F474597

General Info

Members Datasets Scaffolds Average Seq Length
677 395 1354 103

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_1551602|Ga0466967_1551602_288_635
Length 115
Sequence MRRLSQEVPMAQTMRPNAAGNGLFATDGKPHPLQDTLLLVTLVLGLTAFVTGLTAPGLHLLSSWAGLVGIITGAYGQWISVTTRQRFGLILGLGASAIGFFLGMWHGGPFGGVVG

Samples

Sample ID Description Type Environment
1 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003559 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
11 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
12 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
13 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
33 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
34 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
35 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
36 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
37 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
38 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
39 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
40 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
41 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
51 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
56 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
57 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
58 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
59 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
60 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
61 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
62 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
66 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
68 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
89 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
92 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
93 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
94 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
95 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
96 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
97 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
98 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
99 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
100 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
101 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
102 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
103 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
104 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
105 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
106 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
107 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
108 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
109 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
110 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
111 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
112 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
113 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
114 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
115 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
116 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
117 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
118 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
119 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
120 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
121 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
122 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
123 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
124 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
125 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
126 3300041510 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaT Metatranscriptome Unclassified
127 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
128 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
129 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
130 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
131 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
132 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
133 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
134 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
135 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
136 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
137 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
138 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
139 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
140 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
141 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
142 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
143 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
144 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
145 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
146 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
147 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
148 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
149 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
150 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
151 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
152 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
153 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
154 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
155 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
156 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
157 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
158 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
159 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
160 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
161 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
162 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
163 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
164 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
165 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
166 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
167 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
168 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
169 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
170 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
171 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
172 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
173 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
174 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
175 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
176 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
177 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
178 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
179 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
180 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
181 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
182 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
183 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
184 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
185 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
186 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
187 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
188 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
189 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
190 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
191 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
192 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
193 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
194 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
195 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
196 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
197 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
198 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
199 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
200 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
201 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
202 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
203 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
204 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
