F474568
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 677 | 284 | 668 | 278 |
Family's Representative Sequence
| Representative Sequence | 3300005335|Ga0070666_10286238|Ga0070666_102862381 |
| Length | 310 |
| Sequence | MNFALILFVLTSITGAAWLFDKLVLEGRRRERARLALANLDRQMPATVSGDGGAAAPARRADVETAALREPSWVEYSKAFFPVLLIVFLLRSFLAEPFKIPSSSMRPTLEVGDFILVNKFAYGIRLPIIEKKIVPIDDPKRGDVVVFRYPVNPSQDFIKRVIGIGGDVVEYRDKRITVNGQPWPQQTDGTYSYLEGLRFDTLTRMAERTDAAAGARDHMIGLNQNAPAVYPLNVRNFPGRENCDYNERGFTCKVPAGHYLMMGDNRDNSDDSRYWGFVPDDHIRGKAFFIWFNWDDIASFAFKRVGSGIR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221559 | Lysobacter sp. Root559 | Isolate | Unclassified |
| 2 | 2643221586 | Lysobacter sp. Root667 | Isolate | Unclassified |
| 3 | 2643221593 | Lysobacter sp. Root690 | Isolate | Unclassified |
| 4 | 2643221612 | Lysobacter sp. Root76 | Isolate | Unclassified |
| 5 | 2643221727 | Lysobacter sp. Root96 | Isolate | Unclassified |
| 6 | 2941489479 | Lysobacter enzymogenes 2943 | Isolate | Rhizosphere |
| 7 | 2952252522 | Salinicola sp. DM10 | Isolate | Unclassified |
| 8 | 2995948881 | Lysobacter enzymogenes B25 | Isolate | Unclassified |
| 9 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 10 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 11 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 12 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 13 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 14 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 15 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 16 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 17 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 18 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 19 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 20 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 21 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 22 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 29 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 33 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 43 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 56 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 57 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 58 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 60 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 66 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 68 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 69 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 70 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 72 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 73 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 74 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 75 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 76 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 77 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 78 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 79 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 80 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 81 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 82 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 83 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 85 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 86 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 87 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 88 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 89 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 113 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300015689 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 | Metagenome | Rhizosphere |
| 117 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 119 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 120 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 122 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 124 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 127 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 130 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 195 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 199 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 200 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 201 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 202 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 203 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 204 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 205 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 206 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 207 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 208 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 209 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 210 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 211 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 212 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 213 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 214 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 215 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 216 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 217 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 218 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 219 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 220 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 221 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 222 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 223 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 224 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 225 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 226 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 227 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 228 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 229 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 230 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 231 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 232 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 241 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 242 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 243 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 244 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 245 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 246 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 247 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 248 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 249 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 250 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 251 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 252 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 253 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 254 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 255 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 256 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 268 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 269 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 270 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 271 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 272 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 274 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 275 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 276 | 3300049771 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control | Metagenome | Rhizosphere |
| 277 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 281 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 282 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 283 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 284 | 8003014200 | Lysobacter changpingensis Cm-3-T8 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.67 |
| Metatranscriptomes | 0 |
| Isolates | 1.33 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.32 |
| Nodule | 0 |
| Rhizoplane | 4.14 |
| Rhizosphere | 88.92 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.62 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24752J21851_1002344 | 3300001976 | Bacteria | 2519 |
