300005336 Ga0070680_100142652 Ga0070680_1001426522 294
103 3300005336 Ga0070680_100186120 Ga0070680_1001861202 294
104 3300005338 Ga0068868_100023618 Ga0068868_1000236186 294
105 3300005338 Ga0068868_100075749 Ga0068868_1000757492 294
106 3300005338 Ga0068868_100093513 Ga0068868_1000935132 294
107 3300005338 Ga0068868_100119743 Ga0068868_1001197433 294
108 3300005339 Ga0070660_100002742 Ga0070660_1000027428 294
109 3300005339 Ga0070660_100375049 Ga0070660_1003750491 294
110 3300005341 Ga0070691_10002114 Ga0070691_100021141 294
111 3300005344 Ga0070661_100129655 Ga0070661_1001296552 294
112 3300005355 Ga0070671_100267980 Ga0070671_1002679801 294
113 3300005364 Ga0070673_100123165 Ga0070673_1001231652 294
114 3300005365 Ga0070688_100150727 Ga0070688_1001507272 294
115 3300005367 Ga0070667_100055003 Ga0070667_1000550032 294
116 3300005434 Ga0070709_10030640 Ga0070709_100306401 294
117 3300005434 Ga0070709_10063403 Ga0070709_100634033 294
118 3300005435 Ga0070714_100003215 Ga0070714_10000321510 294
119 3300005435 Ga0070714_100058773 Ga0070714_1000587733 294
120 3300005435 Ga0070714_100064407 Ga0070714_1000644072 294
121 3300005436 Ga0070713_100167342 Ga0070713_1001673422 294
122 3300005439 Ga0070711_100042000 Ga0070711_1000420002 294
123 3300005439 Ga0070711_100090522 Ga0070711_1000905222 294
124 3300005439 Ga0070711_100318339 Ga0070711_1003183392 294
125 3300005445 Ga0070708_100284292 Ga0070708_1002842922 294
126 3300005455 Ga0070663_100060249 Ga0070663_1000602493 294
127 3300005458 Ga0070681_10006458 Ga0070681_100064582 294
128 3300005458 Ga0070681_10063096 Ga0070681_100630962 294
129 3300005458 Ga0070681_10089637 Ga0070681_100896372 294
130 3300005458 Ga0070681_10090794 Ga0070681_100907942 294
131 3300005458 Ga0070681_10097798 Ga0070681_100977983 294
132 3300005458 Ga0070681_10123522 Ga0070681_101235224 294
133 3300005459 Ga0068867_100046551 Ga0068867_1000465513 294
134 3300005518 Ga0070699_100268052 Ga0070699_1002680522 294
135 3300005535 Ga0070684_100000002 Ga0070684_100000002218 294
136 3300005535 Ga0070684_100002594 Ga0070684_10000259413 294
137 3300005535 Ga0070684_100078823 Ga0070684_1000788233 294
138 3300005535 Ga0070684_100225988 Ga0070684_1002259882 294
139 3300005539 Ga0068853_100016150 Ga0068853_1000161507 294
140 3300005539 Ga0068853_100592998 Ga0068853_1005929981 294
141 3300005543 Ga0070672_100269938 Ga0070672_1002699382 294
142 3300005544 Ga0070686_100037813 Ga0070686_1000378134 294
143 3300005544 Ga0070686_100283343 Ga0070686_1002833432 294
144 3300005546 Ga0070696_100008036 Ga0070696_1000080365 294
145 3300005548 Ga0070665_100051724 Ga0070665_1000517242 294
146 3300005548 Ga0070665_100179540 Ga0070665_1001795404 294
147 3300005563 Ga0068855_100014432 Ga0068855_1000144322 294
148 3300005563 Ga0068855_100023824 Ga0068855_1000238248 294
149 3300005563 Ga0068855_100146721 Ga0068855_1001467214 294
150 3300005563 Ga0068855_100149562 Ga0068855_1001495623 294
151 3300005563 Ga0068855_100184194 Ga0068855_1001841943 294
152 3300005563 Ga0068855_100268366 Ga0068855_1002683662 294
153 3300005563 Ga0068855_100416320 Ga0068855_1004163202 294
154 3300005563 Ga0068855_100489111 Ga0068855_1004891112 294
155 3300005564 Ga0070664_100058067 Ga0070664_1000580674 294
156 3300005564 Ga0070664_100105947 Ga0070664_1001059471 294
157 3300005577 Ga0068857_100011338 Ga0068857_1000113388 294
158 3300005577 Ga0068857_100015478 Ga0068857_1000154787 294
159 3300005577 Ga0068857_100041697 Ga0068857_1000416971 294
160 3300005577 Ga0068857_100101393 Ga0068857_1001013933 294
161 3300005614 Ga0068856_100003872 Ga0068856_10000387213 294
162 3300005614 Ga0068856_100004846 Ga0068856_1000048462 294
163 3300005614 Ga0068856_100033576 Ga0068856_1000335765 294
164 3300005614 Ga0068856_100058592 Ga0068856_1000585922 294
165 3300005614 Ga0068856_100196587 Ga0068856_1001965872 294
166 3300005614 Ga0068856_100332321 Ga0068856_1003323211 294
167 3300005614 Ga0068856_100340259 Ga0068856_1003402593 294
168 3300005616 Ga0068852_100256795 Ga0068852_1002567952 294
169 3300005616 Ga0068852_100339061 Ga0068852_1003390612 294
170 3300005617 Ga0068859_100232347 Ga0068859_1002323472 294
171 3300005617 Ga0068859_100260495 Ga0068859_1002604953 294
172 3300005617 Ga0068859_100795630 Ga0068859_1007956301 294
173 3300005618 Ga0068864_100186511 Ga0068864_1001865112 294
174 3300005618 Ga0068864_100430983 Ga0068864_1004309832 294
175 3300005834 Ga0068851_10045862 Ga0068851_100458621 294
176 3300005841 Ga0068863_100031318 Ga0068863_1000313186 294
177 3300005841 Ga0068863_100039440 Ga0068863_1000394406 294
178 3300005841 Ga0068863_100130038 Ga0068863_1001300382 294