205 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
206 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
207 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
208 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
209 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
210 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
211 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
212 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
213 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
214 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
215 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
216 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
217 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
218 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
219 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
220 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
221 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
222 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
223 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
224 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
225 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
226 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
227 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
228 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
229 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
230 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
231 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
232 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
233 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
234 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
235 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
236 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
237 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
238 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
239 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
240 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
241 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
242 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
243 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
244 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
245 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
246 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
247 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
248 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
249 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
250 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
251 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
265 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
266 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
267 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
268 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
269 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
270 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
271 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
272 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
273 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
276 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
277 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
278 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
279 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
280 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
281 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
282 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
283 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
284 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
285 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
286 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
287 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
288 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
289 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
290 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
291 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
292 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
293 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
294 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
295 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
296 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
297 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
298 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
299 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
300 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
301 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
302 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
303 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
304 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
305 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
306 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
307 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
308 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
309 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
310 3300053152 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 endosphere Metagenome Endosphere
311 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
312 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
313 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
314 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
315 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
316 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
317 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
318 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
319 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
320 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
321 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
322 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
323 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
324 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
325 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
326 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
327 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
328 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
329 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
330 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
331 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
332 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
333 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
334 2643221548 Streptomyces sp. Root55 Isolate Unclassified
335 2643221578 Streptomyces sp. Root63 Isolate Unclassified
336 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
337 2643221647 Streptomyces sp. Root369 Isolate Unclassified
338 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
339 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
340 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
341 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
342 2643221714 Streptomyces sp. Root264 Isolate Unclassified
343 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
344 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
345 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
346 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
347 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
348 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
349 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
350 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
351 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
352 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
353 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
354 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
355 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
356 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
357 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
358 2862574272 Streptomyces sp. AcE210 Isolate Nodule
359 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
360 2867428634 Streptomyces sp. RP5T Isolate Unclassified
361 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
362 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
363 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