| 2 | JGI24747J21853_1000416 | 3300001978 | Bacteria | 2585 |
| 3 | JGI24737J22298_10026321 | 3300001990 | Bacteria | 1836 |
| 4 | JGI24033J26618_1006613 | 3300002155 | Bacteria | 1305 |
| 5 | JGI24034J26672_10003260 | 3300002239 | Bacteria | 2262 |
| 6 | JGI24742J22300_10006158 | 3300002244 | Bacteria | 1978 |
| 7 | rootH2_10263331 | 3300003320 | Bacteria | 1110 |
| 8 | Ga0055524_1000206 | 3300003775 | Bacteria | 63929 |
| 9 | Ga0055536_1001400 | 3300003781 | Bacteria | 14570 |
| 10 | Ga0055534_1000164 | 3300003784 | Bacteria | 49529 |
| 11 | Ga0055528_1000027 | 3300003790 | Bacteria | 126420 |
| 12 | Ga0055530_10002733 | 3300003791 | Bacteria | 10932 |
| 13 | Ga0065715_10164276 | 3300005293 | Bacteria | 1600 |
| 14 | Ga0070658_10010428 | 3300005327 | Bacteria | 7451 |
| 15 | Ga0070658_10223651 | 3300005327 | Bacteria | 1592 |
| 16 | Ga0070676_10021807 | 3300005328 | Bacteria | 3587 |
| 17 | Ga0070676_10033957 | 3300005328 | Bacteria | 2927 |
| 18 | Ga0070676_10044557 | 3300005328 | Bacteria | 2582 |
| 19 | Ga0070676_10079311 | 3300005328 | Bacteria | 1988 |
| 20 | Ga0070676_10228769 | 3300005328 | Bacteria | 1232 |
| 21 | Ga0070683_100035699 | 3300005329 | Bacteria | 4544 |
| 22 | Ga0070683_100104562 | 3300005329 | Bacteria | 2669 |
| 23 | Ga0070683_100299069 | 3300005329 | Bacteria | 1531 |
| 24 | Ga0070690_100067434 | 3300005330 | Bacteria | 2318 |
| 25 | Ga0070670_100001361 | 3300005331 | Bacteria | 19584 |
| 26 | Ga0070670_100010473 | 3300005331 | Bacteria | 7913 |
| 27 | Ga0070670_100016063 | 3300005331 | Bacteria | 6425 |
| 28 | Ga0070670_100376144 | 3300005331 | Bacteria | 1251 |
| 29 | Ga0070670_100424371 | 3300005331 | Bacteria | 1176 |
| 30 | Ga0070677_10001351 | 3300005333 | Bacteria | 7826 |
| 31 | Ga0070677_10039239 | 3300005333 | Bacteria | 1857 |
| 32 | Ga0068869_100002085 | 3300005334 | Bacteria | 12019 |
| 33 | Ga0068869_100016238 | 3300005334 | Bacteria | 5014 |
| 34 | Ga0068869_100101091 | 3300005334 | Bacteria | 2181 |
| 35 | Ga0068869_100182958 | 3300005334 | Bacteria | 1644 |
| 36 | Ga0070666_10058348 | 3300005335 | Bacteria | 2610 |
| 37 | Ga0070666_10103753 | 3300005335 | Bacteria | 1962 |
| 38 | Ga0070666_10124781 | 3300005335 | Bacteria | 1787 |
| 39 | Ga0070666_10286238 | 3300005335 | Bacteria | 1172 |
| 40 | Ga0070680_100130082 | 3300005336 | Bacteria | 2106 |
| 41 | Ga0070680_100154792 | 3300005336 | Bacteria | 1925 |
| 42 | Ga0070682_100017775 | 3300005337 | Bacteria | 4147 |
| 43 | Ga0068868_100001366 | 3300005338 | Bacteria | 16818 |
| 44 | Ga0068868_100005837 | 3300005338 | Bacteria | 8681 |
| 45 | Ga0070660_100008372 | 3300005339 | Bacteria | 7230 |
| 46 | Ga0070660_100014412 | 3300005339 | Bacteria | 5693 |
| 47 | Ga0070660_100036902 | 3300005339 | Bacteria | 3704 |
| 48 | Ga0070660_100116390 | 3300005339 | Bacteria | 2132 |
| 49 | Ga0070660_100173267 | 3300005339 | Bacteria | 1743 |
| 50 | Ga0070660_100219590 | 3300005339 | Bacteria | 1544 |
| 51 | Ga0070687_100018652 | 3300005343 | Bacteria | 3214 |
| 52 | Ga0070661_100001117 | 3300005344 | Bacteria | 18832 |
| 53 | Ga0070661_100003926 | 3300005344 | Bacteria | 10231 |
| 54 | Ga0070661_100012543 | 3300005344 | Bacteria | 5930 |
| 55 | Ga0070661_100049843 | 3300005344 | Bacteria | 3065 |
| 56 | Ga0070661_100076708 | 3300005344 | Bacteria | 2463 |
| 57 | Ga0070668_100001120 | 3300005347 | Bacteria | 18884 |
| 58 | Ga0070668_100047740 | 3300005347 | Bacteria | 3292 |
| 59 | Ga0070668_100204857 | 3300005347 | Bacteria | 1621 |
| 60 | Ga0070668_100236777 | 3300005347 | Bacteria | 1511 |
| 61 | Ga0070669_100049666 | 3300005353 | Bacteria | 3063 |
| 62 | Ga0070669_100096618 | 3300005353 | Bacteria | 2223 |
| 63 | Ga0070675_100013337 | 3300005354 | Bacteria | 6457 |
| 64 | Ga0070675_100092570 | 3300005354 | Bacteria | 2534 |
| 65 | Ga0070675_100150125 | 3300005354 | Bacteria | 1998 |
| 66 | Ga0070675_100186431 | 3300005354 | Bacteria | 1796 |
| 67 | Ga0070671_100001808 | 3300005355 | Bacteria | 16265 |
| 68 | Ga0070671_100001980 | 3300005355 | Bacteria | 15715 |
| 69 | Ga0070671_100003000 | 3300005355 | Bacteria | 13142 |
| 70 | Ga0070671_100068995 | 3300005355 | Bacteria | 2948 |
| 71 | Ga0070671_100409565 | 3300005355 | Bacteria | 1160 |
| 72 | Ga0070674_100000120 | 3300005356 | Bacteria | 35826 |
| 73 | Ga0070674_100003810 | 3300005356 | Bacteria | 8524 |
| 74 | Ga0070673_100004665 | 3300005364 | Bacteria | 8700 |
| 75 | Ga0070673_100007284 | 3300005364 | Bacteria | 7285 |
| 76 | Ga0070673_100007452 | 3300005364 | Bacteria | 7217 |
| 77 | Ga0070673_100070400 | 3300005364 | Bacteria | 2807 |
| 78 | Ga0070673_100209279 | 3300005364 | Bacteria | 1683 |
| 79 | Ga0070673_100238712 | 3300005364 | Bacteria | 1579 |
| 80 | Ga0070688_100026678 | 3300005365 | Bacteria | 3434 |
| 81 | Ga0070688_100288542 | 3300005365 | Bacteria | 1182 |
| 82 | Ga0070659_100010091 | 3300005366 | Bacteria | 6953 |
| 83 | Ga0070659_100025398 | 3300005366 | Bacteria | 4549 |
| 84 | Ga0070659_100027022 | 3300005366 | Bacteria | 4418 |
| 85 | Ga0070659_100027216 | 3300005366 | Bacteria | 4403 |
| 86 | Ga0070659_100168539 | 3300005366 | Bacteria | 1793 |
| 87 | Ga0070667_100007635 | 3300005367 | Bacteria | 8971 |
| 88 | Ga0070667_100010847 | 3300005367 | Bacteria | 7534 |
| 89 | Ga0070667_100026761 | 3300005367 | Bacteria | 4799 |
| 90 | Ga0070667_100171120 | 3300005367 | Bacteria | 1917 |
| 91 | Ga0070667_100203747 | 3300005367 | Bacteria | 1756 |
| 92 | Ga0070709_10072007 | 3300005434 | Bacteria | 2233 |
| 93 | Ga0070709_10108278 | 3300005434 | Bacteria | 1864 |
| 94 | Ga0070714_100008331 | 3300005435 | Bacteria | 8088 |
| 95 | Ga0070714_100021200 | 3300005435 | Bacteria | 5314 |
| 96 | Ga0070713_100147307 | 3300005436 | Bacteria | 2091 |
| 97 | Ga0070713_100245381 | 3300005436 | Bacteria | 1632 |
| 98 | Ga0070701_10006671 | 3300005438 | Bacteria | 4874 |
| 99 | Ga0070701_10178619 | 3300005438 | Bacteria | 1241 |
| 100 | Ga0070705_100097872 | 3300005440 | Bacteria | 1845 |
| 101 | Ga0070700_100003437 | 3300005441 | Bacteria | 8167 |
| 102 | Ga0070700_100043889 | 3300005441 | Bacteria | 2751 |
| 103 | Ga0070694_100124288 | 3300005444 | Bacteria | 1855 |
| 104 | Ga0070663_100003931 | 3300005455 | Bacteria | 8666 |
| 105 | Ga0070663_100004128 | 3300005455 | Bacteria | 8487 |
| 106 | Ga0070663_100047935 | 3300005455 | Bacteria | 3028 |
| 107 | Ga0070678_100001904 | 3300005456 | Bacteria | 11247 |
| 108 | Ga0070678_100069755 | 3300005456 | Bacteria | 2625 |
| 109 | Ga0070678_100150461 | 3300005456 | Bacteria | 1874 |
| 110 | Ga0070678_100241425 | 3300005456 | Bacteria | 1511 |
| 111 | Ga0070662_100000231 | 3300005457 | Bacteria | 32882 |
| 112 | Ga0070662_100298379 | 3300005457 | Bacteria | 1308 |
| 113 | Ga0070662_100339856 | 3300005457 | Bacteria | 1228 |
| 114 | Ga0070681_10001697 | 3300005458 | Bacteria | 19691 |
| 115 | Ga0070681_10046933 | 3300005458 | Bacteria | 4318 |
| 116 | Ga0068867_100025632 | 3300005459 | Bacteria | 4232 |
| 117 | Ga0068867_100085484 | 3300005459 | Bacteria | 2385 |
| 118 | Ga0068867_100105010 | 3300005459 | Bacteria | 2163 |
| 119 | Ga0068867_100174181 | 3300005459 | Bacteria | 1706 |
| 120 | Ga0070679_100031634 | 3300005530 | Bacteria | 5230 |
| 121 | Ga0070679_100055491 | 3300005530 | Bacteria | 3944 |
| 122 | Ga0070679_100262633 | 3300005530 | Bacteria | 1682 |
| 123 | Ga0070684_100006951 | 3300005535 | Bacteria | 8790 |
| 124 | Ga0070684_100016618 | 3300005535 | Bacteria | 6018 |
| 125 | Ga0070684_100098053 | 3300005535 | Bacteria | 2614 |
| 126 | Ga0068853_100016067 | 3300005539 | Bacteria | 6156 |
| 127 | Ga0068853_100018749 | 3300005539 | Bacteria | 5731 |
| 128 | Ga0068853_100019246 | 3300005539 | Bacteria | 5658 |
| 129 | Ga0068853_100256372 | 3300005539 | Bacteria | 1607 |
| 130 | Ga0068853_100668065 | 3300005539 | Bacteria | 990 |
| 131 | Ga0070672_100000824 | 3300005543 | Bacteria | 18534 |
| 132 | Ga0070672_100001034 | 3300005543 | Bacteria | 16942 |
| 133 | Ga0070672_100136110 | 3300005543 | Bacteria | 2023 |
| 134 | Ga0070695_100361054 | 3300005545 | Bacteria | 1091 |
| 135 | Ga0070693_100151350 | 3300005547 | Bacteria | 1470 |