179 3300005842 Ga0068858_100007363 Ga0068858_1000073636 294
180 3300005843 Ga0068860_100011802 Ga0068860_1000118028 294
181 3300005843 Ga0068860_100115125 Ga0068860_1001151252 294
182 3300005843 Ga0068860_100632177 Ga0068860_1006321771 294
183 3300005937 Ga0081455_10022065 Ga0081455_100220652 294
184 3300005985 Ga0081539_10031631 Ga0081539_100316312 294
185 3300006028 Ga0070717_10072087 Ga0070717_100720873 294
186 3300006028 Ga0070717_10204902 Ga0070717_102049022 294
187 3300006175 Ga0070712_100083533 Ga0070712_1000835332 294
188 3300006237 Ga0097621_100002831 Ga0097621_1000028312 294
189 3300006237 Ga0097621_100026434 Ga0097621_1000264346 294
190 3300006237 Ga0097621_100080645 Ga0097621_1000806452 294
191 3300006237 Ga0097621_100142486 Ga0097621_1001424862 294
192 3300006237 Ga0097621_100176027 Ga0097621_1001760273 294
193 3300006237 Ga0097621_100363556 Ga0097621_1003635562 294
194 3300006358 Ga0068871_100024195 Ga0068871_1000241956 294
195 3300006358 Ga0068871_100033322 Ga0068871_1000333223 294
196 3300006358 Ga0068871_100112152 Ga0068871_1001121522 294
197 3300006847 Ga0075431_100002616 Ga0075431_10000261615 294
198 3300006881 Ga0068865_100020093 Ga0068865_1000200933 294
199 3300006881 Ga0068865_100096740 Ga0068865_1000967403 294
200 3300006881 Ga0068865_100247732 Ga0068865_1002477322 294
201 3300006914 Ga0075436_100003431 Ga0075436_1000034315 294
202 3300006931 Ga0097620_100232358 Ga0097620_1002323584 294
203 3300006931 Ga0097620_100260493 Ga0097620_1002604933 294
204 3300006931 Ga0097620_100795618 Ga0097620_1007956181 294
205 3300009093 Ga0105240_10000381 Ga0105240_1000038161 294
206 3300009093 Ga0105240_10000408 Ga0105240_100004082 294
207 3300009093 Ga0105240_10002782 Ga0105240_1000278217 294
208 3300009093 Ga0105240_10006165 Ga0105240_100061651 294
209 3300009093 Ga0105240_10035570 Ga0105240_100355703 294
210 3300009093 Ga0105240_10069696 Ga0105240_100696965 294
211 3300009093 Ga0105240_10075100 Ga0105240_100751002 294
212 3300009093 Ga0105240_10187186 Ga0105240_101871862 294
213 3300009093 Ga0105240_10197772 Ga0105240_101977722 294
214 3300009093 Ga0105240_10208408 Ga0105240_102084082 294
215 3300009093 Ga0105240_10505180 Ga0105240_105051802 294
216 3300009098 Ga0105245_10013951 Ga0105245_100139515 294
217 3300009098 Ga0105245_10025460 Ga0105245_100254606 294
218 3300009098 Ga0105245_10025911 Ga0105245_100259116 294
219 3300009098 Ga0105245_10035283 Ga0105245_100352836 294
220 3300009098 Ga0105245_10038828 Ga0105245_100388281 294
221 3300009098 Ga0105245_10040716 Ga0105245_100407161 294
222 3300009098 Ga0105245_10061626 Ga0105245_100616264 294
223 3300009098 Ga0105245_10482209 Ga0105245_104822092 294
224 3300009098 Ga0105245_10580972 Ga0105245_105809721 294
225 3300009147 Ga0114129_10044732 Ga0114129_100447327 294
226 3300009147 Ga0114129_10462128 Ga0114129_104621282 294
227 3300009148 Ga0105243_10059431 Ga0105243_100594313 294
228 3300009174 Ga0105241_10019190 Ga0105241_100191902 294
229 3300009174 Ga0105241_10056486 Ga0105241_100564863 294
230 3300009174 Ga0105241_10130000 Ga0105241_101300003 294
231 3300009174 Ga0105241_10214379 Ga0105241_102143792 294
232 3300009174 Ga0105241_10386490 Ga0105241_103864901 294
233 3300009176 Ga0105242_10006492 Ga0105242_100064927 294
234 3300009176 Ga0105242_10076869 Ga0105242_100768692 294
235 3300009176 Ga0105242_10193914 Ga0105242_101939143 294
236 3300009176 Ga0105242_10311234 Ga0105242_103112341 294
237 3300009177 Ga0105248_10008614 Ga0105248_100086142 294
238 3300009177 Ga0105248_10020925 Ga0105248_100209255 294
239 3300009177 Ga0105248_10031660 Ga0105248_100316607 294
240 3300009177 Ga0105248_10048353 Ga0105248_100483531 294
241 3300009177 Ga0105248_10084335 Ga0105248_100843352 294
242 3300009177 Ga0105248_10239687 Ga0105248_102396872 294
243 3300009177 Ga0105248_10615080 Ga0105248_106150802 294
244 3300009177 Ga0105248_10639768 Ga0105248_106397681 294
245 3300009545 Ga0105237_10004190 Ga0105237_1000419016 294
246 3300009545 Ga0105237_10028686 Ga0105237_100286864 294
247 3300009545 Ga0105237_10028966 Ga0105237_100289662 294
248 3300009545 Ga0105237_10158422 Ga0105237_101584223 294
249 3300009545 Ga0105237_10239987 Ga0105237_102399872 294
250 3300009545 Ga0105237_10491720 Ga0105237_104917201 294
251 3300009545 Ga0105237_10575472 Ga0105237_105754721 294
252 3300009551 Ga0105238_10002578 Ga0105238_100025781 294
253 3300009551 Ga0105238_10026055 Ga0105238_100260552 294
254 3300009551 Ga0105238_10036067 Ga0105238_100360676 294
255 3300009551 Ga0105238_10049965 Ga0105238_100499656 294
256 3300009551 Ga0105238_10095999 Ga0105238_100959995 294
257 3300009551 Ga0105238_10165883 Ga0105238_101658833 294