364 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
365 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
366 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
367 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
368 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
369 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
370 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
371 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
372 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
373 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
374 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
375 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
376 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
377 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
378 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
379 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
380 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
381 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
382 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
383 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
384 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
385 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
386 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
387 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
388 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
389 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
390 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
391 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
392 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
393 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
394 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
395 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.52
Metatranscriptomes 4.28
Isolates 10.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.31
Nodule 0.59
Rhizoplane 1.92
Rhizosphere 77.4
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466967_1551602 3300045976 Bacteria 659
2 JGI24739J22299_10040041 3300001989 Bacteria 1566
3 JGI24737J22298_10035020 3300001990 Bacteria 1555
4 JGI24738J21930_10009499 3300002075 Bacteria 2187
5 JGI25153J46596_10053388 3300003215 Bacteria 1144
6 Ga0006777J48905_1097507 3300003308 Bacteria 504
7 rootH1_10023704 3300003316 Bacteria 2751
8 rootH1_10074419 3300003316 Bacteria 1436
9 rootH2_10036711 3300003320 Bacteria 5426
10 rootH1_10008667 3300003323 Bacteria 1476
11 Ga0007427J51700_117942 3300003559 Bacteria 500
12 Ga0006562J51391_1050510 3300003578 Bacteria 1270
13 Ga0006562J51391_1078574 3300003578 Bacteria 590
14 Ga0006562J51391_1161500 3300003578 Bacteria 516
15 Ga0007429J51699_1078522 3300003579 Bacteria 1297
16 Ga0058861_10907449 3300004800 Bacteria 593
17 Ga0070676_10135513 3300005328 Bacteria 1562
18 Ga0070668_101224039 3300005347 Bacteria 681
19 Ga0070669_100198939 3300005353 Bacteria 1576
20 Ga0070659_101275005 3300005366 Bacteria 651
21 Ga0070667_101420940 3300005367 Bacteria 651
22 Ga0070663_101104995 3300005455 Bacteria 693
23 Ga0070678_100649841 3300005456 Bacteria 946
24 Ga0070681_10443465 3300005458 Bacteria 1210
25 Ga0068853_101992381 3300005539 Bacteria 563
26 Ga0070665_102141056 3300005548 Bacteria 563
27 Ga0070665_102155029 3300005548 Bacteria 562
28 Ga0068855_100764261 3300005563 Bacteria 1029
29 Ga0070664_100480927 3300005564 Bacteria 1143
30 Ga0068857_101332708 3300005577 Bacteria 697
31 Ga0068857_102256143 3300005577 Bacteria 534
32 Ga0068856_100193503 3300005614 Bacteria 2048
33 Ga0068864_100556769 3300005618 Bacteria 1109
34 Ga0068861_100480894 3300005719 Bacteria 1119
35 Ga0068860_102257129 3300005843 Bacteria 565
36 Ga0081455_10015051 3300005937 Bacteria 7533
37 Ga0075365_10139079 3300006038 Bacteria 1685
38 Ga0075368_10039407 3300006042 Bacteria 1852
39 Ga0075363_100788086 3300006048 Bacteria 577
40 Ga0075363_101002521 3300006048 Bacteria 515
41 Ga0070715_11074375 3300006163 Bacteria 505
42 Ga0075367_10000116 3300006178 Bacteria 22957
43 Ga0075370_10384015 3300006353 Bacteria 841
44 Ga0099826_10058003 3300006948 Bacteria 2542
45 Ga0105251_10614824 3300009011 Bacteria 517
46 Ga0105244_10107324 3300009036 Bacteria 1361
47 Ga0105250_10255700 3300009092 Bacteria 749
48 Ga0105250_10270986 3300009092 Bacteria 729
49 Ga0105245_10403452 3300009098 Bacteria 1367
50 Ga0105245_10661142 3300009098 Bacteria 1076
51 Ga0105247_10424669 3300009101 Bacteria 953
52 Ga0105243_10244637 3300009148 Bacteria 1598
53 Ga0105243_10491509 3300009148 Bacteria 1161
54 Ga0105243_10745728 3300009148 Bacteria 959
55 Ga0105242_11509303 3300009176 Bacteria 703
56 Ga0105242_11603828 3300009176 Bacteria 684
57 Ga0105248_10051618 3300009177 Bacteria 4614
58 Ga0105238_12105888 3300009551 Bacteria 598
59 Ga0105249_10103486 3300009553 Bacteria 2682
60 Ga0105239_10382282 3300010375 Bacteria 1592
61 Ga0105239_10704566 3300010375 Bacteria 1154
62 Ga0105246_10003847 3300011119 Bacteria 9104
63 Ga0105246_10178955 3300011119 Bacteria 1631
64 Ga0105246_10660212 3300011119 Bacteria 911
65 Ga0157371_10121512 3300013102 Bacteria 1857
66 Ga0157369_10249055 3300013105 Bacteria 1854
67 Ga0157372_10147996 3300013307 Bacteria 2709
68 Ga0157375_10410877 3300013308 Bacteria 1520
69 Ga0157375_12658753 3300013308 Bacteria 598
70 Ga0182008_10001290 3300014497 Bacteria 17115
71 Ga0157376_10193211 3300014969 Bacteria 1868
72 Ga0182006_1047277 3300015261 Bacteria 1669
73 Ga0182007_10000530 3300015262 Bacteria 22535
74 Ga0182005_1050237 3300015265 Bacteria 1134
75 Ga0183367_1008 3300015688 Bacteria 490626
76 Ga0206355_1326617 3300020076 Bacteria 897
77 Ga0206355_1452502 3300020076 Bacteria 880
78 Ga0206351_10977052 3300020077 Bacteria 629
79 Ga0206352_10118868 3300020078 Bacteria 551
80 Ga0206352_10631011 3300020078 Bacteria 541
81 Ga0206350_10337230 3300020080 Bacteria 530
82 Ga0206350_10995876 3300020080 Bacteria 521
83 Ga0206350_11520041 3300020080 Bacteria 687
84 Ga0154015_1341688 3300020610 Bacteria 690
85 Ga0224712_10348714 3300022467 Bacteria 699
86 Ga0224712_10568028 3300022467 Bacteria 552
87 Ga0209758_1006734 3300025297 Bacteria 8093
88 Ga0207696_1077232 3300025711 Bacteria 922
89 Ga0207696_1089718 3300025711 Bacteria 843
90 Ga0207647_10002992 3300025904 Bacteria 12717
91 Ga0207685_10705802 3300025905 Bacteria 549
92 Ga0207645_10098761 3300025907 Bacteria 1882
93 Ga0207707_10216963 3300025912 Bacteria 1666
94 Ga0207681_10497412 3300025923 Bacteria 998
95 Ga0207694_10360552 3300025924 Bacteria 1204
96 Ga0207687_10830577 3300025927 Bacteria 789
97 Ga0207690_10820172 3300025932 Bacteria 769
98 Ga0207709_10216747 3300025935 Bacteria 1378
99 Ga0207709_10371505 3300025935 Bacteria 1085
100 Ga0207711_10075418 3300025941 Bacteria 2935
101 Ga0207679_11624168 3300025945 Bacteria 592
102 Ga0207667_10184029 3300025949 Bacteria 2145
103 Ga0207712_10128708 3300025961 Bacteria 1926
104 Ga0207668_10377733 3300025972 Bacteria 1192
105 Ga0207658_11055646 3300025986 Bacteria 742
106 Ga0207639_11289536 3300026041 Bacteria 685
107 Ga0207702_10305650 3300026078 Bacteria 1510
108 Ga0207676_10798031 3300026095 Bacteria 921
109 Ga0209371_1017142 3300027312 Bacteria 1886
110 Ga0209813_10059097 3300027866 Bacteria 1220
111 Ga0268266_10306082 3300028379 Bacteria 1484
112 Ga0268264_11694497 3300028381 Bacteria 643
113 Ga0307517_10010298 3300028786 Bacteria 13101
114 Ga0307517_10011673 3300028786 Bacteria 12155
115 Ga0307515_10001593 3300028794 Bacteria 50590
116 Ga0307515_10082647 3300028794 Bacteria 4150
117 Ga0268256_1008419 3300030500 Bacteria 3533
118 Ga0307511_10000329 3300030521 Bacteria 50299
119 Ga0307511_10081036 3300030521 Bacteria 2282
120 Ga0307511_10277906 3300030521 Bacteria 777
121 Ga0307512_10016261 3300030522 Bacteria 6871
122 Ga0307512_10042977 3300030522 Bacteria 3735
123 Ga0307512_10139189 3300030522 Bacteria 1491
124 Ga0316180_1112362 3300030736 Bacteria 536
125 Ga0307513_10001562 3300031456 Bacteria 32853
126 Ga0307513_10262356 3300031456 Bacteria 1516
127 Ga0307509_10145378 3300031507 Bacteria 2298
128 Ga0307509_10562619 3300031507 Bacteria 816
129 Ga0307509_10832023 3300031507 Bacteria 587
130 Ga0307508_10010953 3300031616 Bacteria 8292
131 Ga0307508_10021437 3300031616 Bacteria 5875
132 Ga0307508_10022087 3300031616 Bacteria 5784
133 Ga0307508_10164470 3300031616 Bacteria 1822
134 Ga0307508_10554837 3300031616 Bacteria 747