| 136 | Ga0070693_100336782 | 3300005547 | Bacteria | 1028 |
| 137 | Ga0070665_100021679 | 3300005548 | Bacteria | 6460 |
| 138 | Ga0070665_100201467 | 3300005548 | Bacteria | 1991 |
| 139 | Ga0070704_100033352 | 3300005549 | Bacteria | 3480 |
| 140 | Ga0070704_100157512 | 3300005549 | Bacteria | 1793 |
| 141 | Ga0068855_100003881 | 3300005563 | Bacteria | 18269 |
| 142 | Ga0068855_100016354 | 3300005563 | Bacteria | 8921 |
| 143 | Ga0068855_100133982 | 3300005563 | Bacteria | 2827 |
| 144 | Ga0068855_100393642 | 3300005563 | Bacteria | 1519 |
| 145 | Ga0068855_100792755 | 3300005563 | Bacteria | 1007 |
| 146 | Ga0070664_100001653 | 3300005564 | Bacteria | 17820 |
| 147 | Ga0070664_100006016 | 3300005564 | Bacteria | 9809 |
| 148 | Ga0070664_100051878 | 3300005564 | Bacteria | 3473 |
| 149 | Ga0070664_100080532 | 3300005564 | Bacteria | 2805 |
| 150 | Ga0070664_100099768 | 3300005564 | Bacteria | 2524 |
| 151 | Ga0070664_100211756 | 3300005564 | Bacteria | 1732 |
| 152 | Ga0068857_100001618 | 3300005577 | Bacteria | 18074 |
| 153 | Ga0068857_100003665 | 3300005577 | Bacteria | 12869 |
| 154 | Ga0068857_100007108 | 3300005577 | Bacteria | 9643 |
| 155 | Ga0068857_100071383 | 3300005577 | Bacteria | 3093 |
| 156 | Ga0068857_100122755 | 3300005577 | Bacteria | 2340 |
| 157 | Ga0068854_100033434 | 3300005578 | Bacteria | 3585 |
| 158 | Ga0068854_100041971 | 3300005578 | Bacteria | 3235 |
| 159 | Ga0068854_100043770 | 3300005578 | Bacteria | 3175 |
| 160 | Ga0068854_100049070 | 3300005578 | Bacteria | 3014 |
| 161 | Ga0068856_100000352 | 3300005614 | Bacteria | 50157 |
| 162 | Ga0068856_100002212 | 3300005614 | Bacteria | 20140 |
| 163 | Ga0068856_100010244 | 3300005614 | Bacteria | 9112 |
| 164 | Ga0068856_100023580 | 3300005614 | Bacteria | 5983 |
| 165 | Ga0068856_100082032 | 3300005614 | Bacteria | 3200 |
| 166 | Ga0068856_100485290 | 3300005614 | Bacteria | 1257 |
| 167 | Ga0070702_100004488 | 3300005615 | Bacteria | 6379 |
| 168 | Ga0070702_100176194 | 3300005615 | Bacteria | 1395 |
| 169 | Ga0068852_100000773 | 3300005616 | Bacteria | 21097 |
| 170 | Ga0068852_100005811 | 3300005616 | Bacteria | 8858 |
| 171 | Ga0068852_100025659 | 3300005616 | Bacteria | 4778 |
| 172 | Ga0068852_100039439 | 3300005616 | Bacteria | 3976 |
| 173 | Ga0068852_100120862 | 3300005616 | Bacteria | 2398 |
| 174 | Ga0068859_100027011 | 3300005617 | Bacteria | 5758 |
| 175 | Ga0068859_100118329 | 3300005617 | Bacteria | 2715 |
| 176 | Ga0068864_100003658 | 3300005618 | Bacteria | 12713 |
| 177 | Ga0068864_100014257 | 3300005618 | Bacteria | 6600 |
| 178 | Ga0068866_10024168 | 3300005718 | Bacteria | 2836 |
| 179 | Ga0068861_100012379 | 3300005719 | Bacteria | 5949 |
| 180 | Ga0068861_100013855 | 3300005719 | Bacteria | 5650 |
| 181 | Ga0068861_100036482 | 3300005719 | Bacteria | 3648 |
| 182 | Ga0068861_100247724 | 3300005719 | Bacteria | 1519 |
| 183 | Ga0068861_100312575 | 3300005719 | Bacteria | 1365 |
| 184 | Ga0068851_10001455 | 3300005834 | Bacteria | 10374 |
| 185 | Ga0068851_10003070 | 3300005834 | Bacteria | 7388 |
| 186 | Ga0068851_10004826 | 3300005834 | Bacteria | 6103 |
| 187 | Ga0068851_10004891 | 3300005834 | Bacteria | 6069 |
| 188 | Ga0068851_10017890 | 3300005834 | Bacteria | 3411 |
| 189 | Ga0068851_10048826 | 3300005834 | Bacteria | 2145 |
| 190 | Ga0068870_10021432 | 3300005840 | Bacteria | 3161 |
| 191 | Ga0068870_10025835 | 3300005840 | Bacteria | 2920 |
| 192 | Ga0068863_100010535 | 3300005841 | Bacteria | 8978 |
| 193 | Ga0068863_100021979 | 3300005841 | Bacteria | 6088 |
| 194 | Ga0068863_100038684 | 3300005841 | Bacteria | 4537 |
| 195 | Ga0068863_100097455 | 3300005841 | Bacteria | 2793 |
| 196 | Ga0068863_100105963 | 3300005841 | Bacteria | 2675 |
| 197 | Ga0068858_100004907 | 3300005842 | Bacteria | 13110 |
| 198 | Ga0068858_100050068 | 3300005842 | Bacteria | 3866 |
| 199 | Ga0068858_100365351 | 3300005842 | Bacteria | 1383 |
| 200 | Ga0068860_100023880 | 3300005843 | Bacteria | 5910 |
| 201 | Ga0068860_100035130 | 3300005843 | Bacteria | 4809 |
| 202 | Ga0068860_100246236 | 3300005843 | Bacteria | 1740 |
| 203 | Ga0068860_100430199 | 3300005843 | Bacteria | 1310 |
| 204 | Ga0068862_100002754 | 3300005844 | Bacteria | 15415 |
| 205 | Ga0068862_100041670 | 3300005844 | Bacteria | 3907 |
| 206 | Ga0068862_100069554 | 3300005844 | Bacteria | 3038 |
| 207 | Ga0068862_100093716 | 3300005844 | Bacteria | 2619 |
| 208 | Ga0068862_100181208 | 3300005844 | Bacteria | 1891 |
| 209 | Ga0075365_10039010 | 3300006038 | Bacteria | 3091 |
| 210 | Ga0097621_100028347 | 3300006237 | Bacteria | 4413 |
| 211 | Ga0097621_100178212 | 3300006237 | Bacteria | 1835 |
| 212 | Ga0068871_100197758 | 3300006358 | Bacteria | 1734 |
| 213 | Ga0075428_100333134 | 3300006844 | Bacteria | 1630 |
| 214 | Ga0075430_100185269 | 3300006846 | Bacteria | 1731 |
| 215 | Ga0075434_100072667 | 3300006871 | Bacteria | 3431 |
| 216 | Ga0075434_100144958 | 3300006871 | Bacteria | 2395 |
| 217 | Ga0075434_100294240 | 3300006871 | Bacteria | 1643 |
| 218 | Ga0075434_100611294 | 3300006871 | Bacteria | 1109 |
| 219 | Ga0068865_100017947 | 3300006881 | Bacteria | 4559 |
| 220 | Ga0068865_100172881 | 3300006881 | Bacteria | 1658 |
| 221 | Ga0097620_100027012 | 3300006931 | Bacteria | 5758 |
| 222 | Ga0097620_100118327 | 3300006931 | Bacteria | 2715 |
| 223 | Ga0105240_10006454 | 3300009093 | Bacteria | 17236 |
| 224 | Ga0105240_10027454 | 3300009093 | Bacteria | 7450 |
| 225 | Ga0105240_10077525 | 3300009093 | Bacteria | 4094 |
| 226 | Ga0105240_10184091 | 3300009093 | Bacteria | 2462 |
| 227 | Ga0111539_10005900 | 3300009094 | Bacteria | 15822 |
| 228 | Ga0111539_10602031 | 3300009094 | Bacteria | 1280 |
| 229 | Ga0105245_10073338 | 3300009098 | Bacteria | 3112 |
| 230 | Ga0105245_10162224 | 3300009098 | Bacteria | 2122 |
| 231 | Ga0105247_10076894 | 3300009101 | Bacteria | 2097 |
| 232 | Ga0105243_10070666 | 3300009148 | Bacteria | 2820 |
| 233 | Ga0105241_10008892 | 3300009174 | Bacteria | 7387 |
| 234 | Ga0105241_10098206 | 3300009174 | Bacteria | 2323 |
| 235 | Ga0105241_10198326 | 3300009174 | Bacteria | 1675 |
| 236 | Ga0105248_10002044 | 3300009177 | Bacteria | 22366 |
| 237 | Ga0105248_10544378 | 3300009177 | Bacteria | 1309 |
| 238 | Ga0105237_10091743 | 3300009545 | Bacteria | 3027 |
| 239 | Ga0105237_10097875 | 3300009545 | Bacteria | 2925 |
| 240 | Ga0105237_10156383 | 3300009545 | Bacteria | 2277 |
| 241 | Ga0105238_10002047 | 3300009551 | Bacteria | 20346 |
| 242 | Ga0105238_10016725 | 3300009551 | Bacteria | 7432 |
| 243 | Ga0105238_10429890 | 3300009551 | Bacteria | 1316 |
| 244 | Ga0105249_10137822 | 3300009553 | Bacteria | 2337 |
| 245 | Ga0105249_10314581 | 3300009553 | Bacteria | 1575 |
| 246 | Ga0105249_10443664 | 3300009553 | Bacteria | 1335 |
| 247 | Ga0105239_10085572 | 3300010375 | Bacteria | 3475 |
| 248 | Ga0105239_10198582 | 3300010375 | Bacteria | 2247 |
| 249 | Ga0157373_10004347 | 3300013100 | Bacteria | 10669 |
| 250 | Ga0157373_10068500 | 3300013100 | Bacteria | 2508 |
| 251 | Ga0157373_10190282 | 3300013100 | Bacteria | 1446 |
| 252 | Ga0157371_10002076 | 3300013102 | Bacteria | 19624 |
| 253 | Ga0157371_10136062 | 3300013102 | Bacteria | 1750 |
| 254 | Ga0157371_10487890 | 3300013102 | Bacteria | 909 |
| 255 | Ga0157370_10013300 | 3300013104 | Bacteria | 8479 |
| 256 | Ga0157370_10081387 | 3300013104 | Bacteria | 3047 |
| 257 | Ga0157370_10204802 | 3300013104 | Bacteria | 1830 |
| 258 | Ga0157369_10002386 | 3300013105 | Bacteria | 22557 |
| 259 | Ga0157369_10033327 | 3300013105 | Bacteria | 5661 |
| 260 | Ga0157369_10042950 | 3300013105 | Bacteria | 4929 |
| 261 | Ga0157369_10190744 | 3300013105 | Bacteria | 2154 |
| 262 | Ga0157369_10399605 | 3300013105 | Bacteria | 1426 |
| 263 | Ga0157374_10037309 | 3300013296 | Bacteria | 4460 |
| 264 | Ga0157374_10049729 | 3300013296 | Bacteria | 3895 |
| 265 | Ga0157374_10192978 | 3300013296 | Bacteria | 1992 |
| 266 | Ga0157378_10032926 | 3300013297 | Bacteria | 4582 |
| 267 | Ga0157378_10060540 | 3300013297 | Bacteria | 3378 |
| 268 | Ga0157378_10069151 | 3300013297 | Bacteria | 3167 |
| 269 | Ga0157378_10095255 | 3300013297 | Bacteria | 2711 |