258 3300009551 Ga0105238_10264771 Ga0105238_102647712 294
259 3300009551 Ga0105238_10614438 Ga0105238_106144381 294
260 3300009553 Ga0105249_10002934 Ga0105249_100029346 294
261 3300009553 Ga0105249_10074866 Ga0105249_100748663 294
262 3300009553 Ga0105249_10150261 Ga0105249_101502611 294
263 3300010375 Ga0105239_10009114 Ga0105239_1000911411 294
264 3300010375 Ga0105239_10030555 Ga0105239_100305552 294
265 3300010375 Ga0105239_10121422 Ga0105239_101214224 294
266 3300010375 Ga0105239_10164197 Ga0105239_101641974 294
267 3300010375 Ga0105239_10175295 Ga0105239_101752952 294
268 3300011119 Ga0105246_10006378 Ga0105246_100063787 294
269 3300011119 Ga0105246_10089554 Ga0105246_100895542 294
270 3300011119 Ga0105246_10400118 Ga0105246_104001181 294
271 3300013100 Ga0157373_10165671 Ga0157373_101656712 294
272 3300013104 Ga0157370_10003411 Ga0157370_100034112 294
273 3300013104 Ga0157370_10155270 Ga0157370_101552701 294
274 3300013104 Ga0157370_10232529 Ga0157370_102325293 294
275 3300013104 Ga0157370_10278559 Ga0157370_102785591 294
276 3300013104 Ga0157370_10349390 Ga0157370_103493902 294
277 3300013105 Ga0157369_10001852 Ga0157369_1000185215 294
278 3300013105 Ga0157369_10061690 Ga0157369_100616905 294
279 3300013105 Ga0157369_10110052 Ga0157369_101100525 294
280 3300013105 Ga0157369_10117083 Ga0157369_101170832 294
281 3300013105 Ga0157369_10118372 Ga0157369_101183722 294
282 3300013105 Ga0157369_10250689 Ga0157369_102506892 294
283 3300013105 Ga0157369_10267352 Ga0157369_102673521 294
284 3300013105 Ga0157369_10737820 Ga0157369_107378201 294
285 3300013296 Ga0157374_10021617 Ga0157374_100216176 294
286 3300013296 Ga0157374_10036701 Ga0157374_100367012 294
287 3300013296 Ga0157374_10076247 Ga0157374_100762472 294
288 3300013296 Ga0157374_10076405 Ga0157374_100764052 294
289 3300013297 Ga0157378_10023708 Ga0157378_100237083 294
290 3300013297 Ga0157378_10057735 Ga0157378_100577353 294
291 3300013297 Ga0157378_10089884 Ga0157378_100898843 294
292 3300013297 Ga0157378_10200032 Ga0157378_102000322 294
293 3300013297 Ga0157378_10249841 Ga0157378_102498413 294
294 3300013306 Ga0163162_10153404 Ga0163162_101534042 294
295 3300013306 Ga0163162_10213547 Ga0163162_102135472 294
296 3300013306 Ga0163162_10426024 Ga0163162_104260241 294
297 3300013306 Ga0163162_10707760 Ga0163162_107077602 294
298 3300013306 Ga0163162_10783023 Ga0163162_107830231 294
299 3300013307 Ga0157372_10064041 Ga0157372_100640416 294
300 3300013307 Ga0157372_10118166 Ga0157372_101181664 294
301 3300013308 Ga0157375_10008398 Ga0157375_100083989 294
302 3300013308 Ga0157375_10360290 Ga0157375_103602902 294
303 3300013308 Ga0157375_10413155 Ga0157375_104131551 294
304 3300013308 Ga0157375_10591881 Ga0157375_105918812 294
305 3300014325 Ga0163163_10000134 Ga0163163_100001348 294
306 3300014325 Ga0163163_10023286 Ga0163163_100232863 294
307 3300014325 Ga0163163_10038278 Ga0163163_100382781 294
308 3300014325 Ga0163163_10110146 Ga0163163_101101462 294
309 3300014325 Ga0163163_10187729 Ga0163163_101877291 294
310 3300014325 Ga0163163_10250146 Ga0163163_102501463 294
311 3300014325 Ga0163163_10400448 Ga0163163_104004482 294
312 3300014326 Ga0157380_10056749 Ga0157380_100567493 294
313 3300014326 Ga0157380_10348742 Ga0157380_103487422 294
314 3300014968 Ga0157379_10269428 Ga0157379_102694282 294
315 3300014968 Ga0157379_10360155 Ga0157379_103601552 294
316 3300014968 Ga0157379_10442694 Ga0157379_104426941 294
317 3300014969 Ga0157376_10004167 Ga0157376_100041673 294
318 3300014969 Ga0157376_10080409 Ga0157376_100804093 294
319 3300014969 Ga0157376_10442449 Ga0157376_104424491 294
320 3300021361 Ga0213872_10001118 Ga0213872_1000111814 294
321 3300021377 Ga0213874_10054956 Ga0213874_100549562 294
322 3300021384 Ga0213876_10005305 Ga0213876_100053053 294
323 3300021388 Ga0213875_10000002 Ga0213875_1000000227 294
324 3300021388 Ga0213875_10013064 Ga0213875_100130642 294
325 3300021388 Ga0213875_10022029 Ga0213875_100220292 294
326 3300021388 Ga0213875_10049624 Ga0213875_100496242 294
327 3300025900 Ga0207710_10124212 Ga0207710_101242122 294
328 3300025903 Ga0207680_10005017 Ga0207680_100050172 294
329 3300025903 Ga0207680_10171259 Ga0207680_101712592 294
330 3300025906 Ga0207699_10221154 Ga0207699_102211541 294
331 3300025906 Ga0207699_10295335 Ga0207699_102953351 294
332 3300025907 Ga0207645_10061669 Ga0207645_100616693 294
333 3300025909 Ga0207705_10096703 Ga0207705_100967033 294
334 3300025909 Ga0207705_10117404 Ga0207705_101174043 294
335 3300025911 Ga0207654_10002103 Ga0207654_100021034 294
336 3300025911 Ga0207654_10012829 Ga0207654_100128291 294
337 3300025911 Ga0207654_10015126 Ga0207654_100151263 294