135 Ga0307514_10004638 3300031649 Bacteria 12601
136 Ga0307514_10057304 3300031649 Bacteria 2985
137 Ga0307514_10253329 3300031649 Bacteria 1039
138 Ga0307514_10397889 3300031649 Bacteria 705
139 Ga0307516_10022262 3300031730 Bacteria 6510
140 Ga0307516_10026400 3300031730 Bacteria 5898
141 Ga0307516_10107075 3300031730 Bacteria 2605
142 Ga0307516_10951241 3300031730 Bacteria 528
143 Ga0307410_10328249 3300031852 Bacteria 1216
144 Ga0307410_10933022 3300031852 Bacteria 745
145 Ga0307407_10840273 3300031903 Bacteria 701
146 Ga0307409_101503025 3300031995 Bacteria 701
147 Ga0307416_100033582 3300032002 Bacteria 3891
148 Ga0307416_100143532 3300032002 Bacteria 2175
149 Ga0307507_10124755 3300033179 Bacteria 2043
150 Ga0307507_10374958 3300033179 Bacteria 822
151 Ga0307510_10015016 3300033180 Bacteria 9157
152 Ga0307510_10064035 3300033180 Bacteria 3737
153 Ga0307510_10226979 3300033180 Bacteria 1373
154 Ga0395898_0163028 3300037466 Bacteria 2132
155 Ga0395901_1441423 3300038443 Bacteria 646
156 Ga0439436_0001203 3300041404 Bacteria 7367
157 Ga0439436_0076315 3300041404 Bacteria 933
158 Ga0439438_120803 3300041405 Bacteria 630
159 Ga0439439_0007508 3300041406 Bacteria 2553
160 Ga0439439_0032167 3300041406 Bacteria 1339
161 Ga0451787_350198 3300041441 Bacteria 512
162 Ga0451789_0396580 3300041443 Bacteria 620
163 Ga0451797_0829954 3300041453 Bacteria 1862
164 Ga0451795_1599477 3300041456 Bacteria 847
165 Ga0451800_0655333 3300041459 Bacteria 614
166 Ga0451802_1130406 3300041460 Bacteria 1429
167 Ga0451804_0536826 3300041463 Bacteria 1003
168 Ga0451807_1553078 3300041486 Bacteria 867
169 Ga0451833_0881429 3300041491 Bacteria 721
170 Ga0451835_0736315 3300041492 Bacteria 1853
171 Ga0451837_0584372 3300041494 Bacteria 2669
172 Ga0451841_1443935 3300041498 Bacteria 585
173 Ga0451849_0107485 3300041505 Bacteria 788
174 Ga0451854_40419 3300041510 Bacteria 504
175 Ga0451853_1026689 3300041512 Bacteria 989
176 Ga0451853_2149613 3300041512 Bacteria 1698
177 Ga0451853_2961558 3300041512 Bacteria 1158
178 Ga0451853_3999901 3300041512 Bacteria 656
179 Ga0439433_0032165 3300041999 Bacteria 1202
180 Ga0439442_003991 3300042002 Bacteria 2923
181 Ga0439442_031610 3300042002 Bacteria 1106
182 Ga0439448_0003302 3300042005 Bacteria 4458
183 Ga0439432_030332 3300042006 Bacteria 1754
184 Ga0439449_0034161 3300042007 Bacteria 1893
185 Ga0439449_0125966 3300042007 Bacteria 951
186 Ga0439449_0127487 3300042007 Bacteria 945
187 Ga0439449_0173516 3300042007 Bacteria 805
188 Ga0439449_0177337 3300042007 Bacteria 796
189 Ga0439449_0239159 3300042007 Bacteria 682
190 Ga0439455_0004480 3300042012 Bacteria 2768
191 Ga0439457_001010 3300042014 Bacteria 8470
192 Ga0439457_006563 3300042014 Bacteria 2843
193 Ga0439462_0009790 3300042015 Bacteria 2424
194 Ga0450890_006016 3300042127 Bacteria 1559
195 Ga0450894_000239 3300042131 Bacteria 9866
196 Ga0450895_008445 3300042132 Bacteria 863
197 Ga0450898_000768 3300042134 Bacteria 3927
198 Ga0450898_019354 3300042134 Bacteria 1186
199 Ga0450902_078777 3300042137 Bacteria 578
200 Ga0450903_000320 3300042138 Bacteria 10589
201 Ga0450903_021683 3300042138 Bacteria 992
202 Ga0450906_001465 3300042145 Bacteria 5143
203 Ga0439458_0004077 3300042157 Bacteria 3370
204 Ga0450908_004015 3300042184 Bacteria 2844
205 Ga0466969_0053127 3300044656 Bacteria 1989
206 Ga0466969_0066965 3300044656 Bacteria 1733
207 Ga0466969_0309939 3300044656 Bacteria 714
208 Ga0466972_0003319 3300044658 Bacteria 7982
209 Ga0466972_0010610 3300044658 Bacteria 4620
210 Ga0466972_0040773 3300044658 Bacteria 2261
211 Ga0466972_0188627 3300044658 Bacteria 966
212 Ga0466965_0006277 3300044683 Bacteria 5381
213 Ga0466965_0057582 3300044683 Bacteria 1937
214 Ga0466965_0107977 3300044683 Bacteria 1428
215 Ga0466965_0129581 3300044683 Bacteria 1307
216 Ga0466966_0169396 3300044684 Bacteria 1327
217 Ga0466966_0212299 3300044684 Bacteria 1169
218 Ga0466966_0261821 3300044684 Bacteria 1041
219 Ga0466966_0572792 3300044684 Bacteria 679
220 Ga0466961_0018558 3300044693 Bacteria 4476
221 Ga0466961_0043230 3300044693 Bacteria 2886
222 Ga0466961_0149399 3300044693 Bacteria 1459
223 Ga0466963_0000753 3300044694 Bacteria 15986
224 Ga0466963_0021601 3300044694 Bacteria 4063
225 Ga0466963_0149917 3300044694 Bacteria 1619
226 Ga0466964_0033520 3300044706 Bacteria 2046
227 Ga0466964_0122136 3300044706 Bacteria 1176
228 Ga0466964_0626588 3300044706 Bacteria 592
229 Ga0466971_0004114 3300044719 Bacteria 6261
230 Ga0466971_0066057 3300044719 Bacteria 1638
231 Ga0466971_0384672 3300044719 Bacteria 682
232 Ga0466968_0007615 3300044735 Bacteria 4123
233 Ga0466968_0413043 3300044735 Bacteria 663
234 Ga0466970_0011048 3300044765 Bacteria 4596
235 Ga0466970_0012392 3300044765 Bacteria 4358
236 Ga0466970_0142190 3300044765 Bacteria 1322
237 Ga0466957_0000165 3300044842 Bacteria 29339
238 Ga0466960_0019851 3300044901 Bacteria 2967
239 Ga0466959_0120614 3300045049 Bacteria 1864
240 Ga0466959_0449681 3300045049 Bacteria 873
241 Ga0466958_0000098 3300045836 Bacteria 27382
242 Ga0466967_0047604 3300045976 Bacteria 3738
243 Ga0466967_0193850 3300045976 Bacteria 1921
244 Ga0466967_0551509 3300045976 Bacteria 1134
245 Ga0466967_0599450 3300045976 Bacteria 1087
246 Ga0466967_1449383 3300045976 Bacteria 684
247 Ga0466967_1464178 3300045976 Bacteria 680
248 Ga0466967_1531873 3300045976 Bacteria 664
249 Ga0466967_2048300 3300045976 Bacteria 569
250 Ga0495627_018327 3300046453 Bacteria 2363
251 Ga0495627_021925 3300046453 Bacteria 2109
252 Ga0495592_0005778 3300046454 Bacteria 9163
253 Ga0495592_0006868 3300046454 Bacteria 8497
254 Ga0495603_0015550 3300046455 Bacteria 4605
255 Ga0495603_0030651 3300046455 Bacteria 3238
256 Ga0495603_0069362 3300046455 Bacteria 2073
257 Ga0495603_0102968 3300046455 Bacteria 1666
258 Ga0495603_0240550 3300046455 Bacteria 1042
259 Ga0495603_0395092 3300046455 Bacteria 792
260 Ga0495590_0039192 3300046457 Bacteria 1652
261 Ga0495590_0065490 3300046457 Bacteria 1272
262 Ga0495629_0001004 3300046459 Bacteria 22632
263 Ga0495629_0003872 3300046459 Bacteria 11281
264 Ga0495629_0029922 3300046459 Bacteria 3860
265 Ga0495629_0041357 3300046459 Bacteria 3243
266 Ga0495629_0063651 3300046459 Bacteria 2575
267 Ga0495629_0078280 3300046459 Bacteria 2308
268 Ga0495629_0109565 3300046459 Bacteria 1925
269 Ga0495629_0119010 3300046459 Bacteria 1840
270 Ga0495629_0570345 3300046459 Bacteria 758
271 Ga0495638_0037081 3300046460 Bacteria 3103
272 Ga0495638_0133053 3300046460 Bacteria 1459
273 Ga0495638_0219128 3300046460 Bacteria 1065
274 Ga0495638_0281902 3300046460 Bacteria 902
275 Ga0495641_0236186 3300046461 Bacteria 821
276 Ga0495651_0009752 3300046462 Bacteria 7385
277 Ga0495651_0154018 3300046462 Bacteria 1653
278 Ga0495653_0178764 3300046463 Bacteria 1458
279 Ga0495580_0036168 3300046472 Bacteria 3546
280 Ga0495605_0015012 3300046474 Bacteria 4222
281 Ga0495605_0262701 3300046474 Bacteria 736
282 Ga0495639_0160349 3300046475 Bacteria 1088
283 Ga0495662_0002468 3300046476 Bacteria 9310
284 Ga0495662_0099177 3300046476 Bacteria 1424
285 Ga0495662_0120385 3300046476 Bacteria 1288
286 Ga0495662_0139398 3300046476 Bacteria 1193
287 Ga0495662_0419972 3300046476 Bacteria 656
288 Ga0495662_0527655 3300046476 Bacteria 579
289 Ga0495664_0034013 3300046477 Bacteria 2996
290 Ga0495664_0281150 3300046477 Bacteria 1005
291 Ga0495584_0031411 3300046491 Bacteria 2688
292 Ga0495585_0091327 3300046492 Bacteria 1639
293 Ga0495585_0327823 3300046492 Bacteria 747
294 Ga0495594_0000431 3300046499 Bacteria 21108
295 Ga0495594_0049924 3300046499 Bacteria 2300
296 Ga0495594_0165256 3300046499 Bacteria 1258
297 Ga0495594_0538008 3300046499 Bacteria 663
298 Ga0495596_0047286 3300046500 Bacteria 1688
299 Ga0495607_0096645 3300046501 Bacteria 1590
300 Ga0495607_0127238 3300046501 Bacteria 1330
301 Ga0495583_0126583 3300046506 Bacteria 1071
302 Ga0495606_0026837 3300046507 Bacteria 4095
303 Ga0495606_0430319 3300046507 Bacteria 680
304 Ga0495608_0040948 3300046511 Bacteria 3102
305 Ga0495610_0048575 3300046512 Bacteria 2082
306 Ga0495610_0068943 3300046512 Bacteria 1656
307 Ga0495616_0007863 3300046513 Bacteria 6358
308 Ga0495618_0012630 3300046514 Bacteria 5129
309 Ga0495620_0114303 3300046515 Bacteria 1067
310 Ga0495620_0187027 3300046515 Bacteria 799
311 Ga0495628_0041105 3300046516 Bacteria 3691
312 Ga0495630_0016280 3300046517 Bacteria 5432
313 Ga0495631_0032605 3300046518 Bacteria 2347