| 270 | Ga0163162_10142153 | 3300013306 | Bacteria | 2514 |
| 271 | Ga0163162_10449192 | 3300013306 | Bacteria | 1421 |
| 272 | Ga0157372_10000868 | 3300013307 | Bacteria | 32826 |
| 273 | Ga0157372_10019933 | 3300013307 | Bacteria | 7229 |
| 274 | Ga0157372_10069597 | 3300013307 | Bacteria | 3958 |
| 275 | Ga0157372_10080809 | 3300013307 | Bacteria | 3679 |
| 276 | Ga0157372_10148857 | 3300013307 | Bacteria | 2701 |
| 277 | Ga0157372_10188652 | 3300013307 | Bacteria | 2387 |
| 278 | Ga0157372_10467578 | 3300013307 | Bacteria | 1470 |
| 279 | Ga0157372_10709150 | 3300013307 | Bacteria | 1171 |
| 280 | Ga0157375_10011825 | 3300013308 | Bacteria | 7717 |
| 281 | Ga0157375_10041809 | 3300013308 | Bacteria | 4430 |
| 282 | Ga0157375_10179913 | 3300013308 | Bacteria | 2266 |
| 283 | Ga0163163_10001567 | 3300014325 | Bacteria | 19293 |
| 284 | Ga0163163_10071035 | 3300014325 | Bacteria | 3468 |
| 285 | Ga0163163_10639020 | 3300014325 | Bacteria | 1128 |
| 286 | Ga0157380_10011224 | 3300014326 | Bacteria | 6468 |
| 287 | Ga0157380_10031222 | 3300014326 | Bacteria | 4089 |
| 288 | Ga0157380_10194692 | 3300014326 | Bacteria | 1793 |
| 289 | Ga0182008_10034474 | 3300014497 | Bacteria | 2538 |
| 290 | Ga0157377_10003604 | 3300014745 | Bacteria | 7013 |
| 291 | Ga0157379_10001124 | 3300014968 | Bacteria | 21866 |
| 292 | Ga0157379_10009433 | 3300014968 | Bacteria | 8502 |
| 293 | Ga0157379_10057028 | 3300014968 | Bacteria | 3491 |
| 294 | Ga0157376_10037088 | 3300014969 | Bacteria | 3953 |
| 295 | Ga0157376_10081210 | 3300014969 | Bacteria | 2783 |
| 296 | Ga0157376_10606584 | 3300014969 | Bacteria | 1090 |
| 297 | Ga0183360_10001 | 3300015689 | Bacteria | 3943671 |
| 298 | Ga0163161_10019802 | 3300017792 | Bacteria | 4722 |
| 299 | Ga0207425_1004282 | 3300025245 | Bacteria | 4330 |
| 300 | Ga0209565_1000005 | 3300025263 | Bacteria | 947317 |
| 301 | Ga0207666_1001999 | 3300025271 | Bacteria | 2435 |
| 302 | Ga0209673_1000011 | 3300025273 | Bacteria | 586604 |
| 303 | Ga0209673_1003898 | 3300025273 | Bacteria | 8393 |
| 304 | Ga0209130_1005666 | 3300025284 | Bacteria | 4267 |
| 305 | Ga0209675_1000004 | 3300025291 | Bacteria | 947166 |
| 306 | Ga0209675_1005300 | 3300025291 | Bacteria | 5430 |
| 307 | Ga0209675_1010527 | 3300025291 | Bacteria | 3148 |
| 308 | Ga0209676_1000472 | 3300025292 | Bacteria | 67063 |
| 309 | Ga0209676_1000857 | 3300025292 | Bacteria | 39244 |
| 310 | Ga0209676_1001048 | 3300025292 | Bacteria | 31833 |
| 311 | Ga0209676_1002293 | 3300025292 | Bacteria | 13961 |
| 312 | Ga0209025_1000005 | 3300025294 | Bacteria | 1272149 |
| 313 | Ga0209025_1001267 | 3300025294 | Bacteria | 34816 |
| 314 | Ga0209025_1013136 | 3300025294 | Bacteria | 5229 |
| 315 | Ga0209564_1000018 | 3300025295 | Bacteria | 586913 |
| 316 | Ga0209564_1006241 | 3300025295 | Bacteria | 6501 |
| 317 | Ga0209758_1034629 | 3300025297 | Bacteria | 2005 |
| 318 | Ga0209050_1001432 | 3300025298 | Bacteria | 25688 |
| 319 | Ga0209256_1000031 | 3300025299 | Bacteria | 410189 |
| 320 | Ga0209256_1001506 | 3300025299 | Bacteria | 23600 |
| 321 | Ga0209256_1004781 | 3300025299 | Bacteria | 8237 |
| 322 | Ga0209256_1007727 | 3300025299 | Bacteria | 5207 |
| 323 | Ga0209051_1025684 | 3300025303 | Bacteria | 2391 |
| 324 | Ga0209257_1000255 | 3300025304 | Bacteria | 123098 |
| 325 | Ga0209257_1000715 | 3300025304 | Bacteria | 51044 |
| 326 | Ga0209257_1001117 | 3300025304 | Bacteria | 34675 |
| 327 | Ga0209257_1003071 | 3300025304 | Bacteria | 15043 |
| 328 | Ga0209257_1003627 | 3300025304 | Bacteria | 12981 |
| 329 | Ga0207697_10000570 | 3300025315 | Bacteria | 20951 |
| 330 | Ga0207697_10041953 | 3300025315 | Bacteria | 1879 |
| 331 | Ga0207656_10001877 | 3300025321 | Bacteria | 6990 |
| 332 | Ga0207656_10010980 | 3300025321 | Bacteria | 3409 |
| 333 | Ga0207656_10015078 | 3300025321 | Bacteria | 2987 |
| 334 | Ga0207656_10016205 | 3300025321 | Bacteria | 2899 |
| 335 | Ga0207656_10020774 | 3300025321 | Bacteria | 2613 |
| 336 | Ga0207656_10047132 | 3300025321 | Bacteria | 1852 |
| 337 | Ga0207682_10000037 | 3300025893 | Bacteria | 54103 |
| 338 | Ga0207682_10001668 | 3300025893 | Bacteria | 10184 |
| 339 | Ga0207642_10082365 | 3300025899 | Bacteria | 1566 |
| 340 | Ga0207688_10001415 | 3300025901 | Bacteria | 12502 |
| 341 | Ga0207680_10061796 | 3300025903 | Bacteria | 2285 |
| 342 | Ga0207680_10100108 | 3300025903 | Bacteria | 1861 |
| 343 | Ga0207647_10097086 | 3300025904 | Bacteria | 1753 |
| 344 | Ga0207647_10138966 | 3300025904 | Bacteria | 1424 |
| 345 | Ga0207645_10001825 | 3300025907 | Bacteria | 17179 |
| 346 | Ga0207645_10008253 | 3300025907 | Bacteria | 7280 |
| 347 | Ga0207645_10049429 | 3300025907 | Bacteria | 2685 |
| 348 | Ga0207643_10000184 | 3300025908 | Bacteria | 43056 |
| 349 | Ga0207643_10025680 | 3300025908 | Bacteria | 3258 |
| 350 | Ga0207705_10079161 | 3300025909 | Bacteria | 2393 |
| 351 | Ga0207705_10268454 | 3300025909 | Bacteria | 1304 |
| 352 | Ga0207654_10022758 | 3300025911 | Bacteria | 3348 |
| 353 | Ga0207654_10057677 | 3300025911 | Bacteria | 2257 |
| 354 | Ga0207654_10235128 | 3300025911 | Bacteria | 1222 |
| 355 | Ga0207654_10364875 | 3300025911 | Bacteria | 997 |
| 356 | Ga0207707_10001968 | 3300025912 | Bacteria | 18649 |
| 357 | Ga0207707_10002953 | 3300025912 | Bacteria | 15142 |
| 358 | Ga0207707_10007126 | 3300025912 | Bacteria | 9741 |
| 359 | Ga0207695_10008152 | 3300025913 | Bacteria | 13173 |
| 360 | Ga0207695_10104624 | 3300025913 | Bacteria | 2819 |
| 361 | Ga0207695_10126634 | 3300025913 | Bacteria | 2515 |
| 362 | Ga0207671_10056139 | 3300025914 | Bacteria | 2917 |
| 363 | Ga0207663_10112901 | 3300025916 | Bacteria | 1847 |
| 364 | Ga0207663_10212871 | 3300025916 | Bacteria | 1402 |
| 365 | Ga0207660_10016235 | 3300025917 | Bacteria | 4927 |
| 366 | Ga0207660_10031286 | 3300025917 | Bacteria | 3662 |
| 367 | Ga0207660_10044661 | 3300025917 | Bacteria | 3117 |
| 368 | Ga0207662_10000381 | 3300025918 | Bacteria | 19870 |
| 369 | Ga0207657_10000102 | 3300025919 | Bacteria | 82096 |
| 370 | Ga0207657_10002428 | 3300025919 | Bacteria | 20129 |
| 371 | Ga0207657_10009399 | 3300025919 | Bacteria | 9831 |
| 372 | Ga0207657_10011151 | 3300025919 | Bacteria | 8933 |
| 373 | Ga0207657_10036598 | 3300025919 | Bacteria | 4391 |
| 374 | Ga0207657_10126002 | 3300025919 | Bacteria | 2103 |
| 375 | Ga0207657_10140579 | 3300025919 | Bacteria | 1973 |
| 376 | Ga0207649_10002170 | 3300025920 | Bacteria | 11096 |
| 377 | Ga0207649_10051585 | 3300025920 | Bacteria | 2548 |
| 378 | Ga0207649_10081247 | 3300025920 | Bacteria | 2098 |
| 379 | Ga0207649_10095164 | 3300025920 | Bacteria | 1959 |
| 380 | Ga0207649_10129175 | 3300025920 | Bacteria | 1714 |
| 381 | Ga0207652_10023450 | 3300025921 | Bacteria | 5113 |
| 382 | Ga0207652_10057299 | 3300025921 | Bacteria | 3355 |
| 383 | Ga0207652_10179700 | 3300025921 | Bacteria | 1901 |
| 384 | Ga0207681_10037717 | 3300025923 | Bacteria | 3196 |
| 385 | Ga0207681_10038997 | 3300025923 | Bacteria | 3151 |
| 386 | Ga0207681_10042134 | 3300025923 | Bacteria | 3047 |
| 387 | Ga0207694_10001672 | 3300025924 | Bacteria | 18592 |
| 388 | Ga0207694_10034094 | 3300025924 | Bacteria | 3902 |
| 389 | Ga0207650_10000534 | 3300025925 | Bacteria | 31116 |
| 390 | Ga0207650_10008143 | 3300025925 | Bacteria | 7146 |
| 391 | Ga0207659_10000713 | 3300025926 | Bacteria | 19773 |
| 392 | Ga0207659_10114925 | 3300025926 | Bacteria | 2052 |
| 393 | Ga0207687_10218575 | 3300025927 | Bacteria | 1499 |
| 394 | Ga0207700_10281408 | 3300025928 | Bacteria | 1431 |
| 395 | Ga0207664_10035335 | 3300025929 | Bacteria | 3855 |
| 396 | Ga0207664_10118805 | 3300025929 | Bacteria | 2209 |
| 397 | Ga0207664_10524888 | 3300025929 | Bacteria | 1061 |
| 398 | Ga0207644_10009523 | 3300025931 | Bacteria | 6382 |
| 399 | Ga0207644_10014319 | 3300025931 | Bacteria | 5305 |
| 400 | Ga0207644_10031990 | 3300025931 | Bacteria | 3668 |
| 401 | Ga0207644_10204817 | 3300025931 | Bacteria | 1557 |
| 402 | Ga0207644_10409472 | 3300025931 | Bacteria | 1109 |
| 403 | Ga0207690_10027829 | 3300025932 | Bacteria | 3576 |
| 404 | Ga0207690_10041228 | 3300025932 | Bacteria | 3024 |