338 3300025911 Ga0207654_10042271 Ga0207654_100422712 294
339 3300025911 Ga0207654_10123534 Ga0207654_101235342 294
340 3300025911 Ga0207654_10230952 Ga0207654_102309521 294
341 3300025911 Ga0207654_10317753 Ga0207654_103177531 294
342 3300025912 Ga0207707_10002717 Ga0207707_1000271713 294
343 3300025912 Ga0207707_10004495 Ga0207707_100044956 294
344 3300025912 Ga0207707_10131025 Ga0207707_101310252 294
345 3300025912 Ga0207707_10171437 Ga0207707_101714372 294
346 3300025912 Ga0207707_10189991 Ga0207707_101899912 294
347 3300025912 Ga0207707_10221541 Ga0207707_102215412 294
348 3300025913 Ga0207695_10002192 Ga0207695_1000219215 294
349 3300025913 Ga0207695_10003003 Ga0207695_100030032 294
350 3300025913 Ga0207695_10003666 Ga0207695_1000366618 294
351 3300025913 Ga0207695_10013398 Ga0207695_100133986 294
352 3300025913 Ga0207695_10022587 Ga0207695_100225876 294
353 3300025913 Ga0207695_10068023 Ga0207695_100680235 294
354 3300025913 Ga0207695_10073747 Ga0207695_100737472 294
355 3300025913 Ga0207695_10302113 Ga0207695_103021131 294
356 3300025913 Ga0207695_10351049 Ga0207695_103510491 294
357 3300025913 Ga0207695_10539223 Ga0207695_105392231 294
358 3300025914 Ga0207671_10004955 Ga0207671_1000495512 294
359 3300025914 Ga0207671_10033998 Ga0207671_100339982 294
360 3300025914 Ga0207671_10065230 Ga0207671_100652303 294
361 3300025914 Ga0207671_10072450 Ga0207671_100724503 294
362 3300025914 Ga0207671_10106904 Ga0207671_101069043 294
363 3300025914 Ga0207671_10162569 Ga0207671_101625691 294
364 3300025914 Ga0207671_10338395 Ga0207671_103383951 294
365 3300025915 Ga0207693_10046663 Ga0207693_100466633 294
366 3300025916 Ga0207663_10024932 Ga0207663_100249323 294
367 3300025916 Ga0207663_10041675 Ga0207663_100416752 294
368 3300025916 Ga0207663_10106456 Ga0207663_101064562 294
369 3300025916 Ga0207663_10234007 Ga0207663_102340072 294
370 3300025916 Ga0207663_10368999 Ga0207663_103689991 294
371 3300025917 Ga0207660_10080437 Ga0207660_100804372 294
372 3300025917 Ga0207660_10088407 Ga0207660_100884072 294
373 3300025917 Ga0207660_10221286 Ga0207660_102212861 294
374 3300025917 Ga0207660_10406466 Ga0207660_104064661 294
375 3300025918 Ga0207662_10368967 Ga0207662_103689671 294
376 3300025919 Ga0207657_10045424 Ga0207657_100454243 294
377 3300025919 Ga0207657_10073910 Ga0207657_100739102 294
378 3300025919 Ga0207657_10173964 Ga0207657_101739642 294
379 3300025920 Ga0207649_10040324 Ga0207649_100403241 294
380 3300025920 Ga0207649_10108707 Ga0207649_101087072 294
381 3300025921 Ga0207652_10001801 Ga0207652_1000180116 294
382 3300025924 Ga0207694_10003089 Ga0207694_1000308913 294
383 3300025924 Ga0207694_10004347 Ga0207694_100043474 294
384 3300025924 Ga0207694_10006916 Ga0207694_100069169 294
385 3300025924 Ga0207694_10011443 Ga0207694_100114435 294
386 3300025924 Ga0207694_10059591 Ga0207694_100595912 294
387 3300025924 Ga0207694_10175149 Ga0207694_101751491 294
388 3300025924 Ga0207694_10270690 Ga0207694_102706902 294
389 3300025927 Ga0207687_10002645 Ga0207687_1000264512 294
390 3300025927 Ga0207687_10008818 Ga0207687_100088188 294
391 3300025927 Ga0207687_10014193 Ga0207687_100141934 294
392 3300025927 Ga0207687_10103311 Ga0207687_101033112 294
393 3300025927 Ga0207687_10469983 Ga0207687_104699831 294
394 3300025927 Ga0207687_10570909 Ga0207687_105709091 294
395 3300025928 Ga0207700_10120764 Ga0207700_101207643 294
396 3300025928 Ga0207700_10132296 Ga0207700_101322961 294
397 3300025928 Ga0207700_10212239 Ga0207700_102122392 294
398 3300025929 Ga0207664_10003958 Ga0207664_100039583 294
399 3300025929 Ga0207664_10066895 Ga0207664_100668952 294
400 3300025931 Ga0207644_10027535 Ga0207644_100275354 294
401 3300025931 Ga0207644_10374041 Ga0207644_103740411 294
402 3300025933 Ga0207706_10057352 Ga0207706_100573524 294
403 3300025934 Ga0207686_10023433 Ga0207686_100234333 294
404 3300025934 Ga0207686_10029010 Ga0207686_100290102 294
405 3300025934 Ga0207686_10154251 Ga0207686_101542512 294
406 3300025934 Ga0207686_10222716 Ga0207686_102227162 294
407 3300025938 Ga0207704_10012304 Ga0207704_100123043 294
408 3300025938 Ga0207704_10080995 Ga0207704_100809952 294
409 3300025940 Ga0207691_10250013 Ga0207691_102500132 294
410 3300025941 Ga0207711_10001276 Ga0207711_1000127618 294
411 3300025941 Ga0207711_10031573 Ga0207711_100315734 294
412 3300025941 Ga0207711_10059986 Ga0207711_100599863 294
413 3300025941 Ga0207711_10302391 Ga0207711_103023912 294
414 3300025942 Ga0207689_10061765 Ga0207689_100617653 294
415 3300025942 Ga0207689_10264612 Ga0207689_102646122 294
416 3300025944 Ga0207661_10000008 Ga0207661_10000008218 294