314 Ga0495632_0026378 3300046519 Bacteria 3059
315 Ga0495632_0031794 3300046519 Bacteria 2725
316 Ga0495637_0086956 3300046520 Bacteria 1238
317 Ga0495643_0004506 3300046522 Bacteria 9711
318 Ga0495643_0056158 3300046522 Bacteria 2102
319 Ga0495648_0029130 3300046524 Bacteria 3668
320 Ga0495648_0150338 3300046524 Bacteria 1215
321 Ga0495648_0393720 3300046524 Bacteria 621
322 Ga0495666_0278447 3300046526 Bacteria 759
323 Ga0495642_0020361 3300046528 Bacteria 2606
324 Ga0495642_0512410 3300046528 Bacteria 531
325 Ga0495652_0021436 3300046529 Bacteria 5744
326 Ga0495654_0008091 3300046530 Bacteria 5830
327 Ga0495640_0115676 3300046533 Bacteria 1747
328 Ga0495640_0285395 3300046533 Bacteria 1027
329 Ga0495586_0191337 3300046535 Bacteria 1159
330 Ga0495586_0207277 3300046535 Bacteria 1112
331 Ga0495586_0366176 3300046535 Bacteria 828
332 Ga0495587_0003636 3300046536 Bacteria 10264
333 Ga0495587_0299006 3300046536 Bacteria 900
334 Ga0495597_0126037 3300046542 Bacteria 1064
335 Ga0495597_0245680 3300046542 Bacteria 704
336 Ga0495645_0016083 3300046543 Bacteria 5335
337 Ga0495645_0057851 3300046543 Bacteria 2813
338 Ga0495622_0003619 3300046557 Bacteria 7254
339 Ga0495622_0190036 3300046557 Bacteria 918
340 Ga0495633_0014454 3300046558 Bacteria 4127
341 Ga0495633_0555850 3300046558 Bacteria 517
342 Ga0495667_0228520 3300046559 Bacteria 1186
343 Ga0495667_0353286 3300046559 Bacteria 928
344 Ga0495656_0661545 3300046615 Bacteria 561
345 Ga0495668_0107258 3300046616 Bacteria 1527
346 Ga0495668_0184612 3300046616 Bacteria 1142
347 Ga0495634_0005910 3300046642 Bacteria 9346
348 Ga0495634_0119573 3300046642 Bacteria 1687
349 Ga0495634_0404453 3300046642 Bacteria 810
350 Ga0495611_0018000 3300046648 Bacteria 3027
351 Ga0495611_0340736 3300046648 Bacteria 688
352 Ga0495625_0024636 3300046660 Bacteria 4576
353 Ga0495625_0397580 3300046660 Bacteria 861
354 Ga0495635_0016693 3300046663 Bacteria 5128
355 Ga0495635_0044431 3300046663 Bacteria 3065
356 Ga0495635_0299907 3300046663 Bacteria 1077
357 Ga0495661_0015238 3300046665 Bacteria 5132
358 Ga0495588_0002384 3300046674 Bacteria 8043
359 Ga0495588_0088060 3300046674 Bacteria 1624
360 Ga0495588_0190196 3300046674 Bacteria 1084
361 Ga0495588_0751796 3300046674 Bacteria 510
362 Ga0495657_0006399 3300046675 Bacteria 9220
363 Ga0495657_0326839 3300046675 Bacteria 910
364 Ga0495657_0740941 3300046675 Bacteria 563
365 Ga0495623_0203182 3300046679 Bacteria 1138
366 Ga0495646_0016085 3300046680 Bacteria 4747
367 Ga0495646_0170495 3300046680 Bacteria 1199
368 Ga0495658_0012803 3300046683 Bacteria 4259
369 Ga0495658_0040882 3300046683 Bacteria 2579
370 Ga0495613_0020358 3300046689 Bacteria 4946
371 Ga0495613_0031857 3300046689 Bacteria 3916
372 Ga0495613_0087190 3300046689 Bacteria 2262
373 Ga0495613_0249986 3300046689 Bacteria 1237
374 Ga0495613_0379389 3300046689 Bacteria 967
375 Ga0495613_0537359 3300046689 Bacteria 784
376 Ga0495670_0022133 3300046691 Bacteria 3138
377 Ga0495670_0027569 3300046691 Bacteria 2815
378 Ga0495670_0191961 3300046691 Bacteria 1080
379 Ga0495671_0050880 3300046692 Bacteria 2062
380 Ga0495671_0113162 3300046692 Bacteria 1325
381 Ga0495649_0088991 3300046694 Bacteria 1646
382 Ga0495589_0025919 3300046794 Bacteria 2972
383 Ga0495589_0041196 3300046794 Bacteria 2305
384 Ga0495589_0081012 3300046794 Bacteria 1579
385 Ga0495589_0132288 3300046794 Bacteria 1197
386 Ga0495589_0152327 3300046794 Bacteria 1103
387 Ga0495600_0001206 3300046809 Bacteria 14165
388 Ga0495600_0322935 3300046809 Bacteria 970
389 Ga0495660_0016318 3300046810 Bacteria 4282
390 Ga0495660_0185667 3300046810 Bacteria 1002
391 Ga0495660_0297586 3300046810 Bacteria 732
392 Ga0495581_0118456 3300047315 Bacteria 1540
393 Ga0495581_0152751 3300047315 Bacteria 1349
394 Ga0495581_0362878 3300047315 Bacteria 845
395 Ga0495581_0771856 3300047315 Bacteria 552
396 Ga0495604_0000570 3300047317 Bacteria 32433
397 Ga0495604_0003204 3300047317 Bacteria 13077
398 Ga0495604_0018660 3300047317 Bacteria 5556
399 Ga0495604_0863133 3300047317 Bacteria 567
400 Ga0495636_0007766 3300047318 Bacteria 4221
401 Ga0495636_0028789 3300047318 Bacteria 2266
402 Ga0495636_0047565 3300047318 Bacteria 1791
403 Ga0495636_0066407 3300047318 Bacteria 1533
404 Ga0495636_0072715 3300047318 Bacteria 1470
405 Ga0495636_0193944 3300047318 Bacteria 925
406 Ga0495636_0213789 3300047318 Bacteria 883
407 Ga0495636_0329100 3300047318 Bacteria 718
408 Ga0495636_0539916 3300047318 Bacteria 566
409 Ga0495674_0105294 3300047319 Bacteria 2397
410 Ga0495674_0482548 3300047319 Bacteria 993
411 Ga0495672_0014706 3300047320 Bacteria 5344
412 Ga0495676_0002124 3300047321 Bacteria 17506
413 Ga0495676_0009594 3300047321 Bacteria 8811
414 Ga0495676_0080391 3300047321 Bacteria 2475
415 Ga0495676_0365426 3300047321 Bacteria 962
416 Ga0495676_0374249 3300047321 Bacteria 948
417 Ga0495680_0006173 3300047322 Bacteria 11175
418 Ga0495683_0083890 3300047323 Bacteria 1551
419 Ga0495683_0131459 3300047323 Bacteria 1180
420 Ga0495687_002282 3300047443 Bacteria 15691
421 Ga0495687_072415 3300047443 Bacteria 1377
422 Ga0495687_083875 3300047443 Bacteria 1239
423 Ga0495687_098912 3300047443 Bacteria 1099
424 Ga0495687_116055 3300047443 Bacteria 974
425 Ga0495675_0004154 3300047444 Bacteria 8766
426 Ga0495675_0008391 3300047444 Bacteria 6397
427 Ga0495675_0025099 3300047444 Bacteria 3801
428 Ga0495675_0146894 3300047444 Bacteria 1458
429 Ga0495677_0015179 3300047445 Bacteria 2799
430 Ga0495677_0190571 3300047445 Bacteria 796
431 Ga0495679_018020 3300047446 Bacteria 2516
432 Ga0495685_000652 3300047447 Bacteria 10599
433 Ga0495685_027136 3300047447 Bacteria 1969
434 Ga0495685_032070 3300047447 Bacteria 1805
435 Ga0495685_063621 3300047447 Bacteria 1241
436 Ga0495685_068531 3300047447 Bacteria 1190
437 Ga0495685_069051 3300047447 Bacteria 1185
438 Ga0495685_088217 3300047447 Bacteria 1029
439 Ga0495685_116392 3300047447 Bacteria 878
440 Ga0495681_0003346 3300047470 Bacteria 11154
441 Ga0495681_0012252 3300047470 Bacteria 5051
442 Ga0495681_0062772 3300047470 Bacteria 1707
443 Ga0495681_0106769 3300047470 Bacteria 1217
444 Ga0495684_0021108 3300047471 Bacteria 5017
445 Ga0495684_0630550 3300047471 Bacteria 719
446 Ga0495686_0149481 3300047472 Bacteria 1372
447 Ga0495686_0157453 3300047472 Bacteria 1329
448 Ga0495686_0248084 3300047472 Bacteria 1001
449 Ga0495593_0051657 3300047673 Bacteria 2174
450 Ga0495602_0126801 3300048088 Bacteria 2043
451 Ga0495602_0667517 3300048088 Bacteria 708
452 Ga0495614_0007610 3300048089 Bacteria 4816
453 Ga0495614_0011720 3300048089 Bacteria 3854
454 Ga0495614_0030826 3300048089 Bacteria 2308
455 Ga0495614_0052164 3300048089 Bacteria 1753
456 Ga0495614_0190746 3300048089 Bacteria 924
457 Ga0495614_0404661 3300048089 Bacteria 641
458 Ga0495614_0415337 3300048089 Bacteria 634
459 Ga0495626_0070063 3300048091 Bacteria 1578
460 Ga0495626_0168752 3300048091 Bacteria 913
461 Ga0496104_1492316 3300048907 Bacteria 579
462 Ga0496108_0086770 3300048911 Bacteria 2657
463 Ga0496108_0592320 3300048911 Bacteria 966
464 Ga0496109_0106158 3300048912 Bacteria 2609
465 Ga0496111_0713023 3300048914 Bacteria 729
466 Ga0501308_089376 3300049128 Bacteria 500
467 Ga0495678_124893 3300049459 Bacteria 859
468 Ga0495682_0076763 3300049460 Bacteria 1202
469 Ga0501311_044215 3300049527 Bacteria 683
470 Ga0501031_0007531 3300049568 Bacteria 7092
471 Ga0501032_0004548 3300049569 Bacteria 10436
472 Ga0501032_0264773 3300049569 Bacteria 1114
473 Ga0501032_0731441 3300049569 Bacteria 626
474 Ga0501033_0008883 3300049570 Bacteria 7762
475 Ga0501033_0012526 3300049570 Bacteria 6471
476 Ga0501033_0317096 3300049570 Bacteria 1095
477 Ga0501033_0361189 3300049570 Bacteria 1016
478 Ga0501033_0870164 3300049570 Bacteria 607
479 Ga0501034_0002375 3300049571 Bacteria 22860
480 Ga0501034_0025491 3300049571 Bacteria 6021
481 Ga0501034_0609671 3300049571 Bacteria 996
482 Ga0501034_0778788 3300049571 Bacteria 850
483 Ga0501036_0007476 3300049572 Bacteria 8908
484 Ga0501036_0071127 3300049572 Bacteria 2941
485 Ga0501036_0472132 3300049572 Bacteria 1044
486 Ga0501036_1684755 3300049572 Bacteria 511
487 Ga0501037_0377108 3300049573 Bacteria 975
488 Ga0501038_0025066 3300049574 Bacteria 5316
489 Ga0501038_0083257 3300049574 Bacteria 2693
490 Ga0501038_0308452 3300049574 Bacteria 1240
491 Ga0501039_0020154 3300049575 Bacteria 5113
492 Ga0501039_0127036 3300049575 Bacteria 2000
493 Ga0501042_0018885 3300049578 Bacteria 4779