| 405 | Ga0207690_10091333 | 3300025932 | Bacteria | 2152 |
| 406 | Ga0207690_10117117 | 3300025932 | Bacteria | 1928 |
| 407 | Ga0207706_10002115 | 3300025933 | Bacteria | 19440 |
| 408 | Ga0207706_10053287 | 3300025933 | Bacteria | 3572 |
| 409 | Ga0207706_10100135 | 3300025933 | Bacteria | 2550 |
| 410 | Ga0207709_10280449 | 3300025935 | Bacteria | 1230 |
| 411 | Ga0207670_10026331 | 3300025936 | Bacteria | 3663 |
| 412 | Ga0207669_10003118 | 3300025937 | Bacteria | 7142 |
| 413 | Ga0207704_10107855 | 3300025938 | Bacteria | 1874 |
| 414 | Ga0207691_10000024 | 3300025940 | Bacteria | 132111 |
| 415 | Ga0207691_10013184 | 3300025940 | Bacteria | 7914 |
| 416 | Ga0207691_10018214 | 3300025940 | Bacteria | 6651 |
| 417 | Ga0207691_10041073 | 3300025940 | Bacteria | 4273 |
| 418 | Ga0207691_10063836 | 3300025940 | Bacteria | 3339 |
| 419 | Ga0207691_10200399 | 3300025940 | Bacteria | 1737 |
| 420 | Ga0207711_10008833 | 3300025941 | Bacteria | 8422 |
| 421 | Ga0207711_10023627 | 3300025941 | Bacteria | 5147 |
| 422 | Ga0207711_10037186 | 3300025941 | Bacteria | 4133 |
| 423 | Ga0207689_10000280 | 3300025942 | Bacteria | 46392 |
| 424 | Ga0207689_10002437 | 3300025942 | Bacteria | 17322 |
| 425 | Ga0207689_10075595 | 3300025942 | Bacteria | 2769 |
| 426 | Ga0207689_10123682 | 3300025942 | Bacteria | 2128 |
| 427 | Ga0207661_10024176 | 3300025944 | Bacteria | 4601 |
| 428 | Ga0207661_10063257 | 3300025944 | Bacteria | 2997 |
| 429 | Ga0207661_10119981 | 3300025944 | Bacteria | 2237 |
| 430 | Ga0207679_10006518 | 3300025945 | Bacteria | 7381 |
| 431 | Ga0207679_10013121 | 3300025945 | Bacteria | 5426 |
| 432 | Ga0207679_10016676 | 3300025945 | Bacteria | 4879 |
| 433 | Ga0207679_10158946 | 3300025945 | Bacteria | 1848 |
| 434 | Ga0207679_10246892 | 3300025945 | Bacteria | 1515 |
| 435 | Ga0207679_10433889 | 3300025945 | Bacteria | 1162 |
| 436 | Ga0207667_10000233 | 3300025949 | Bacteria | 77272 |
| 437 | Ga0207667_10018851 | 3300025949 | Bacteria | 7724 |
| 438 | Ga0207667_10025679 | 3300025949 | Bacteria | 6445 |
| 439 | Ga0207667_10044309 | 3300025949 | Bacteria | 4715 |
| 440 | Ga0207667_10090024 | 3300025949 | Bacteria | 3171 |
| 441 | Ga0207667_10225883 | 3300025949 | Bacteria | 1918 |
| 442 | Ga0207667_10260994 | 3300025949 | Bacteria | 1771 |
| 443 | Ga0207651_10004138 | 3300025960 | Bacteria | 7250 |
| 444 | Ga0207651_10028815 | 3300025960 | Bacteria | 3508 |
| 445 | Ga0207651_10076105 | 3300025960 | Bacteria | 2398 |
| 446 | Ga0207651_10114650 | 3300025960 | Bacteria | 2030 |
| 447 | Ga0207712_10167314 | 3300025961 | Bacteria | 1715 |
| 448 | Ga0207712_10459604 | 3300025961 | Bacteria | 1081 |
| 449 | Ga0207668_10175414 | 3300025972 | Bacteria | 1685 |
| 450 | Ga0207668_10244377 | 3300025972 | Bacteria | 1454 |
| 451 | Ga0207668_10535704 | 3300025972 | Bacteria | 1012 |
| 452 | Ga0207640_10016411 | 3300025981 | Bacteria | 4308 |
| 453 | Ga0207640_10046246 | 3300025981 | Bacteria | 2799 |
| 454 | Ga0207640_10182204 | 3300025981 | Bacteria | 1576 |
| 455 | Ga0207658_10003432 | 3300025986 | Bacteria | 11217 |
| 456 | Ga0207658_10009658 | 3300025986 | Bacteria | 6545 |
| 457 | Ga0207658_10013773 | 3300025986 | Bacteria | 5533 |
| 458 | Ga0207658_10127141 | 3300025986 | Bacteria | 2042 |
| 459 | Ga0207658_10128740 | 3300025986 | Bacteria | 2030 |
| 460 | Ga0207658_10173026 | 3300025986 | Bacteria | 1781 |
| 461 | Ga0207677_10030187 | 3300026023 | Bacteria | 3456 |
| 462 | Ga0207677_10041599 | 3300026023 | Bacteria | 3040 |
| 463 | Ga0207677_10329241 | 3300026023 | Bacteria | 1272 |
| 464 | Ga0207677_10437407 | 3300026023 | Bacteria | 1118 |
| 465 | Ga0207703_10001378 | 3300026035 | Bacteria | 22200 |
| 466 | Ga0207703_10037884 | 3300026035 | Bacteria | 3844 |
| 467 | Ga0207703_10041259 | 3300026035 | Bacteria | 3696 |
| 468 | Ga0207703_10062016 | 3300026035 | Bacteria | 3062 |
| 469 | Ga0207703_10186588 | 3300026035 | Bacteria | 1834 |
| 470 | Ga0207703_10478288 | 3300026035 | Bacteria | 1167 |
| 471 | Ga0207639_10027674 | 3300026041 | Bacteria | 4133 |
| 472 | Ga0207639_10042399 | 3300026041 | Bacteria | 3410 |
| 473 | Ga0207639_10082677 | 3300026041 | Bacteria | 2546 |
| 474 | Ga0207639_10461026 | 3300026041 | Bacteria | 1155 |
| 475 | Ga0207639_10616462 | 3300026041 | Bacteria | 1002 |
| 476 | Ga0207678_10002265 | 3300026067 | Bacteria | 17417 |
| 477 | Ga0207678_10012930 | 3300026067 | Bacteria | 7325 |
| 478 | Ga0207678_10012994 | 3300026067 | Bacteria | 7306 |
| 479 | Ga0207678_10018535 | 3300026067 | Bacteria | 6112 |
| 480 | Ga0207678_10038834 | 3300026067 | Bacteria | 4134 |
| 481 | Ga0207678_10316043 | 3300026067 | Bacteria | 1343 |
| 482 | Ga0207708_10002250 | 3300026075 | Bacteria | 14203 |
| 483 | Ga0207708_10076007 | 3300026075 | Bacteria | 2576 |
| 484 | Ga0207702_10000597 | 3300026078 | Bacteria | 39958 |
| 485 | Ga0207702_10002745 | 3300026078 | Bacteria | 16477 |
| 486 | Ga0207702_10003655 | 3300026078 | Bacteria | 13933 |
| 487 | Ga0207641_10008312 | 3300026088 | Bacteria | 8577 |
| 488 | Ga0207641_10008392 | 3300026088 | Bacteria | 8535 |
| 489 | Ga0207641_10012888 | 3300026088 | Bacteria | 6859 |
| 490 | Ga0207641_10132766 | 3300026088 | Bacteria | 2237 |
| 491 | Ga0207641_10362301 | 3300026088 | Bacteria | 1384 |
| 492 | Ga0207648_10001593 | 3300026089 | Bacteria | 24841 |
| 493 | Ga0207648_10005178 | 3300026089 | Bacteria | 13201 |
| 494 | Ga0207648_10010379 | 3300026089 | Bacteria | 8830 |
| 495 | Ga0207648_10023595 | 3300026089 | Bacteria | 5508 |
| 496 | Ga0207648_10271111 | 3300026089 | Bacteria | 1516 |
| 497 | Ga0207648_10846984 | 3300026089 | Bacteria | 853 |
| 498 | Ga0207676_10003016 | 3300026095 | Bacteria | 12009 |
| 499 | Ga0207676_10084873 | 3300026095 | Bacteria | 2582 |
| 500 | Ga0207676_10089313 | 3300026095 | Bacteria | 2525 |
| 501 | Ga0207676_10619444 | 3300026095 | Bacteria | 1041 |
| 502 | Ga0207674_10001568 | 3300026116 | Bacteria | 29439 |
| 503 | Ga0207674_10002723 | 3300026116 | Bacteria | 22045 |
| 504 | Ga0207674_10007142 | 3300026116 | Bacteria | 13045 |
| 505 | Ga0207674_10010383 | 3300026116 | Bacteria | 10553 |
| 506 | Ga0207674_10541571 | 3300026116 | Bacteria | 1125 |
| 507 | Ga0207675_100000538 | 3300026118 | Bacteria | 36903 |
| 508 | Ga0207675_100000981 | 3300026118 | Bacteria | 28343 |
| 509 | Ga0207675_100019499 | 3300026118 | Bacteria | 6329 |
| 510 | Ga0207675_100294357 | 3300026118 | Bacteria | 1580 |
| 511 | Ga0207683_10000012 | 3300026121 | Bacteria | 134768 |
| 512 | Ga0207683_10002415 | 3300026121 | Bacteria | 16316 |
| 513 | Ga0207683_10209360 | 3300026121 | Bacteria | 1774 |
| 514 | Ga0207698_10002317 | 3300026142 | Bacteria | 11278 |
| 515 | Ga0207698_10009337 | 3300026142 | Bacteria | 6250 |
| 516 | Ga0207698_10042564 | 3300026142 | Bacteria | 3394 |
| 517 | Ga0207698_10066748 | 3300026142 | Bacteria | 2833 |
| 518 | Ga0207698_10099409 | 3300026142 | Bacteria | 2406 |
| 519 | Ga0207698_10149715 | 3300026142 | Bacteria | 2023 |
| 520 | Ga0209969_1007075 | 3300027360 | Bacteria | 1583 |
| 521 | Ga0209983_1010239 | 3300027665 | Bacteria | 1915 |
| 522 | Ga0209971_1003476 | 3300027682 | Bacteria | 3735 |
| 523 | Ga0209974_10001787 | 3300027876 | Bacteria | 7838 |
| 524 | Ga0209974_10007961 | 3300027876 | Bacteria | 3634 |
| 525 | Ga0207428_10104165 | 3300027907 | Bacteria | 2190 |
| 526 | Ga0268266_10012004 | 3300028379 | Bacteria | 7497 |
| 527 | Ga0268266_10014078 | 3300028379 | Bacteria | 6885 |
| 528 | Ga0268266_10014494 | 3300028379 | Bacteria | 6775 |
| 529 | Ga0268266_10170524 | 3300028379 | Bacteria | 1975 |
| 530 | Ga0268265_10108423 | 3300028380 | Bacteria | 2261 |
| 531 | Ga0268265_10316915 | 3300028380 | Bacteria | 1410 |
| 532 | Ga0268264_10000715 | 3300028381 | Bacteria | 38163 |
| 533 | Ga0268264_10070958 | 3300028381 | Bacteria | 2950 |
| 534 | Ga0268264_10103801 | 3300028381 | Bacteria | 2476 |
| 535 | Ga0268264_10247456 | 3300028381 | Bacteria | 1654 |
| 536 | Ga0316176_1170459 | 3300030732 | Bacteria | 3648 |
| 537 | Ga0314311_1038789 | 3300030733 | Bacteria | 3996 |
| 538 | Ga0307408_100012994 | 3300031548 | Bacteria | 5521 |
| 539 | Ga0307408_100230229 | 3300031548 | Bacteria | 1517 |
| 540 | Ga0307408_100337856 | 3300031548 | Bacteria | 1274 |