417 3300025944 Ga0207661_10004308 Ga0207661_1000430810 294
418 3300025944 Ga0207661_10263666 Ga0207661_102636662 294
419 3300025945 Ga0207679_10174093 Ga0207679_101740932 294
420 3300025945 Ga0207679_10199707 Ga0207679_101997072 294
421 3300025949 Ga0207667_10005708 Ga0207667_100057083 294
422 3300025949 Ga0207667_10006005 Ga0207667_1000600510 294
423 3300025949 Ga0207667_10016739 Ga0207667_100167396 294
424 3300025949 Ga0207667_10017798 Ga0207667_100177982 294
425 3300025949 Ga0207667_10025374 Ga0207667_100253743 294
426 3300025949 Ga0207667_10052037 Ga0207667_100520372 294
427 3300025949 Ga0207667_10238675 Ga0207667_102386752 294
428 3300025949 Ga0207667_10319842 Ga0207667_103198422 294
429 3300025949 Ga0207667_10329228 Ga0207667_103292281 294
430 3300025949 Ga0207667_10787819 Ga0207667_107878191 294
431 3300025960 Ga0207651_10097837 Ga0207651_100978372 294
432 3300025961 Ga0207712_10027513 Ga0207712_100275131 294
433 3300025961 Ga0207712_10129888 Ga0207712_101298883 294
434 3300025981 Ga0207640_10175259 Ga0207640_101752592 294
435 3300026023 Ga0207677_10145343 Ga0207677_101453433 294
436 3300026023 Ga0207677_10155288 Ga0207677_101552882 294
437 3300026035 Ga0207703_10027702 Ga0207703_100277024 294
438 3300026035 Ga0207703_10068868 Ga0207703_100688682 294
439 3300026041 Ga0207639_10029023 Ga0207639_100290232 294
440 3300026041 Ga0207639_10041913 Ga0207639_100419134 294
441 3300026041 Ga0207639_10058306 Ga0207639_100583063 294
442 3300026041 Ga0207639_10393532 Ga0207639_103935321 294
443 3300026067 Ga0207678_10040173 Ga0207678_100401731 294
444 3300026078 Ga0207702_10010815 Ga0207702_100108156 294
445 3300026078 Ga0207702_10019879 Ga0207702_100198795 294
446 3300026078 Ga0207702_10035328 Ga0207702_100353285 294
447 3300026078 Ga0207702_10076619 Ga0207702_100766194 294
448 3300026078 Ga0207702_10099210 Ga0207702_100992104 294
449 3300026078 Ga0207702_10127549 Ga0207702_101275492 294
450 3300026078 Ga0207702_10217551 Ga0207702_102175512 294
451 3300026078 Ga0207702_10405241 Ga0207702_104052412 294
452 3300026078 Ga0207702_10507232 Ga0207702_105072322 294
453 3300026088 Ga0207641_10028899 Ga0207641_100288993 294
454 3300026088 Ga0207641_10345677 Ga0207641_103456771 294
455 3300026088 Ga0207641_10522198 Ga0207641_105221982 294
456 3300026089 Ga0207648_10054929 Ga0207648_100549294 294
457 3300026089 Ga0207648_10700259 Ga0207648_107002591 294
458 3300026116 Ga0207674_10000300 Ga0207674_1000030023 294
459 3300026116 Ga0207674_10002626 Ga0207674_100026264 294
460 3300026116 Ga0207674_10003738 Ga0207674_100037385 294
461 3300026116 Ga0207674_10125874 Ga0207674_101258743 294
462 3300026116 Ga0207674_10132882 Ga0207674_101328823 294
463 3300026116 Ga0207674_10166575 Ga0207674_101665752 294
464 3300026116 Ga0207674_10567598 Ga0207674_105675981 294
465 3300026142 Ga0207698_10096422 Ga0207698_100964223 294
466 3300026142 Ga0207698_10406672 Ga0207698_104066721 294
467 3300028379 Ga0268266_10082747 Ga0268266_100827473 294
468 3300028379 Ga0268266_10206487 Ga0268266_102064872 294
469 3300028381 Ga0268264_10044237 Ga0268264_100442373 294
470 3300028381 Ga0268264_10128194 Ga0268264_101281942 294
471 3300028381 Ga0268264_10341417 Ga0268264_103414172 294
472 3300028381 Ga0268264_10365122 Ga0268264_103651222 294
473 3300028666 Ga0265336_10018772 Ga0265336_100187721 294
474 3300028800 Ga0265338_10084456 Ga0265338_100844563 294
475 3300031238 Ga0265332_10014399 Ga0265332_100143992 294
476 3300031238 Ga0265332_10029721 Ga0265332_100297212 294
477 3300031240 Ga0265320_10015146 Ga0265320_100151464 294
478 3300031241 Ga0265325_10000825 Ga0265325_1000082514 294
479 3300031241 Ga0265325_10045341 Ga0265325_100453411 294
480 3300031247 Ga0265340_10008185 Ga0265340_100081856 294
481 3300031250 Ga0265331_10043088 Ga0265331_100430881 294
482 3300031344 Ga0265316_10000602 Ga0265316_1000060225 294
483 3300031344 Ga0265316_10007613 Ga0265316_100076134 294
484 3300031344 Ga0265316_10026066 Ga0265316_100260665 294
485 3300031344 Ga0265316_10066091 Ga0265316_100660912 294
486 3300031344 Ga0265316_10115093 Ga0265316_101150934 294
487 3300031344 Ga0265316_10338629 Ga0265316_103386291 294
488 3300031595 Ga0265313_10081514 Ga0265313_100815142 294
489 3300031711 Ga0265314_10001370 Ga0265314_100013709 294
490 3300031711 Ga0265314_10089931 Ga0265314_100899313 294
491 3300031711 Ga0265314_10121116 Ga0265314_101211162 294
492 3300031711 Ga0265314_10136026 Ga0265314_101360262 294
493 3300031712 Ga0265342_10091894 Ga0265342_100918943 294
494 3300035083 Ga0373926_0033761 Ga0373926_0033761_507_1391 294
495 3300035086 Ga0373934_0001407 Ga0373934_0001407_1740_2624 294
496 3300035111 Ga0373923_0113053 Ga0373923_0113053_312_1196 294