494 Ga0501043_0007108 3300049579 Bacteria 8906
495 Ga0501043_0028743 3300049579 Bacteria 4364
496 Ga0501043_0366644 3300049579 Bacteria 1092
497 Ga0501043_0648731 3300049579 Bacteria 775
498 Ga0501043_0934364 3300049579 Bacteria 620
499 Ga0501046_0007616 3300049580 Bacteria 9499
500 Ga0501046_0462824 3300049580 Bacteria 911
501 Ga0501046_0467298 3300049580 Bacteria 906
502 Ga0501046_1215439 3300049580 Bacteria 517
503 Ga0501047_0158054 3300049581 Bacteria 2139
504 Ga0501047_0190556 3300049581 Bacteria 1914
505 Ga0501047_0329098 3300049581 Bacteria 1366
506 Ga0501047_0952688 3300049581 Bacteria 671
507 Ga0501048_0012120 3300049582 Bacteria 6424
508 Ga0501048_0690054 3300049582 Bacteria 733
509 Ga0501068_0907466 3300049584 Bacteria 580
510 Ga0501069_0133804 3300049585 Bacteria 1421
511 Ga0501069_0428214 3300049585 Bacteria 785
512 Ga0501070_0003975 3300049586 Bacteria 12726
513 Ga0501070_0362305 3300049586 Bacteria 1176
514 Ga0501070_0649543 3300049586 Bacteria 838
515 Ga0501071_0314357 3300049587 Bacteria 1189
516 Ga0501071_0603356 3300049587 Bacteria 844
517 Ga0501073_0065438 3300049589 Bacteria 2535
518 Ga0501074_0036657 3300049590 Bacteria 3552
519 Ga0501209_120035 3300049656 Bacteria 780
520 Ga0501217_055049 3300049661 Bacteria 1049
521 Ga0501080_0209167 3300049742 Bacteria 1788
522 Ga0501080_0379808 3300049742 Bacteria 1273
523 Ga0501080_0798302 3300049742 Bacteria 828
524 Ga0501035_0037955 3300049822 Bacteria 4361
525 Ga0501035_0157927 3300049822 Bacteria 1964
526 Ga0501035_0523812 3300049822 Bacteria 973
527 Ga0501035_0558954 3300049822 Bacteria 936
528 Ga0501035_0663732 3300049822 Bacteria 844
529 Ga0501035_0804794 3300049822 Bacteria 750
530 Ga0501035_1143877 3300049822 Bacteria 606
531 Ga0501044_0032365 3300049823 Bacteria 5498
532 Ga0501044_0035077 3300049823 Bacteria 5255
533 Ga0501044_0139360 3300049823 Bacteria 2414
534 Ga0501044_0276024 3300049823 Bacteria 1615
535 Ga0501044_0478915 3300049823 Bacteria 1148
536 Ga0501045_0449085 3300049824 Bacteria 958
537 nmdc:mga03n38_129966_c1 3300050490 Bacteria 1247
538 nmdc:mga03n38_79750_c1 3300050490 Bacteria 1536
539 nmdc:mga0yw44_832058_c1 3300050492 Bacteria 627
540 nmdc:mga06z11_215_c1 3300050494 Bacteria 23038
541 nmdc:mga04h51_91004_c1 3300050495 Bacteria 1098
542 nmdc:mga07m45_514774_c1 3300050496 Bacteria 693
543 nmdc:mga07m45_792089_c1 3300050496 Bacteria 543
544 Ga0495612_0009917 3300053078 Bacteria 3858
545 Ga0500610_0048691 3300053079 Bacteria 2204
546 Ga0500610_0151442 3300053079 Bacteria 1162
547 Ga0495655_0013977 3300053083 Bacteria 1673
548 Ga0495595_0423234 3300053084 Bacteria 676
549 Ga0495619_0074563 3300053085 Bacteria 2276
550 Ga0495619_0190556 3300053085 Bacteria 1419
551 Ga0495619_0739388 3300053085 Bacteria 668
552 Ga0500578_0022454 3300053086 Bacteria 4051
553 Ga0500578_0369349 3300053086 Bacteria 834
554 Ga0500644_0009537 3300053088 Bacteria 2600
555 Ga0500644_0217803 3300053088 Bacteria 795
556 Ga0500647_0160388 3300053091 Bacteria 1044
557 Ga0500583_0046759 3300053092 Bacteria 1992
558 Ga0500583_0102268 3300053092 Bacteria 1405
559 Ga0500566_0031554 3300053094 Bacteria 3090
560 Ga0500640_007555 3300053095 Bacteria 4240
561 Ga0500641_0050189 3300053096 Bacteria 1713
562 Ga0500654_089291 3300053099 Bacteria 1384
563 Ga0500660_084858 3300053100 Bacteria 1436
564 Ga0500660_202560 3300053100 Bacteria 680
565 Ga0500553_023686 3300053101 Bacteria 3097
566 Ga0500553_191030 3300053101 Bacteria 717
567 Ga0500556_0060044 3300053104 Bacteria 1398
568 Ga0500560_003760 3300053107 Bacteria 3119
569 Ga0500560_224577 3300053107 Bacteria 597
570 Ga0500569_003463 3300053109 Bacteria 3231
571 Ga0500572_028412 3300053111 Bacteria 1539
572 Ga0500608_190589 3300053122 Bacteria 858
573 Ga0500608_328608 3300053122 Bacteria 553
574 Ga0500614_006475 3300053123 Bacteria 2463
575 Ga0500628_003190 3300053129 Bacteria 2699
576 Ga0500628_033387 3300053129 Bacteria 1132
577 Ga0500652_026857 3300053131 Bacteria 2220
578 Ga0500655_094143 3300053133 Bacteria 624
579 Ga0500658_0010852 3300053134 Bacteria 3362
580 Ga0500561_0008939 3300053137 Bacteria 2015
581 Ga0500573_0003164 3300053140 Bacteria 8450
582 Ga0500573_0077005 3300053140 Bacteria 1898
583 Ga0500579_056125 3300053143 Bacteria 2373
584 Ga0500600_0012478 3300053149 Bacteria 5157
585 Ga0500600_0262282 3300053149 Bacteria 766
586 Ga0500600_0416730 3300053149 Bacteria 527
587 Ga0500606_041595 3300053152 Bacteria 1518
588 Ga0500616_0017609 3300053153 Bacteria 4051
589 Ga0500624_008595 3300053157 Bacteria 1433
590 Ga0500627_0377125 3300053158 Bacteria 608
591 Ga0500633_0002420 3300053160 Bacteria 3835
592 Ga0500633_0032198 3300053160 Bacteria 1701
593 Ga0500634_0013278 3300053161 Bacteria 4316
594 Ga0500634_0122081 3300053161 Bacteria 1266
595 Ga0500656_020032 3300053732 Bacteria 821
596 Ga0500587_001715 3300053739 Bacteria 3113
597 Ga0501084_0959407 3300054114 Bacteria 719
598 Ga0587073_0101064 3300059492 Bacteria 749
599 Ga0587082_136525 3300059504 Bacteria 568
600 Ga0587083_0205798 3300059505 Bacteria 564
601 Ga0587106_036732 3300059605 Bacteria 813
602 Ga0587068_100971 3300059641 Bacteria 606
603 Ga0587075_040527 3300059644 Bacteria 778
604 Ga0587078_045927 3300059646 Bacteria 629
605 Ga0587107_043358 3300059652 Bacteria 736
606 Ga0466962_0000132 3300061719 Bacteria 30670
607 Ga0466962_0014263 3300061719 Bacteria 3829
608 Ga0466962_0193621 3300061719 Bacteria 992
609 2554257519 2554235005 Bacteria 6457341
610 2585298461 2582581312 Bacteria 7308206
611 2585305764 2582581313 Bacteria 10042643
612 2585314558 2582581314 Bacteria 11452267
613 2616700361 2616644814 Bacteria 11555299
614 2616702143 2616644814 Bacteria 11555299
615 2616904197 2616644941 Bacteria 8510691
616 2643763146 2643221548 Bacteria 8053412
617 2643900159 2643221578 Bacteria 9213798
618 2643947913 2643221587 Bacteria 7586415
619 2644262876 2643221647 Bacteria 10741251
620 2644405617 2643221673 Bacteria 9196637
621 2644433779 2643221677 Bacteria 7584031
622 2644443080 2643221678 Bacteria 9540101
623 2644463984 2643221682 Bacteria 6743283
624 2644627108 2643221714 Bacteria 9015452
625 2785342816 2784746763 Bacteria 9783172
626 2785369987 2784746768 Bacteria 10036182
627 2786671058 2786546132 Bacteria 10419719
628 2804846345 2802429296 Bacteria 7227771
629 2808842481 2808606359 Bacteria 9866990
630 2808920987 2808606375 Bacteria 9466072
631 2811845742 2808606982 Bacteria 7791042
632 2812357620 2811994879 Bacteria 9313447
633 2812480140 2811994917 Bacteria 7761064
634 2819697314 2818991463 Bacteria 7948711
635 2852637302 2852635781 Bacteria 8251373
636 2862178939 2862178590 Bacteria 8583590
637 2862286085 2862281513 Bacteria 9621493
638 2862291394 2862290372 Bacteria 7471434
639 2862390457 2862382967 Bacteria 10317375
640 2862578830 2862574272 Bacteria 10567477
641 2863412705 2863404153 Bacteria 9672205
642 2867436423 2867428634 Bacteria 9590268
643 2873155318 2873151551 Bacteria 8625867
644 2875395171 2875391855 Bacteria 7600475
645 2877680640 2877676314 Bacteria 9512378
646 2912719355 2912715099 Bacteria 9460473
647 2912731431 2912723979 Bacteria 8557534
648 2918505143 2918501144 Bacteria 8668083
649 2919471855 2919468124 Bacteria 9133025
650 2935390795 2935390628 Bacteria 7043367
651 2946049474 2946045630 Bacteria 8527308
652 2946068236 2946064051 Bacteria 8957905
653 2946076371 2946072368 Bacteria 8999607
654 2947228687 2947224130 Bacteria 9938529
655 2954006839 2954002825 Bacteria 9173742
656 2954385767 2954380949 Bacteria 10050426
657 2954677387 2954673503 Bacteria 9685905
658 2954686766 2954682443 Bacteria 9862841
659 2954696414 2954691527 Bacteria 10720516
660 2954705863 2954701450 Bacteria 10834262
661 2954715771 2954711539 Bacteria 10867210
662 2954725708 2954721474 Bacteria 10456478
663 2954736092 2954731030 Bacteria 10243860
664 2954744662 2954740390 Bacteria 10229294
665 2954754952 2954749733 Bacteria 10366972
666 2954763629 2954759201 Bacteria 9358192
667 2966602112 2966598605 Bacteria 7676064
668 2990061618 2990059506 Bacteria 9321252
669 3006399584 3006393351 Bacteria 6615579
670 3006488481 3006486233 Bacteria 8157040
671 3006499412 3006493962 Bacteria 8825450
672 8008566813 8008558824 Bacteria 10610750
673 8008578502 8008574985 Bacteria 7815457
674 8025419897 8025413630 Bacteria 7014048
675 8025484251 8025478263 Bacteria 8209203
676 8048411535 8048406513 Bacteria 8936924
677 8056671974 8056667051 Bacteria 6953971
678 Ga0466967_1551602