| 541 | Ga0316576_10044230 | 3300031727 | Bacteria | 3216 |
| 542 | Ga0316576_10044602 | 3300031727 | Bacteria | 3203 |
| 543 | Ga0316576_10246947 | 3300031727 | Bacteria | 1340 |
| 544 | Ga0316578_10208925 | 3300031728 | Bacteria | 1174 |
| 545 | Ga0307405_10006485 | 3300031731 | Bacteria | 5759 |
| 546 | Ga0307405_10083844 | 3300031731 | Bacteria | 2090 |
| 547 | Ga0307405_10093808 | 3300031731 | Bacteria | 1995 |
| 548 | Ga0307405_10265139 | 3300031731 | Bacteria | 1285 |
| 549 | Ga0316577_10125339 | 3300031733 | Bacteria | 1444 |
| 550 | Ga0307413_10000671 | 3300031824 | Bacteria | 11682 |
| 551 | Ga0307413_10168424 | 3300031824 | Bacteria | 1547 |
| 552 | Ga0307410_10053119 | 3300031852 | Bacteria | 2740 |
| 553 | Ga0307410_10278215 | 3300031852 | Bacteria | 1312 |
| 554 | Ga0307410_10368776 | 3300031852 | Bacteria | 1152 |
| 555 | Ga0307406_10002817 | 3300031901 | Bacteria | 9480 |
| 556 | Ga0307406_10010659 | 3300031901 | Bacteria | 5191 |
| 557 | Ga0307406_10076680 | 3300031901 | Bacteria | 2209 |
| 558 | Ga0307407_10026799 | 3300031903 | Bacteria | 3057 |
| 559 | Ga0307412_10048448 | 3300031911 | Bacteria | 2795 |
| 560 | Ga0307412_10052107 | 3300031911 | Bacteria | 2708 |
| 561 | Ga0307412_10148000 | 3300031911 | Bacteria | 1729 |
| 562 | Ga0307409_100006853 | 3300031995 | Bacteria | 6750 |
| 563 | Ga0307409_100073753 | 3300031995 | Bacteria | 2724 |
| 564 | Ga0307409_100217339 | 3300031995 | Bacteria | 1723 |
| 565 | Ga0307409_100299231 | 3300031995 | Bacteria | 1496 |
| 566 | Ga0307416_100034049 | 3300032002 | Bacteria | 3871 |
| 567 | Ga0307416_100071084 | 3300032002 | Bacteria | 2889 |
| 568 | Ga0307416_100117996 | 3300032002 | Bacteria | 2357 |
| 569 | Ga0307416_100355603 | 3300032002 | Bacteria | 1484 |
| 570 | Ga0307416_100510597 | 3300032002 | Bacteria | 1268 |
| 571 | Ga0307414_10015482 | 3300032004 | Bacteria | 4603 |
| 572 | Ga0307414_10216998 | 3300032004 | Bacteria | 1568 |
| 573 | Ga0307414_10247562 | 3300032004 | Bacteria | 1479 |
| 574 | Ga0307411_10000781 | 3300032005 | Bacteria | 11792 |
| 575 | Ga0307411_10056063 | 3300032005 | Bacteria | 2595 |
| 576 | Ga0307411_10201086 | 3300032005 | Bacteria | 1530 |
| 577 | Ga0307411_10380770 | 3300032005 | Bacteria | 1160 |
| 578 | Ga0307415_100008495 | 3300032126 | Bacteria | 5697 |
| 579 | Ga0373949_0028531 | 3300035090 | Bacteria | 1318 |
| 580 | Ga0373943_0076921 | 3300035170 | Bacteria | 1703 |
| 581 | Ga0373946_0161195 | 3300035171 | Bacteria | 1053 |
| 582 | Ga0373961_0022424 | 3300035241 | Bacteria | 1690 |
| 583 | Ga0316574_0070911 | 3300035398 | Bacteria | 2200 |
| 584 | Ga0316574_0199283 | 3300035398 | Bacteria | 1286 |
| 585 | Ga0316582_0132205 | 3300036647 | Bacteria | 1677 |
| 586 | Ga0316584_0013687 | 3300036712 | Bacteria | 5752 |
| 587 | Ga0316584_0032259 | 3300036712 | Bacteria | 3877 |
| 588 | Ga0373925_0294135 | 3300037068 | Bacteria | 1310 |
| 589 | Ga0395905_0043100 | 3300037471 | Bacteria | 4234 |
| 590 | Ga0242420_015757 | 3300038996 | Bacteria | 1310 |
| 591 | Ga0439447_004281 | 3300041407 | Bacteria | 4952 |
| 592 | Ga0439465_0016994 | 3300041413 | Bacteria | 2270 |
| 593 | Ga0451853_3157308 | 3300041512 | Bacteria | 1378 |
| 594 | Ga0439433_0024590 | 3300041999 | Bacteria | 1358 |
| 595 | Ga0439449_0023590 | 3300042007 | Bacteria | 2300 |
| 596 | Ga0439462_0030597 | 3300042015 | Bacteria | 1424 |
| 597 | Ga0439462_0048193 | 3300042015 | Bacteria | 1143 |
| 598 | Ga0451577_0578595 | 3300042876 | Bacteria | 1019 |
| 599 | Ga0495580_0249396 | 3300046472 | Bacteria | 1216 |
| 600 | Ga0495663_0054621 | 3300046525 | Bacteria | 1244 |
| 601 | Ga0495621_0034478 | 3300046539 | Bacteria | 1749 |
| 602 | Ga0495656_0090655 | 3300046615 | Bacteria | 1397 |
| 603 | Ga0495668_0003858 | 3300046616 | Bacteria | 10961 |
| 604 | Ga0495647_0039929 | 3300046681 | Bacteria | 1781 |
| 605 | Ga0495670_0256772 | 3300046691 | Bacteria | 932 |
| 606 | Ga0495636_0012361 | 3300047318 | Bacteria | 3379 |
| 607 | Ga0495636_0035997 | 3300047318 | Bacteria | 2040 |
| 608 | Ga0495636_0150113 | 3300047318 | Bacteria | 1045 |
| 609 | Ga0496100_0352536 | 3300048903 | Bacteria | 1112 |
| 610 | Ga0496101_0018812 | 3300048904 | Bacteria | 4704 |
| 611 | Ga0496102_0044103 | 3300048905 | Bacteria | 4046 |
| 612 | Ga0496102_0132926 | 3300048905 | Bacteria | 2330 |
| 613 | Ga0496102_0249972 | 3300048905 | Bacteria | 1672 |
| 614 | Ga0496102_0485223 | 3300048905 | Bacteria | 1157 |
| 615 | Ga0496103_0021237 | 3300048906 | Bacteria | 3906 |
| 616 | Ga0496103_0067798 | 3300048906 | Bacteria | 2229 |
| 617 | Ga0496103_0166033 | 3300048906 | Bacteria | 1416 |
| 618 | Ga0496104_0021874 | 3300048907 | Bacteria | 5874 |
| 619 | Ga0496106_0031062 | 3300048909 | Bacteria | 3981 |
| 620 | Ga0496106_0134934 | 3300048909 | Bacteria | 1938 |
| 621 | Ga0496107_0092068 | 3300048910 | Bacteria | 2216 |
| 622 | Ga0496107_0122445 | 3300048910 | Bacteria | 1916 |
| 623 | Ga0496108_0027107 | 3300048911 | Bacteria | 4727 |
| 624 | Ga0496108_0088421 | 3300048911 | Bacteria | 2632 |
| 625 | Ga0496108_0221810 | 3300048911 | Bacteria | 1643 |
| 626 | Ga0496108_0602472 | 3300048911 | Bacteria | 957 |
| 627 | Ga0496109_0018670 | 3300048912 | Bacteria | 6095 |
| 628 | Ga0496109_0053323 | 3300048912 | Bacteria | 3687 |
| 629 | Ga0496109_0081059 | 3300048912 | Bacteria | 2990 |
| 630 | Ga0496110_0010489 | 3300048913 | Bacteria | 7540 |
| 631 | Ga0496110_0320487 | 3300048913 | Bacteria | 1412 |
| 632 | Ga0496111_0021905 | 3300048914 | Bacteria | 4467 |
| 633 | Ga0496112_0003817 | 3300048915 | Bacteria | 12593 |
| 634 | Ga0496112_0199124 | 3300048915 | Bacteria | 1963 |
| 635 | Ga0496113_0385997 | 3300048916 | Bacteria | 1124 |
| 636 | Ga0496114_0024195 | 3300048917 | Bacteria | 4956 |
| 637 | Ga0496121_0002370 | 3300048924 | Bacteria | 28968 |
| 638 | Ga0496124_0206654 | 3300048927 | Bacteria | 1489 |
| 639 | Ga0501032_0037025 | 3300049569 | Bacteria | 3328 |
| 640 | Ga0501034_0173842 | 3300049571 | Bacteria | 2120 |
| 641 | Ga0501038_0047763 | 3300049574 | Bacteria | 3707 |
| 642 | Ga0501039_0072673 | 3300049575 | Bacteria | 2673 |
| 643 | Ga0501040_0307182 | 3300049576 | Bacteria | 1134 |
| 644 | Ga0501042_0171962 | 3300049578 | Bacteria | 1563 |
| 645 | Ga0501043_0061245 | 3300049579 | Bacteria | 2955 |
| 646 | Ga0501046_0311702 | 3300049580 | Bacteria | 1148 |
| 647 | Ga0501047_0205080 | 3300049581 | Bacteria | 1831 |
| 648 | Ga0501071_0107637 | 3300049587 | Bacteria | 2059 |
| 649 | Ga0501072_0105788 | 3300049588 | Bacteria | 2238 |
| 650 | Ga0501072_0117470 | 3300049588 | Bacteria | 2119 |
| 651 | Ga0501202_020523 | 3300049652 | Bacteria | 1314 |
| 652 | Ga0501209_080941 | 3300049656 | Bacteria | 936 |
| 653 | Ga0501223_032335 | 3300049663 | Bacteria | 1018 |
| 654 | Ga0501253_015981 | 3300049683 | Bacteria | 1242 |
| 655 | Ga0501245_022618 | 3300049708 | Bacteria | 993 |
| 656 | Ga0501080_0057521 | 3300049742 | Bacteria | 3620 |
| 657 | Ga0501266_015497 | 3300049763 | Bacteria | 1007 |
| 658 | Ga0501268_001560 | 3300049765 | Bacteria | 2880 |
| 659 | Ga0501270_002433 | 3300049767 | Bacteria | 1906 |
| 660 | Ga0501274_004103 | 3300049771 | Bacteria | 1192 |
| 661 | Ga0501035_0136034 | 3300049822 | Bacteria | 2139 |
| 662 | Ga0501044_0095350 | 3300049823 | Bacteria | 2998 |
| 663 | Ga0501045_0240091 | 3300049824 | Bacteria | 1349 |
| 664 | nmdc:mga0yw44_9694_c1 | 3300050492 | Bacteria | 4887 |
| 665 | nmdc:mga08y16_162705_c1 | 3300050511 | Bacteria | 2319 |
| 666 | nmdc:mga0n895_666919_c1 | 3300050512 | Bacteria | 1038 |
| 667 | nmdc:mga0n895_86311_c1 | 3300050512 | Bacteria | 3134 |
| 668 | nmdc:mga0a205_199027_c1 | 3300050515 | Bacteria | 1894 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300026089 | Ga0207648_10846984 | Ga0207648_108469841 | 199 |
| 2 | 3300025940 | Ga0207691_10200399 | Ga0207691_102003992 | 210 |
| 3 | 3300035398 | Ga0316574_0070911 | Ga0316574_0070911_203_1006 | 231 |
| 4 | 3300035398 | Ga0316574_0199283 | Ga0316574_0199283_260_1063 | 231 |
| 5 | 3300036647 | Ga0316582_0132205 | Ga0316582_0132205_376_1179 | 231 |
| 6 | 3300036712 | Ga0316584_0013687 | Ga0316584_0013687_3847_4650 | 231 |