497 3300035111 Ga0373923_0161598 Ga0373923_0161598_36_926 294
498 3300035118 Ga0373954_0014223 Ga0373954_0014223_1326_2210 294
499 3300035118 Ga0373954_0027116 Ga0373954_0027116_158_1042 294
500 3300035119 Ga0373956_0107010 Ga0373956_0107010_58_942 294
501 3300035120 Ga0373957_0042118 Ga0373957_0042118_188_1072 294
502 3300035172 Ga0373955_0202519 Ga0373955_0202519_49_933 294
503 3300035692 Ga0373935_0033838 Ga0373935_0033838_2094_3038 294
504 3300035692 Ga0373935_0097891 Ga0373935_0097891_871_1755 294
505 3300035692 Ga0373935_0154645 Ga0373935_0154645_361_1245 294
506 3300035695 Ga0373927_0002301 Ga0373927_0002301_489_1373 294
507 3300035695 Ga0373927_0003249 Ga0373927_0003249_3732_4616 294
508 3300035695 Ga0373927_0184075 Ga0373927_0184075_463_1347 294
509 3300035724 Ga0373933_0040306 Ga0373933_0040306_1136_2020 294
510 3300035725 Ga0373947_0001408 Ga0373947_0001408_1424_2308 294
511 3300035725 Ga0373947_0014552 Ga0373947_0014552_477_1361 294
512 3300035725 Ga0373947_0044627 Ga0373947_0044627_1733_2617 294
513 3300035725 Ga0373947_0055565 Ga0373947_0055565_289_1233 294
514 3300036401 Ga0373937_0032111 Ga0373937_0032111_3748_4632 294
515 3300036401 Ga0373937_0062436 Ga0373937_0062436_431_1315 294
516 3300036401 Ga0373937_0083864 Ga0373937_0083864_1101_1985 294
517 3300036401 Ga0373937_0136913 Ga0373937_0136913_987_1871 294
518 3300036401 Ga0373937_0137979 Ga0373937_0137979_939_1832 294
519 3300037068 Ga0373925_0000378 Ga0373925_0000378_27813_28697 294
520 3300037068 Ga0373925_0003480 Ga0373925_0003480_6658_7542 294
521 3300037068 Ga0373925_0006245 Ga0373925_0006245_2209_3093 294
522 3300037068 Ga0373925_0143866 Ga0373925_0143866_850_1734 294
523 3300037068 Ga0373925_0167527 Ga0373925_0167527_598_1482 294
524 3300037853 Ga0436364_0035509 Ga0436364_0035509_2515_3402 294
525 3300037853 Ga0436364_0362933 Ga0436364_0362933_2470_3357 294
526 3300037853 Ga0436364_0612043 Ga0436364_0612043_26263_27156 294
527 3300037853 Ga0436364_0622297 Ga0436364_0622297_2999_3883 294
528 3300037853 Ga0436364_0648475 Ga0436364_0648475_562_1446 294
529 3300037853 Ga0436364_0756434 Ga0436364_0756434_899_1786 294
530 3300037853 Ga0436364_0866914 Ga0436364_0866914_934_1833 294
531 3300037853 Ga0436364_0992705 Ga0436364_0992705_5603_6487 294
532 3300037853 Ga0436364_1281089 Ga0436364_1281089_1241_2128 294
533 3300037853 Ga0436364_1435313 Ga0436364_1435313_661_1563 294
534 3300037853 Ga0436364_1514273 Ga0436364_1514273_2920_3825 294
535 3300038443 Ga0395901_0727805 Ga0395901_0727805_20_904 294
536 3300039437 Ga0436365_0158787 Ga0436365_0158787_3164_4051 294
537 3300039437 Ga0436365_1200822 Ga0436365_1200822_9751_10635 294
538 3300039437 Ga0436365_1637806 Ga0436365_1637806_1327_2211 294
539 3300039438 Ga0436360_0581083 Ga0436360_0581083_729_1616 294
540 3300039438 Ga0436360_0589158 Ga0436360_0589158_411_1295 294
541 3300039447 Ga0436361_0510126 Ga0436361_0510126_12971_13855 294
542 3300039450 Ga0436363_0293846 Ga0436363_0293846_1316_2203 294
543 3300039450 Ga0436363_0715765 Ga0436363_0715765_401_1285 294
544 3300039453 Ga0436362_1115434 Ga0436362_1115434_545_1432 294
545 3300044684 Ga0466966_0045548 Ga0466966_0045548_1770_2654 294
546 3300044694 Ga0466963_0418556 Ga0466963_0418556_24_908 294
547 3300045049 Ga0466959_0239771 Ga0466959_0239771_326_1210 294
548 3300045051 Ga0451576_0462789 Ga0451576_0462789_349_1236 294
549 3300045836 Ga0466958_0230756 Ga0466958_0230756_64_948 294
550 3300045976 Ga0466967_0110332 Ga0466967_0110332_587_1471 294
551 3300045976 Ga0466967_0374964 Ga0466967_0374964_232_1119 294
552 3300046454 Ga0495592_0028742 Ga0495592_0028742_1088_1972 294
553 3300046454 Ga0495592_0321929 Ga0495592_0321929_78_962 294
554 3300046462 Ga0495651_0006480 Ga0495651_0006480_2596_3480 294
555 3300046462 Ga0495651_0199153 Ga0495651_0199153_419_1303 294
556 3300046463 Ga0495653_0032054 Ga0495653_0032054_3220_4104 294
557 3300046472 Ga0495580_0003381 Ga0495580_0003381_7082_7966 294
558 3300046472 Ga0495580_0008927 Ga0495580_0008927_6876_7760 294
559 3300046472 Ga0495580_0067820 Ga0495580_0067820_71_955 294
560 3300046472 Ga0495580_0069439 Ga0495580_0069439_369_1262 294
561 3300046472 Ga0495580_0079124 Ga0495580_0079124_110_994 294
562 3300046472 Ga0495580_0162112 Ga0495580_0162112_94_978 294
563 3300046472 Ga0495580_0188813 Ga0495580_0188813_71_955 294
564 3300046472 Ga0495580_0235381 Ga0495580_0235381_91_975 294
565 3300046473 Ga0495582_0004709 Ga0495582_0004709_2251_3135 294
566 3300046473 Ga0495582_0068804 Ga0495582_0068804_913_1797 294
567 3300046473 Ga0495582_0159818 Ga0495582_0159818_113_997 294