679 JGI24739J22299_10040041
680 JGI24737J22298_10035020
681 JGI24738J21930_10009499
682 JGI25153J46596_10053388
683 Ga0006777J48905_1097507
684 rootH1_10023704
685 rootH1_10074419
686 rootH2_10036711
687 rootH1_10008667
688 Ga0007427J51700_117942
689 Ga0006562J51391_1050510
690 Ga0006562J51391_1078574
691 Ga0006562J51391_1161500
692 Ga0007429J51699_1078522
693 Ga0058861_10907449
694 Ga0070676_10135513
695 Ga0070668_101224039
696 Ga0070669_100198939
697 Ga0070659_101275005
698 Ga0070667_101420940
699 Ga0070663_101104995
700 Ga0070678_100649841
701 Ga0070681_10443465
702 Ga0068853_101992381
703 Ga0070665_102141056
704 Ga0070665_102155029
705 Ga0068855_100764261
706 Ga0070664_100480927
707 Ga0068857_101332708
708 Ga0068857_102256143
709 Ga0068856_100193503
710 Ga0068864_100556769
711 Ga0068861_100480894
712 Ga0068860_102257129
713 Ga0081455_10015051
714 Ga0075365_10139079
715 Ga0075368_10039407
716 Ga0075363_100788086
717 Ga0075363_101002521
718 Ga0070715_11074375
719 Ga0075367_10000116
720 Ga0075370_10384015
721 Ga0099826_10058003
722 Ga0105251_10614824
723 Ga0105244_10107324
724 Ga0105250_10255700
725 Ga0105250_10270986
726 Ga0105245_10403452
727 Ga0105245_10661142
728 Ga0105247_10424669
729 Ga0105243_10244637
730 Ga0105243_10491509
731 Ga0105243_10745728
732 Ga0105242_11509303
733 Ga0105242_11603828
734 Ga0105248_10051618
735 Ga0105238_12105888
736 Ga0105249_10103486
737 Ga0105239_10382282
738 Ga0105239_10704566
739 Ga0105246_10003847
740 Ga0105246_10178955
741 Ga0105246_10660212
742 Ga0157371_10121512
743 Ga0157369_10249055
744 Ga0157372_10147996
745 Ga0157375_10410877
746 Ga0157375_12658753
747 Ga0182008_10001290
748 Ga0157376_10193211
749 Ga0182006_1047277
750 Ga0182007_10000530
751 Ga0182005_1050237
752 Ga0183367_1008
753 Ga0206355_1326617
754 Ga0206355_1452502
755 Ga0206351_10977052
756 Ga0206352_10118868
757 Ga0206352_10631011
758 Ga0206350_10337230
759 Ga0206350_10995876
760 Ga0206350_11520041
761 Ga0154015_1341688
762 Ga0224712_10348714
763 Ga0224712_10568028
764 Ga0209758_1006734
765 Ga0207696_1077232
766 Ga0207696_1089718
767 Ga0207647_10002992
768 Ga0207685_10705802
769 Ga0207645_10098761
770 Ga0207707_10216963
771 Ga0207681_10497412
772 Ga0207694_10360552
773 Ga0207687_10830577
774 Ga0207690_10820172
775 Ga0207709_10216747
776 Ga0207709_10371505
777 Ga0207711_10075418
778 Ga0207679_11624168
779 Ga0207667_10184029
780 Ga0207712_10128708
781 Ga0207668_10377733
782 Ga0207658_11055646
783 Ga0207639_11289536
784 Ga0207702_10305650
785 Ga0207676_10798031
786 Ga0209371_1017142
787 Ga0209813_10059097
788 Ga0268266_10306082
789 Ga0268264_11694497
790 Ga0307517_10010298
791 Ga0307517_10011673
792 Ga0307515_10001593
793 Ga0307515_10082647
794 Ga0268256_1008419
795 Ga0307511_10000329
796 Ga0307511_10081036
797 Ga0307511_10277906
798 Ga0307512_10016261
799 Ga0307512_10042977
800 Ga0307512_10139189
801 Ga0316180_1112362
802 Ga0307513_10001562
803 Ga0307513_10262356
804 Ga0307509_10145378
805 Ga0307509_10562619
806 Ga0307509_10832023
807 Ga0307508_10010953
808 Ga0307508_10021437
809 Ga0307508_10022087
810 Ga0307508_10164470
811 Ga0307508_10554837
812 Ga0307514_10004638
813 Ga0307514_10057304
814 Ga0307514_10253329
815 Ga0307514_10397889
816 Ga0307516_10022262
817 Ga0307516_10026400
818 Ga0307516_10107075
819 Ga0307516_10951241
820 Ga0307410_10328249
821 Ga0307410_10933022
822 Ga0307407_10840273
823 Ga0307409_101503025
824 Ga0307416_100033582
825 Ga0307416_100143532
826 Ga0307507_10124755
827 Ga0307507_10374958
828 Ga0307510_10015016
829 Ga0307510_10064035
830 Ga0307510_10226979
831 Ga0395898_0163028
832 Ga0395901_1441423
833 Ga0439436_0001203
834 Ga0439436_0076315
835 Ga0439438_120803
836 Ga0439439_0007508
837 Ga0439439_0032167
838 Ga0451787_350198
839 Ga0451789_0396580
840 Ga0451797_0829954
841 Ga0451795_1599477
842 Ga0451800_0655333
843 Ga0451802_1130406
844 Ga0451804_0536826
845 Ga0451807_1553078
846 Ga0451833_0881429
847 Ga0451835_0736315
848 Ga0451837_0584372
849 Ga0451841_1443935
850 Ga0451849_0107485
851 Ga0451854_40419
852 Ga0451853_1026689
853 Ga0451853_2149613
854 Ga0451853_2961558
855 Ga0451853_3999901
856 Ga0439433_0032165
857 Ga0439442_003991
858 Ga0439442_031610
859 Ga0439448_0003302
860 Ga0439432_030332
861 Ga0439449_0034161
862 Ga0439449_0125966
863 Ga0439449_0127487
864 Ga0439449_0173516
865 Ga0439449_0177337
866 Ga0439449_0239159
867 Ga0439455_0004480
868 Ga0439457_001010
869 Ga0439457_006563
870 Ga0439462_0009790
871 Ga0450890_006016
872 Ga0450894_000239
873 Ga0450895_008445
874 Ga0450898_000768
875 Ga0450898_019354
876 Ga0450902_078777
877 Ga0450903_000320
878 Ga0450903_021683
879 Ga0450906_001465
880 Ga0439458_0004077
881 Ga0450908_004015
882 Ga0466969_0053127
883 Ga0466969_0066965
884 Ga0466969_0309939
885 Ga0466972_0003319
886 Ga0466972_0010610
887 Ga0466972_0040773
888 Ga0466972_0188627
889 Ga0466965_0006277
890 Ga0466965_0057582
891 Ga0466965_0107977
892 Ga0466965_0129581
893 Ga0466966_0169396
894 Ga0466966_0212299
895 Ga0466966_0261821
896 Ga0466966_0572792
897 Ga0466961_0018558
898 Ga0466961_0043230
899 Ga0466961_0149399
900 Ga0466963_0000753
901 Ga0466963_0021601
902 Ga0466963_0149917
903 Ga0466964_0033520
904 Ga0466964_0122136
905 Ga0466964_0626588
906 Ga0466971_0004114
907 Ga0466971_0066057
908 Ga0466971_0384672
909 Ga0466968_0007615
910 Ga0466968_0413043
911 Ga0466970_0011048
912 Ga0466970_0012392
913 Ga0466970_0142190
914 Ga0466957_0000165
915 Ga0466960_0019851
916 Ga0466959_0120614
917 Ga0466959_0449681
918 Ga0466958_0000098
919 Ga0466967_0047604
920 Ga0466967_0193850
921 Ga0466967_0551509
922 Ga0466967_0599450
923 Ga0466967_1449383
924 Ga0466967_1464178
925 Ga0466967_1531873
926 Ga0466967_2048300
927 Ga0495627_018327
928 Ga0495627_021925
929 Ga0495592_0005778
930 Ga0495592_0006868
931 Ga0495603_0015550
932 Ga0495603_0030651
933 Ga0495603_0069362
934 Ga0495603_0102968
935 Ga0495603_0240550
936 Ga0495603_0395092
937 Ga0495590_0039192
938 Ga0495590_0065490
939 Ga0495629_0001004
940 Ga0495629_0003872
941 Ga0495629_0029922
942 Ga0495629_0041357
943 Ga0495629_0063651
944 Ga0495629_0078280
945 Ga0495629_0109565
946 Ga0495629_0119010
947 Ga0495629_0570345
948 Ga0495638_0037081
949 Ga0495638_0133053
950 Ga0495638_0219128
951 Ga0495638_0281902
952 Ga0495641_0236186
953 Ga0495651_0009752
954 Ga0495651_0154018
955 Ga0495653_0178764
956 Ga0495580_0036168
957 Ga0495605_0015012
958 Ga0495605_0262701
959 Ga0495639_0160349
960 Ga0495662_0002468
961 Ga0495662_0099177
962 Ga0495662_0120385
963 Ga0495662_0139398
964 Ga0495662_0419972
965 Ga0495662_0527655
966 Ga0495664_0034013
967 Ga0495664_0281150
968 Ga0495584_0031411
969 Ga0495585_0091327
970 Ga0495585_0327823
971 Ga0495594_0000431
972 Ga0495594_0049924
973 Ga0495594_0165256
974 Ga0495594_0538008
975 Ga0495596_0047286
976 Ga0495607_0096645
977 Ga0495607_0127238
978 Ga0495583_0126583
979 Ga0495606_0026837
980 Ga0495606_0430319
981 Ga0495608_0040948
982 Ga0495610_0048575
983 Ga0495610_0068943
984 Ga0495616_0007863
985 Ga0495618_0012630
986 Ga0495620_0114303
987 Ga0495620_0187027
988 Ga0495628_0041105
989 Ga0495630_0016280
990 Ga0495631_0032605
991 Ga0495632_0026378
992 Ga0495632_0031794
993 Ga0495637_0086956
994 Ga0495643_0004506
995 Ga0495643_0056158
996 Ga0495648_0029130
997 Ga0495648_0150338
998 Ga0495648_0393720
999 Ga0495666_0278447
1000 Ga0495642_0020361
1001 Ga0495642_0512410
1002 Ga0495652_0021436
1003 Ga0495654_0008091
1004 Ga0495640_0115676
1005 Ga0495640_0285395
1006 Ga0495586_0191337
1007 Ga0495586_0207277
1008 Ga0495586_0366176
1009 Ga0495587_0003636
1010 Ga0495587_0299006
1011 Ga0495597_0126037
1012 Ga0495597_0245680
1013 Ga0495645_0016083
1014 Ga0495645_0057851
1015 Ga0495622_0003619
1016 Ga0495622_0190036
1017 Ga0495633_0014454
1018 Ga0495633_0555850
1019 Ga0495667_0228520
1020 Ga0495667_0353286
1021 Ga0495656_0661545
1022 Ga0495668_0107258
1023 Ga0495668_0184612
1024 Ga0495634_0005910
1025 Ga0495634_0119573
1026 Ga0495634_0404453
1027 Ga0495611_0018000
1028 Ga0495611_0340736
1029 Ga0495625_0024636
1030 Ga0495625_0397580
1031 Ga0495635_0016693
1032 Ga0495635_0044431
1033 Ga0495635_0299907
1034 Ga0495661_0015238
1035 Ga0495588_0002384
1036 Ga0495588_0088060
1037 Ga0495588_0190196
1038 Ga0495588_0751796
1039 Ga0495657_0006399
1040 Ga0495657_0326839
1041 Ga0495657_0740941
1042 Ga0495623_0203182
1043 Ga0495646_0016085
1044 Ga0495646_0170495
1045 Ga0495658_0012803
1046 Ga0495658_0040882
1047 Ga0495613_0020358
1048 Ga0495613_0031857
1049 Ga0495613_0087190