| 7 | iso_pu_bacteria | 2952252522 | 2952252651 | 236 |
| 8 | 3300005334 | Ga0068869_100101091 | Ga0068869_1001010912 | 241 |
| 9 | 3300005336 | Ga0070680_100154792 | Ga0070680_1001547921 | 241 |
| 10 | 3300005438 | Ga0070701_10178619 | Ga0070701_101786192 | 241 |
| 11 | 3300005441 | Ga0070700_100043889 | Ga0070700_1000438894 | 241 |
| 12 | 3300005444 | Ga0070694_100124288 | Ga0070694_1001242882 | 241 |
| 13 | 3300005545 | Ga0070695_100361054 | Ga0070695_1003610541 | 241 |
| 14 | 3300005549 | Ga0070704_100033352 | Ga0070704_1000333521 | 241 |
| 15 | 3300005719 | Ga0068861_100036482 | Ga0068861_1000364822 | 241 |
| 16 | 3300005844 | Ga0068862_100069554 | Ga0068862_1000695542 | 241 |
| 17 | 3300009148 | Ga0105243_10070666 | Ga0105243_100706662 | 241 |
| 18 | 3300014326 | Ga0157380_10011224 | Ga0157380_100112245 | 241 |
| 19 | 3300014326 | Ga0157380_10194692 | Ga0157380_101946922 | 241 |
| 20 | 3300025917 | Ga0207660_10031286 | Ga0207660_100312862 | 241 |
| 21 | 3300025935 | Ga0207709_10280449 | Ga0207709_102804492 | 241 |
| 22 | 3300025942 | Ga0207689_10075595 | Ga0207689_100755953 | 241 |
| 23 | 3300026075 | Ga0207708_10076007 | Ga0207708_100760074 | 241 |
| 24 | 3300026118 | Ga0207675_100019499 | Ga0207675_1000194992 | 241 |
| 25 | 3300031727 | Ga0316576_10044230 | Ga0316576_100442303 | 241 |
| 26 | 3300031727 | Ga0316576_10044602 | Ga0316576_100446022 | 241 |
| 27 | 3300031727 | Ga0316576_10246947 | Ga0316576_102469472 | 241 |
| 28 | 3300031728 | Ga0316578_10208925 | Ga0316578_102089252 | 241 |
| 29 | 3300031731 | Ga0307405_10265139 | Ga0307405_102651392 | 241 |
| 30 | 3300031733 | Ga0316577_10125339 | Ga0316577_101253392 | 241 |
| 31 | 3300031995 | Ga0307409_100217339 | Ga0307409_1002173393 | 241 |
| 32 | 3300049569 | Ga0501032_0037025 | Ga0501032_0037025_1707_2516 | 242 |
| 33 | 3300049574 | Ga0501038_0047763 | Ga0501038_0047763_2476_3285 | 242 |
| 34 | 3300049575 | Ga0501039_0072673 | Ga0501039_0072673_1608_2417 | 242 |
| 35 | 3300049581 | Ga0501047_0205080 | Ga0501047_0205080_575_1384 | 242 |
| 36 | 3300049588 | Ga0501072_0117470 | Ga0501072_0117470_552_1367 | 242 |
| 37 | 3300049742 | Ga0501080_0057521 | Ga0501080_0057521_1524_2333 | 242 |
| 38 | 3300049822 | Ga0501035_0136034 | Ga0501035_0136034_895_1704 | 242 |
| 39 | 3300049823 | Ga0501044_0095350 | Ga0501044_0095350_746_1555 | 242 |
| 40 | 3300003320 | rootH2_10263331 | rootH2_102633311 | 243 |
| 41 | 3300005337 | Ga0070682_100017775 | Ga0070682_1000177755 | 243 |
| 42 | 3300009098 | Ga0105245_10073338 | Ga0105245_100733385 | 243 |
| 43 | 3300025927 | Ga0207687_10218575 | Ga0207687_102185753 | 243 |
| 44 | 3300049587 | Ga0501071_0107637 | Ga0501071_0107637_1221_2006 | 243 |
| 45 | 3300049588 | Ga0501072_0105788 | Ga0501072_0105788_1002_1817 | 243 |
| 46 | 3300036712 | Ga0316584_0032259 | Ga0316584_0032259_1230_2030 | 248 |
| 47 | iso_pu_bacteria | 2643221559 | 2643818734 | 249 |
| 48 | iso_pu_bacteria | 2643221586 | 2643940985 | 249 |
| 49 | iso_pu_bacteria | 2643221593 | 2643975810 | 249 |
| 50 | iso_pu_bacteria | 2643221612 | 2644079973 | 249 |
| 51 | iso_pu_bacteria | 2643221727 | 2644695568 | 249 |
| 52 | iso_pu_bacteria | 2941489479 | 2941491431 | 249 |
| 53 | iso_pu_bacteria | 2995948881 | 2995952466 | 249 |
| 54 | iso_pu_bacteria | 8003014200 | 8003016311 | 249 |
| 55 | 3300006038 | Ga0075365_10039010 | Ga0075365_100390104 | 251 |
| 56 | 3300009093 | Ga0105240_10184091 | Ga0105240_101840912 | 251 |
| 57 | 3300031911 | Ga0307412_10048448 | Ga0307412_100484482 | 251 |
| 58 | 3300037068 | Ga0373925_0294135 | Ga0373925_0294135_249_1058 | 251 |
| 59 | 3300041999 | Ga0439433_0024590 | Ga0439433_0024590_36_818 | 251 |
| 60 | 3300050492 | nmdc:mga0yw44_9694_c1 | nmdc:mga0yw44_9694_c1_3300_4085 | 251 |
| 61 | 3300003775 | Ga0055524_1000206 | Ga0055524_100020632 | 252 |
| 62 | 3300003781 | Ga0055536_1001400 | Ga0055536_10014002 | 252 |
| 63 | 3300003784 | Ga0055534_1000164 | Ga0055534_100016420 | 252 |
| 64 | 3300003790 | Ga0055528_1000027 | Ga0055528_100002733 | 252 |
| 65 | 3300003791 | Ga0055530_10002733 | Ga0055530_100027335 | 252 |
| 66 | 3300005367 | Ga0070667_100203747 | Ga0070667_1002037473 | 252 |
| 67 | 3300015689 | Ga0183360_10001 | Ga0183360_10001756 | 252 |
| 68 | 3300025245 | Ga0207425_1004282 | Ga0207425_10042822 | 252 |
| 69 | 3300025263 | Ga0209565_1000005 | Ga0209565_1000005366 | 252 |
| 70 | 3300025273 | Ga0209673_1000011 | Ga0209673_100001121 | 252 |
| 71 | 3300025273 | Ga0209673_1003898 | Ga0209673_10038985 | 252 |
| 72 | 3300025284 | Ga0209130_1005666 | Ga0209130_10056663 | 252 |
| 73 | 3300025291 | Ga0209675_1000004 | Ga0209675_1000004366 | 252 |
| 74 | 3300025291 | Ga0209675_1005300 | Ga0209675_10053002 | 252 |
| 75 | 3300025291 | Ga0209675_1010527 | Ga0209675_10105273 | 252 |
| 76 | 3300025292 | Ga0209676_1000472 | Ga0209676_100047211 | 252 |
| 77 | 3300025292 | Ga0209676_1000857 | Ga0209676_100085716 | 252 |
| 78 | 3300025292 | Ga0209676_1001048 | Ga0209676_100104823 | 252 |
| 79 | 3300025292 | Ga0209676_1002293 | Ga0209676_100229314 | 252 |
| 80 | 3300025294 | Ga0209025_1000005 | Ga0209025_100000534 | 252 |
| 81 | 3300025294 | Ga0209025_1001267 | Ga0209025_100126731 | 252 |
| 82 | 3300025294 | Ga0209025_1013136 | Ga0209025_10131367 | 252 |
| 83 | 3300025295 | Ga0209564_1000018 | Ga0209564_100001821 | 252 |
| 84 | 3300025295 | Ga0209564_1006241 | Ga0209564_10062415 | 252 |
| 85 | 3300025297 | Ga0209758_1034629 | Ga0209758_10346292 | 252 |
| 86 | 3300025298 | Ga0209050_1001432 | Ga0209050_100143217 | 252 |
| 87 | 3300025299 | Ga0209256_1000031 | Ga0209256_1000031365 | 252 |
| 88 | 3300025299 | Ga0209256_1001506 | Ga0209256_10015066 | 252 |
| 89 | 3300025299 | Ga0209256_1004781 | Ga0209256_10047812 | 252 |
| 90 | 3300025299 | Ga0209256_1007727 | Ga0209256_10077272 | 252 |
| 91 | 3300025303 | Ga0209051_1025684 | Ga0209051_10256842 | 252 |
| 92 | 3300025304 | Ga0209257_1000255 | Ga0209257_10002555 | 252 |
| 93 | 3300025304 | Ga0209257_1000715 | Ga0209257_100071557 | 252 |
| 94 | 3300025304 | Ga0209257_1001117 | Ga0209257_10011171 | 252 |
| 95 | 3300025304 | Ga0209257_1003071 | Ga0209257_10030715 | 252 |
| 96 | 3300025304 | Ga0209257_1003627 | Ga0209257_10036272 | 252 |
| 97 | 3300025986 | Ga0207658_10173026 | Ga0207658_101730263 | 252 |
| 98 | 3300031901 | Ga0307406_10002817 | Ga0307406_100028172 | 252 |
| 99 | 3300032002 | Ga0307416_100510597 | Ga0307416_1005105972 | 252 |
| 100 | 3300032004 | Ga0307414_10015482 | Ga0307414_100154822 | 252 |
| 101 | 3300041407 | Ga0439447_004281 | Ga0439447_004281_3224_4009 | 252 |
| 102 | 3300041413 | Ga0439465_0016994 | Ga0439465_0016994_620_1405 | 252 |
| 103 | 3300042007 | Ga0439449_0023590 | Ga0439449_0023590_343_1128 | 252 |
| 104 | 3300042015 | Ga0439462_0030597 | Ga0439462_0030597_428_1213 | 252 |
| 105 | 3300042015 | Ga0439462_0048193 | Ga0439462_0048193_306_1091 | 252 |
| 106 | 3300046616 | Ga0495668_0003858 | Ga0495668_0003858_9734_10519 | 252 |
| 107 | 3300047318 | Ga0495636_0012361 | Ga0495636_0012361_2443_3228 | 252 |
| 108 | 3300048924 | Ga0496121_0002370 | Ga0496121_0002370_673_1458 | 252 |
| 109 | 3300049579 | Ga0501043_0061245 | Ga0501043_0061245_348_1133 | 252 |
| 110 | 3300049824 | Ga0501045_0240091 | Ga0501045_0240091_109_894 | 252 |
| 111 | 3300005331 | Ga0070670_100424371 | Ga0070670_1004243711 | 253 |
| 112 | 3300005355 | Ga0070671_100068995 | Ga0070671_1000689952 | 253 |
| 113 | 3300005364 | Ga0070673_100070400 | Ga0070673_1000704003 | 253 |
| 114 | 3300005615 | Ga0070702_100176194 | Ga0070702_1001761942 | 253 |
| 115 | 3300005618 | Ga0068864_100014257 | Ga0068864_1000142575 | 253 |
| 116 | 3300005841 | Ga0068863_100097455 | Ga0068863_1000974552 | 253 |
| 117 | 3300005844 | Ga0068862_100093716 | Ga0068862_1000937163 | 253 |
| 118 | 3300009177 | Ga0105248_10544378 | Ga0105248_105443782 | 253 |
| 119 | 3300025931 | Ga0207644_10204817 | Ga0207644_102048172 | 253 |
| 120 | 3300025960 | Ga0207651_10076105 | Ga0207651_100761052 | 253 |
| 121 | 3300026095 | Ga0207676_10089313 | Ga0207676_100893132 | 253 |
| 122 | 3300030732 | Ga0316176_1170459 | Ga0316176_11704595 | 253 |
| 123 | 3300030733 | Ga0314311_1038789 | Ga0314311_10387896 | 253 |
| 124 | 3300031548 | Ga0307408_100230229 | Ga0307408_1002302292 | 253 |