568 3300046476 Ga0495662_0003213 Ga0495662_0003213_4673_5557 294
569 3300046477 Ga0495664_0043667 Ga0495664_0043667_727_1611 294
570 3300046499 Ga0495594_0045738 Ga0495594_0045738_349_1233 294
571 3300046499 Ga0495594_0172599 Ga0495594_0172599_95_979 294
572 3300046511 Ga0495608_0077294 Ga0495608_0077294_59_943 294
573 3300046511 Ga0495608_0079514 Ga0495608_0079514_1230_2114 294
574 3300046516 Ga0495628_0048471 Ga0495628_0048471_2336_3220 294
575 3300046517 Ga0495630_0017827 Ga0495630_0017827_4236_5120 294
576 3300046526 Ga0495666_0153524 Ga0495666_0153524_110_994 294
577 3300046529 Ga0495652_0021534 Ga0495652_0021534_2335_3219 294
578 3300046531 Ga0495665_0025185 Ga0495665_0025185_1423_2307 294
579 3300046531 Ga0495665_0075702 Ga0495665_0075702_620_1504 294
580 3300046533 Ga0495640_0114869 Ga0495640_0114869_321_1205 294
581 3300046536 Ga0495587_0069620 Ga0495587_0069620_933_1817 294
582 3300046536 Ga0495587_0072854 Ga0495587_0072854_337_1221 294
583 3300046536 Ga0495587_0170543 Ga0495587_0170543_177_1061 294
584 3300046543 Ga0495645_0007860 Ga0495645_0007860_2801_3685 294
585 3300046543 Ga0495645_0300861 Ga0495645_0300861_140_1024 294
586 3300046559 Ga0495667_0007870 Ga0495667_0007870_3799_4683 294
587 3300046559 Ga0495667_0228185 Ga0495667_0228185_290_1174 294
588 3300046642 Ga0495634_0015888 Ga0495634_0015888_1903_2787 294
589 3300046642 Ga0495634_0106113 Ga0495634_0106113_61_945 294
590 3300046663 Ga0495635_0094331 Ga0495635_0094331_193_1077 294
591 3300046663 Ga0495635_0166924 Ga0495635_0166924_147_1031 294
592 3300046663 Ga0495635_0223292 Ga0495635_0223292_175_1068 294
593 3300046678 Ga0495599_0064056 Ga0495599_0064056_309_1193 294
594 3300046679 Ga0495623_0045580 Ga0495623_0045580_922_1806 294
595 3300046683 Ga0495658_0074771 Ga0495658_0074771_411_1295 294
596 3300046683 Ga0495658_0152618 Ga0495658_0152618_90_1034 294
597 3300046689 Ga0495613_0019989 Ga0495613_0019989_3096_3980 294
598 3300046689 Ga0495613_0051160 Ga0495613_0051160_67_951 294
599 3300046689 Ga0495613_0155252 Ga0495613_0155252_459_1343 294
600 3300047319 Ga0495674_0016845 Ga0495674_0016845_4345_5229 294
601 3300047319 Ga0495674_0034074 Ga0495674_0034074_3288_4181 294
602 3300047319 Ga0495674_0045799 Ga0495674_0045799_2768_3652 294
603 3300047319 Ga0495674_0143343 Ga0495674_0143343_351_1244 294
604 3300047319 Ga0495674_0195104 Ga0495674_0195104_766_1650 294
605 3300047322 Ga0495680_0008013 Ga0495680_0008013_4932_5816 294
606 3300047322 Ga0495680_0259121 Ga0495680_0259121_105_989 294
607 3300047322 Ga0495680_0401543 Ga0495680_0401543_40_924 294
608 3300047471 Ga0495684_0015364 Ga0495684_0015364_2814_3698 294
609 3300047471 Ga0495684_0053527 Ga0495684_0053527_1736_2620 294
610 3300047673 Ga0495593_0133090 Ga0495593_0133090_295_1179 294
611 3300048088 Ga0495602_0018093 Ga0495602_0018093_1284_2168 294
612 3300048903 Ga0496100_0361467 Ga0496100_0361467_170_1054 294
613 3300048905 Ga0496102_0267405 Ga0496102_0267405_393_1277 294
614 3300048907 Ga0496104_0516043 Ga0496104_0516043_132_1016 294
615 3300048909 Ga0496106_0299299 Ga0496106_0299299_221_1105 294
616 3300048915 Ga0496112_0026195 Ga0496112_0026195_1094_1984 294
617 3300048918 Ga0496115_0008018 Ga0496115_0008018_2741_3631 294
618 3300048918 Ga0496115_0143296 Ga0496115_0143296_783_1667 294
619 3300048929 Ga0496126_0068125 Ga0496126_0068125_1694_2578 294
620 3300049568 Ga0501031_0023494 Ga0501031_0023494_255_1142 294
621 3300049569 Ga0501032_0001165 Ga0501032_0001165_16858_17745 294
622 3300049569 Ga0501032_0067914 Ga0501032_0067914_589_1482 294
623 3300049571 Ga0501034_0014757 Ga0501034_0014757_923_1810 294
624 3300049571 Ga0501034_0017376 Ga0501034_0017376_2597_3490 294
625 3300049571 Ga0501034_0169336 Ga0501034_0169336_881_1765 294
626 3300049572 Ga0501036_0007493 Ga0501036_0007493_1782_2669 294
627 3300049573 Ga0501037_0168254 Ga0501037_0168254_552_1439 294
628 3300049574 Ga0501038_0014476 Ga0501038_0014476_197_1084 294
629 3300049575 Ga0501039_0008248 Ga0501039_0008248_1815_2702 294
630 3300049579 Ga0501043_0004312 Ga0501043_0004312_1808_2695 294
631 3300049580 Ga0501046_0002931 Ga0501046_0002931_14340_15227 294
632 3300049580 Ga0501046_0066720 Ga0501046_0066720_779_1672 294
633 3300049581 Ga0501047_0008796 Ga0501047_0008796_6730_7617 294
634 3300049581 Ga0501047_0060307 Ga0501047_0060307_2144_3037 294
635 3300049581 Ga0501047_0244580 Ga0501047_0244580_707_1591 294
636 3300049583 Ga0501067_0000907 Ga0501067_0000907_7107_7994 294
637 3300049584 Ga0501068_0001120 Ga0501068_0001120_9414_10301 294
638 3300049585 Ga0501069_0007271 Ga0501069_0007271_1674_2561 294
639 3300049586 Ga0501070_0197493 Ga0501070_0197493_243_1136 294