1050 Ga0495613_0249986
1051 Ga0495613_0379389
1052 Ga0495613_0537359
1053 Ga0495670_0022133
1054 Ga0495670_0027569
1055 Ga0495670_0191961
1056 Ga0495671_0050880
1057 Ga0495671_0113162
1058 Ga0495649_0088991
1059 Ga0495589_0025919
1060 Ga0495589_0041196
1061 Ga0495589_0081012
1062 Ga0495589_0132288
1063 Ga0495589_0152327
1064 Ga0495600_0001206
1065 Ga0495600_0322935
1066 Ga0495660_0016318
1067 Ga0495660_0185667
1068 Ga0495660_0297586
1069 Ga0495581_0118456
1070 Ga0495581_0152751
1071 Ga0495581_0362878
1072 Ga0495581_0771856
1073 Ga0495604_0000570
1074 Ga0495604_0003204
1075 Ga0495604_0018660
1076 Ga0495604_0863133
1077 Ga0495636_0007766
1078 Ga0495636_0028789
1079 Ga0495636_0047565
1080 Ga0495636_0066407
1081 Ga0495636_0072715
1082 Ga0495636_0193944
1083 Ga0495636_0213789
1084 Ga0495636_0329100
1085 Ga0495636_0539916
1086 Ga0495674_0105294
1087 Ga0495674_0482548
1088 Ga0495672_0014706
1089 Ga0495676_0002124
1090 Ga0495676_0009594
1091 Ga0495676_0080391
1092 Ga0495676_0365426
1093 Ga0495676_0374249
1094 Ga0495680_0006173
1095 Ga0495683_0083890
1096 Ga0495683_0131459
1097 Ga0495687_002282
1098 Ga0495687_072415
1099 Ga0495687_083875
1100 Ga0495687_098912
1101 Ga0495687_116055
1102 Ga0495675_0004154
1103 Ga0495675_0008391
1104 Ga0495675_0025099
1105 Ga0495675_0146894
1106 Ga0495677_0015179
1107 Ga0495677_0190571
1108 Ga0495679_018020
1109 Ga0495685_000652
1110 Ga0495685_027136
1111 Ga0495685_032070
1112 Ga0495685_063621
1113 Ga0495685_068531
1114 Ga0495685_069051
1115 Ga0495685_088217
1116 Ga0495685_116392
1117 Ga0495681_0003346
1118 Ga0495681_0012252
1119 Ga0495681_0062772
1120 Ga0495681_0106769
1121 Ga0495684_0021108
1122 Ga0495684_0630550
1123 Ga0495686_0149481
1124 Ga0495686_0157453
1125 Ga0495686_0248084
1126 Ga0495593_0051657
1127 Ga0495602_0126801
1128 Ga0495602_0667517
1129 Ga0495614_0007610
1130 Ga0495614_0011720
1131 Ga0495614_0030826
1132 Ga0495614_0052164
1133 Ga0495614_0190746
1134 Ga0495614_0404661
1135 Ga0495614_0415337
1136 Ga0495626_0070063
1137 Ga0495626_0168752
1138 Ga0496104_1492316
1139 Ga0496108_0086770
1140 Ga0496108_0592320
1141 Ga0496109_0106158
1142 Ga0496111_0713023
1143 Ga0501308_089376
1144 Ga0495678_124893
1145 Ga0495682_0076763
1146 Ga0501311_044215
1147 Ga0501031_0007531
1148 Ga0501032_0004548
1149 Ga0501032_0264773
1150 Ga0501032_0731441
1151 Ga0501033_0008883
1152 Ga0501033_0012526
1153 Ga0501033_0317096
1154 Ga0501033_0361189
1155 Ga0501033_0870164
1156 Ga0501034_0002375
1157 Ga0501034_0025491
1158 Ga0501034_0609671
1159 Ga0501034_0778788
1160 Ga0501036_0007476
1161 Ga0501036_0071127
1162 Ga0501036_0472132
1163 Ga0501036_1684755
1164 Ga0501037_0377108
1165 Ga0501038_0025066
1166 Ga0501038_0083257
1167 Ga0501038_0308452
1168 Ga0501039_0020154
1169 Ga0501039_0127036
1170 Ga0501042_0018885
1171 Ga0501043_0007108
1172 Ga0501043_0028743
1173 Ga0501043_0366644
1174 Ga0501043_0648731
1175 Ga0501043_0934364
1176 Ga0501046_0007616
1177 Ga0501046_0462824
1178 Ga0501046_0467298
1179 Ga0501046_1215439
1180 Ga0501047_0158054
1181 Ga0501047_0190556
1182 Ga0501047_0329098
1183 Ga0501047_0952688
1184 Ga0501048_0012120
1185 Ga0501048_0690054
1186 Ga0501068_0907466
1187 Ga0501069_0133804
1188 Ga0501069_0428214
1189 Ga0501070_0003975
1190 Ga0501070_0362305
1191 Ga0501070_0649543
1192 Ga0501071_0314357
1193 Ga0501071_0603356
1194 Ga0501073_0065438
1195 Ga0501074_0036657
1196 Ga0501209_120035
1197 Ga0501217_055049
1198 Ga0501080_0209167
1199 Ga0501080_0379808
1200 Ga0501080_0798302
1201 Ga0501035_0037955
1202 Ga0501035_0157927
1203 Ga0501035_0523812
1204 Ga0501035_0558954
1205 Ga0501035_0663732
1206 Ga0501035_0804794
1207 Ga0501035_1143877
1208 Ga0501044_0032365
1209 Ga0501044_0035077
1210 Ga0501044_0139360
1211 Ga0501044_0276024
1212 Ga0501044_0478915
1213 Ga0501045_0449085
1214 nmdc:mga03n38_129966_c1
1215 nmdc:mga03n38_79750_c1
1216 nmdc:mga0yw44_832058_c1
1217 nmdc:mga06z11_215_c1
1218 nmdc:mga04h51_91004_c1
1219 nmdc:mga07m45_514774_c1
1220 nmdc:mga07m45_792089_c1
1221 Ga0495612_0009917
1222 Ga0500610_0048691
1223 Ga0500610_0151442
1224 Ga0495655_0013977
1225 Ga0495595_0423234
1226 Ga0495619_0074563
1227 Ga0495619_0190556
1228 Ga0495619_0739388
1229 Ga0500578_0022454
1230 Ga0500578_0369349
1231 Ga0500644_0009537
1232 Ga0500644_0217803
1233 Ga0500647_0160388
1234 Ga0500583_0046759
1235 Ga0500583_0102268
1236 Ga0500566_0031554
1237 Ga0500640_007555
1238 Ga0500641_0050189
1239 Ga0500654_089291
1240 Ga0500660_084858
1241 Ga0500660_202560
1242 Ga0500553_023686
1243 Ga0500553_191030
1244 Ga0500556_0060044
1245 Ga0500560_003760
1246 Ga0500560_224577
1247 Ga0500569_003463
1248 Ga0500572_028412
1249 Ga0500608_190589
1250 Ga0500608_328608
1251 Ga0500614_006475
1252 Ga0500628_003190
1253 Ga0500628_033387
1254 Ga0500652_026857
1255 Ga0500655_094143
1256 Ga0500658_0010852
1257 Ga0500561_0008939
1258 Ga0500573_0003164
1259 Ga0500573_0077005
1260 Ga0500579_056125
1261 Ga0500600_0012478
1262 Ga0500600_0262282
1263 Ga0500600_0416730
1264 Ga0500606_041595
1265 Ga0500616_0017609
1266 Ga0500624_008595
1267 Ga0500627_0377125
1268 Ga0500633_0002420
1269 Ga0500633_0032198
1270 Ga0500634_0013278
1271 Ga0500634_0122081
1272 Ga0500656_020032
1273 Ga0500587_001715
1274 Ga0501084_0959407
1275 Ga0587073_0101064
1276 Ga0587082_136525
1277 Ga0587083_0205798
1278 Ga0587106_036732
1279 Ga0587068_100971
1280 Ga0587075_040527
1281 Ga0587078_045927
1282 Ga0587107_043358
1283 Ga0466962_0000132
1284 Ga0466962_0014263
1285 Ga0466962_0193621
1286 2554257519
1287 2585298461
1288 2585305764
1289 2585314558
1290 2616700361
1291 2616702143
1292 2616904197
1293 2643763146
1294 2643900159
1295 2643947913
1296 2644262876
1297 2644405617
1298 2644433779
1299 2644443080
1300 2644463984
1301 2644627108
1302 2785342816
1303 2785369987
1304 2786671058
1305 2804846345
1306 2808842481
1307 2808920987
1308 2811845742
1309 2812357620
1310 2812480140
1311 2819697314
1312 2852637302
1313 2862178939
1314 2862286085
1315 2862291394
1316 2862390457
1317 2862578830
1318 2863412705
1319 2867436423
1320 2873155318
1321 2875395171
1322 2877680640
1323 2912719355
1324 2912731431
1325 2918505143
1326 2919471855
1327 2935390795
1328 2946049474
1329 2946068236
1330 2946076371
1331 2947228687
1332 2954006839
1333 2954385767
1334 2954677387
1335 2954686766
1336 2954696414
1337 2954705863
1338 2954715771
1339 2954725708
1340 2954736092
1341 2954744662
1342 2954754952
1343 2954763629
1344 2966602112
1345 2990061618
1346 3006399584
1347 3006488481
1348 3006499412
1349 8008566813
1350 8008578502
1351 8025419897
1352 8025484251
1353 8048411535
1354 8056671974

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
1o9i-assembly1.cif.gz_B crystal structure of the y42f mutant of manganese catalase from lactobacillus plantarum at 1.33a resolution 0.7287 27 95
2ib0-assembly1.cif.gz_A crystal structure of a conserved hypothetical protein, rv2844, from mycobacterium tuberculosis 0.6986 24 94
2v6y-assembly2.cif.gz_B structure of the mit domain from a s. solfataricus vps4-like atpase 0.6972 24 90
2w2u-assembly1.cif.gz_A structural insight into the interaction between archaeal escrt-iii and aaa-atpase 0.6923 21 94
2v6y-assembly1.cif.gz_A structure of the mit domain from a s. solfataricus vps4-like atpase 0.6878 21 91
ID Description Score Start End Superfamily
af_A0A0R0I378_34_190_1.20.1260.10 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.8606 46 94 1.20.1260.10
af_P83260_27_259_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.8409 45 95 1.20.1070.10
af_Q9R1S8_86_155_1.20.58.80 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphotransferase system, lactose/cellobiose-type IIA subunit 0.7823 28 91 1.20.58.80
af_Q9Y6W3_86_155_1.20.58.80 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphotransferase system, lactose/cellobiose-type IIA subunit 0.7807 28 91 1.20.58.80
af_Q499T5_86_155_1.20.58.80 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphotransferase system, lactose/cellobiose-type IIA subunit 0.7795 28 91 1.20.58.80
ID Description Score Start End GO Terms
AF-S4NWB2-F1-model_v4 Integral membrane protein 0.9916 5 98 GO:0016020
AF-A0A7W7RUS9-F1-model_v4 Uncharacterized membrane protein HdeD (DUF308 family) 0.988 23 99 GO:0016020
AF-A0A7V8NI50-F1-model_v4 Integral membrane protein 0.9809 14 98 GO:0016020
AF-A0A7C9N7T2-F1-model_v4 DUF4203 domain-containing protein 0.9795 16 97 GO:0016020
AF-A0A543CKB1-F1-model_v4 Uncharacterized protein 0.9649 18 98 GO:0016020

Map