640 3300049589 Ga0501073_0000471 Ga0501073_0000471_6104_6991 294
641 3300049589 Ga0501073_0054455 Ga0501073_0054455_1489_2382 294
642 3300049590 Ga0501074_0017378 Ga0501074_0017378_831_1718 294
643 3300049592 Ga0501076_0060938 Ga0501076_0060938_307_1194 294
644 3300049593 Ga0501077_0005967 Ga0501077_0005967_341_1228 294
645 3300049741 Ga0501079_0005210 Ga0501079_0005210_5213_6100 294
646 3300049742 Ga0501080_0000006 Ga0501080_0000006_70567_71454 294
647 3300049744 Ga0501083_0025741 Ga0501083_0025741_1782_2669 294
648 3300049822 Ga0501035_0089298 Ga0501035_0089298_1404_2291 294
649 3300049822 Ga0501035_0135646 Ga0501035_0135646_955_1848 294
650 3300049823 Ga0501044_0000814 Ga0501044_0000814_15962_16846 294
651 3300049823 Ga0501044_0012973 Ga0501044_0012973_5079_5963 294
652 3300049823 Ga0501044_0017662 Ga0501044_0017662_5842_6729 294
653 3300049823 Ga0501044_0079518 Ga0501044_0079518_1958_2851 294
654 3300049823 Ga0501044_0267766 Ga0501044_0267766_270_1154 294
655 3300050507 nmdc:mga05p37_130646_c1 nmdc:mga05p37_130646_c1_855_1739 294
656 3300050507 nmdc:mga05p37_180709_c1 nmdc:mga05p37_180709_c1_564_1448 294
657 3300050507 nmdc:mga05p37_294780_c1 nmdc:mga05p37_294780_c1_23_907 294
658 3300050510 nmdc:mga06r32_52589_c1 nmdc:mga06r32_52589_c1_2733_3617 294
659 3300050514 nmdc:mga08x19_974_c1 nmdc:mga08x19_974_c1_7906_8790 294
660 3300053139 Ga0500568_0000650 Ga0500568_0000650_18817_19701 294
661 3300054114 Ga0501084_0000747 Ga0501084_0000747_14678_15565 294
662 3300060353 Ga0501082_0000311 Ga0501082_0000311_14390_15274 294
663 3300060353 Ga0501082_0016943 Ga0501082_0016943_1404_2291 294
664 3300005327 Ga0070658_10009820 Ga0070658_100098203 295
665 3300005458 Ga0070681_10009639 Ga0070681_100096394 295
666 3300005563 Ga0068855_100005049 Ga0068855_1000050494 295
667 3300005614 Ga0068856_100051889 Ga0068856_1000518894 295
668 3300005614 Ga0068856_100246707 Ga0068856_1002467072 295
669 3300005616 Ga0068852_100303515 Ga0068852_1003035152 295
670 3300009093 Ga0105240_10002947 Ga0105240_1000294719 295
671 3300009093 Ga0105240_10402282 Ga0105240_104022821 295
672 3300010375 Ga0105239_10913989 Ga0105239_109139891 295
673 3300013104 Ga0157370_10001524 Ga0157370_100015241 295
674 3300013105 Ga0157369_10012635 Ga0157369_100126355 295
675 3300013296 Ga0157374_10363619 Ga0157374_103636192 295
676 3300025912 Ga0207707_10014579 Ga0207707_100145796 295
677 3300025949 Ga0207667_10231227 Ga0207667_102312272 295
678 3300026078 Ga0207702_10127375 Ga0207702_101273753 295
679 3300037853 Ga0436364_0628087 Ga0436364_0628087_211_1098 295

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00483

NTP_transferase

Nucleotidyl transferase

1

246

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
5i1f-assembly1.cif.gz_A-2 crystal structure of utp-glucose-1-phosphate uridylyltransferase from burkholderia vietnamiensis in complex with uridine-5'-diphosphate-glucose 0.8973 4 292
5j49-assembly1.cif.gz_A crystal structure of udp-glucose pyrophosporylase / utp-glucose-1-phosphate uridylyltransferase from burkholderia xenovorans 0.8961 5 291
3juk-assembly1.cif.gz_D the crystal structure of udp-glucose pyrophosphorylase complexed with udp-glucose 0.8826 5 279
5ve7-assembly1.cif.gz_A crystal structure of utp-glucose-1-phosphate uridylyltransferase from burkholderia ambifaria in complex with utp 0.881 5 293
3juk-assembly1.cif.gz_B the crystal structure of udp-glucose pyrophosphorylase complexed with udp-glucose 0.8804 5 279
ID Description Score Start End Superfamily
af_Q58730_1_282_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8941 5 292 3.90.550.10
3jukA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8844 5 275 3.90.550.10
af_Q58730_1_282_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8792 5 292 3.90.550.10
af_Q2G1T6_1_286_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8766 5 293 3.90.550.10
af_Q2G1T6_1_286_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8681 5 293 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A3D4LJV5-F1-model_v4 UTP--glucose-1-phosphate uridylyltransferase (EC 2.7.7.9) 0.9858 107 265 GO:0003983
GO:0006011
GO:0009058
AF-A0A3B8P012-F1-model_v4 UTP--glucose-1-phosphate uridylyltransferase (EC 2.7.7.9) 0.9809 119 294 GO:0003983
GO:0006011
GO:0009058
AF-I3RCX6-F1-model_v4 UTP--glucose-1-phosphate uridylyltransferase (EC 2.7.7.9) 0.9807 99 291 GO:0003983
GO:0006011
GO:0009058
AF-T0XS77-F1-model_v4 UTP--glucose-1-phosphate uridylyltransferase (EC 2.7.7.9) 0.9806 100 292 GO:0003983
GO:0006011
GO:0009058
AF-T0E8M6-F1-model_v4 deleted 0.9793 99 292

Feature Viewer

pLDDT pTM Quality
82.43 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map