| 125 | 3300031548 | Ga0307408_100337856 | Ga0307408_1003378562 | 253 |
| 126 | 3300031731 | Ga0307405_10083844 | Ga0307405_100838442 | 253 |
| 127 | 3300031824 | Ga0307413_10168424 | Ga0307413_101684242 | 253 |
| 128 | 3300031852 | Ga0307410_10053119 | Ga0307410_100531194 | 253 |
| 129 | 3300031901 | Ga0307406_10076680 | Ga0307406_100766803 | 253 |
| 130 | 3300032002 | Ga0307416_100071084 | Ga0307416_1000710842 | 253 |
| 131 | 3300032002 | Ga0307416_100117996 | Ga0307416_1001179962 | 253 |
| 132 | 3300032004 | Ga0307414_10247562 | Ga0307414_102475622 | 253 |
| 133 | 3300032005 | Ga0307411_10056063 | Ga0307411_100560632 | 253 |
| 134 | 3300032005 | Ga0307411_10201086 | Ga0307411_102010863 | 253 |
| 135 | 3300046525 | Ga0495663_0054621 | Ga0495663_0054621_235_1032 | 253 |
| 136 | 3300046615 | Ga0495656_0090655 | Ga0495656_0090655_177_974 | 253 |
| 137 | 3300046691 | Ga0495670_0256772 | Ga0495670_0256772_65_862 | 253 |
| 138 | 3300047318 | Ga0495636_0035997 | Ga0495636_0035997_128_925 | 253 |
| 139 | 3300047318 | Ga0495636_0150113 | Ga0495636_0150113_195_992 | 253 |
| 140 | 3300048905 | Ga0496102_0485223 | Ga0496102_0485223_342_1139 | 253 |
| 141 | 3300048910 | Ga0496107_0092068 | Ga0496107_0092068_993_1790 | 253 |
| 142 | 3300048911 | Ga0496108_0602472 | Ga0496108_0602472_15_812 | 253 |
| 143 | 3300048912 | Ga0496109_0053323 | Ga0496109_0053323_835_1632 | 253 |
| 144 | 3300048914 | Ga0496111_0021905 | Ga0496111_0021905_3395_4192 | 253 |
| 145 | 3300048915 | Ga0496112_0199124 | Ga0496112_0199124_579_1376 | 253 |
| 146 | 3300048927 | Ga0496124_0206654 | Ga0496124_0206654_254_1051 | 253 |
| 147 | 3300049652 | Ga0501202_020523 | Ga0501202_020523_38_835 | 253 |
| 148 | 3300049656 | Ga0501209_080941 | Ga0501209_080941_87_884 | 253 |
| 149 | 3300049663 | Ga0501223_032335 | Ga0501223_032335_143_940 | 253 |
| 150 | 3300049683 | Ga0501253_015981 | Ga0501253_015981_195_992 | 253 |
| 151 | 3300049708 | Ga0501245_022618 | Ga0501245_022618_144_941 | 253 |
| 152 | 3300049763 | Ga0501266_015497 | Ga0501266_015497_28_825 | 253 |
| 153 | 3300049765 | Ga0501268_001560 | Ga0501268_001560_553_1350 | 253 |
| 154 | 3300049767 | Ga0501270_002433 | Ga0501270_002433_1035_1832 | 253 |
| 155 | 3300049771 | Ga0501274_004103 | Ga0501274_004103_293_1090 | 253 |
| 156 | 3300005353 | Ga0070669_100049666 | Ga0070669_1000496662 | 254 |
| 157 | 3300041512 | Ga0451853_3157308 | Ga0451853_3157308_449_1252 | 254 |
| 158 | 3300049571 | Ga0501034_0173842 | Ga0501034_0173842_446_1249 | 254 |
| 159 | 3300025904 | Ga0207647_10138966 | Ga0207647_101389662 | 262 |
| 160 | 3300006871 | Ga0075434_100072667 | Ga0075434_1000726671 | 270 |
| 161 | 3300013105 | Ga0157369_10399605 | Ga0157369_103996052 | 271 |
| 162 | 3300025321 | Ga0207656_10047132 | Ga0207656_100471322 | 271 |
| 163 | 3300005293 | Ga0065715_10164276 | Ga0065715_101642761 | 273 |
| 164 | 3300005328 | Ga0070676_10079311 | Ga0070676_100793112 | 273 |
| 165 | 3300005331 | Ga0070670_100010473 | Ga0070670_1000104738 | 273 |
| 166 | 3300005331 | Ga0070670_100016063 | Ga0070670_1000160633 | 273 |
| 167 | 3300005334 | Ga0068869_100002085 | Ga0068869_10000208510 | 273 |
| 168 | 3300005335 | Ga0070666_10103753 | Ga0070666_101037532 | 273 |
| 169 | 3300005343 | Ga0070687_100018652 | Ga0070687_1000186522 | 273 |
| 170 | 3300005353 | Ga0070669_100096618 | Ga0070669_1000966182 | 273 |
| 171 | 3300005364 | Ga0070673_100004665 | Ga0070673_1000046653 | 273 |
| 172 | 3300005365 | Ga0070688_100288542 | Ga0070688_1002885422 | 273 |
| 173 | 3300005367 | Ga0070667_100010847 | Ga0070667_1000108477 | 273 |
| 174 | 3300005440 | Ga0070705_100097872 | Ga0070705_1000978723 | 273 |
| 175 | 3300005459 | Ga0068867_100105010 | Ga0068867_1001050101 | 273 |
| 176 | 3300005459 | Ga0068867_100174181 | Ga0068867_1001741811 | 273 |
| 177 | 3300005577 | Ga0068857_100003665 | Ga0068857_10000366511 | 273 |
| 178 | 3300005578 | Ga0068854_100049070 | Ga0068854_1000490702 | 273 |
| 179 | 3300005617 | Ga0068859_100027011 | Ga0068859_1000270115 | 273 |
| 180 | 3300005618 | Ga0068864_100003658 | Ga0068864_10000365813 | 273 |
| 181 | 3300005719 | Ga0068861_100012379 | Ga0068861_1000123797 | 273 |
| 182 | 3300005841 | Ga0068863_100021979 | Ga0068863_1000219795 | 273 |
| 183 | 3300005841 | Ga0068863_100038684 | Ga0068863_1000386846 | 273 |
| 184 | 3300005841 | Ga0068863_100105963 | Ga0068863_1001059632 | 273 |
| 185 | 3300005843 | Ga0068860_100023880 | Ga0068860_1000238803 | 273 |
| 186 | 3300005843 | Ga0068860_100246236 | Ga0068860_1002462362 | 273 |
| 187 | 3300005843 | Ga0068860_100430199 | Ga0068860_1004301992 | 273 |
| 188 | 3300005844 | Ga0068862_100002754 | Ga0068862_10000275413 | 273 |
| 189 | 3300005844 | Ga0068862_100041670 | Ga0068862_1000416705 | 273 |
| 190 | 3300005844 | Ga0068862_100181208 | Ga0068862_1001812083 | 273 |
| 191 | 3300006871 | Ga0075434_100611294 | Ga0075434_1006112942 | 273 |
| 192 | 3300006881 | Ga0068865_100172881 | Ga0068865_1001728812 | 273 |
| 193 | 3300006931 | Ga0097620_100027012 | Ga0097620_1000270125 | 273 |
| 194 | 3300009094 | Ga0111539_10602031 | Ga0111539_106020312 | 273 |
| 195 | 3300009177 | Ga0105248_10002044 | Ga0105248_1000204420 | 273 |
| 196 | 3300009553 | Ga0105249_10443664 | Ga0105249_104436641 | 273 |
| 197 | 3300013297 | Ga0157378_10069151 | Ga0157378_100691514 | 273 |
| 198 | 3300013308 | Ga0157375_10179913 | Ga0157375_101799132 | 273 |
| 199 | 3300014325 | Ga0163163_10001567 | Ga0163163_100015676 | 273 |
| 200 | 3300014968 | Ga0157379_10001124 | Ga0157379_100011248 | 273 |
| 201 | 3300025899 | Ga0207642_10082365 | Ga0207642_100823652 | 273 |
| 202 | 3300025907 | Ga0207645_10008253 | Ga0207645_100082532 | 273 |
| 203 | 3300025923 | Ga0207681_10037717 | Ga0207681_100377172 | 273 |
| 204 | 3300025923 | Ga0207681_10038997 | Ga0207681_100389972 | 273 |
| 205 | 3300025925 | Ga0207650_10008143 | Ga0207650_100081435 | 273 |
| 206 | 3300025941 | Ga0207711_10008833 | Ga0207711_100088332 | 273 |
| 207 | 3300025942 | Ga0207689_10000280 | Ga0207689_1000028020 | 273 |
| 208 | 3300025961 | Ga0207712_10459604 | Ga0207712_104596041 | 273 |
| 209 | 3300025972 | Ga0207668_10175414 | Ga0207668_101754141 | 273 |
| 210 | 3300025986 | Ga0207658_10009658 | Ga0207658_100096586 | 273 |
| 211 | 3300025986 | Ga0207658_10127141 | Ga0207658_101271412 | 273 |
| 212 | 3300026023 | Ga0207677_10030187 | Ga0207677_100301872 | 273 |
| 213 | 3300026035 | Ga0207703_10001378 | Ga0207703_100013784 | 273 |
| 214 | 3300026088 | Ga0207641_10008312 | Ga0207641_100083125 | 273 |
| 215 | 3300026088 | Ga0207641_10012888 | Ga0207641_100128885 | 273 |
| 216 | 3300026088 | Ga0207641_10362301 | Ga0207641_103623012 | 273 |
| 217 | 3300026089 | Ga0207648_10005178 | Ga0207648_1000517813 | 273 |
| 218 | 3300026095 | Ga0207676_10003016 | Ga0207676_1000301611 | 273 |
| 219 | 3300026116 | Ga0207674_10007142 | Ga0207674_100071423 | 273 |
| 220 | 3300026118 | Ga0207675_100000981 | Ga0207675_10000098115 | 273 |
| 221 | 3300028380 | Ga0268265_10108423 | Ga0268265_101084233 | 273 |
| 222 | 3300028381 | Ga0268264_10000715 | Ga0268264_1000071513 | 273 |
| 223 | 3300028381 | Ga0268264_10070958 | Ga0268264_100709582 | 273 |
| 224 | 3300031731 | Ga0307405_10093808 | Ga0307405_100938082 | 273 |
| 225 | 3300031852 | Ga0307410_10278215 | Ga0307410_102782152 | 273 |
| 226 | 3300031852 | Ga0307410_10368776 | Ga0307410_103687761 | 273 |
| 227 | 3300031911 | Ga0307412_10148000 | Ga0307412_101480003 | 273 |
| 228 | 3300031995 | Ga0307409_100073753 | Ga0307409_1000737533 | 273 |
| 229 | 3300032002 | Ga0307416_100355603 | Ga0307416_1003556032 | 273 |
| 230 | 3300032004 | Ga0307414_10216998 | Ga0307414_102169982 | 273 |
| 231 | 3300032005 | Ga0307411_10380770 | Ga0307411_103807701 | 273 |
| 232 | 3300048903 | Ga0496100_0352536 | Ga0496100_0352536_147_974 | 273 |
| 233 | 3300048906 | Ga0496103_0021237 | Ga0496103_0021237_1362_2189 | 273 |
| 234 | 3300048911 | Ga0496108_0088421 | Ga0496108_0088421_171_998 | 273 |
| 235 | 3300048912 | Ga0496109_0018670 | Ga0496109_0018670_4952_5779 | 273 |
| 236 | 3300048912 | Ga0496109_0081059 | Ga0496109_0081059_1032_1853 | 273 |
| 237 | 3300001976 | JGI24752J21851_1002344 | JGI24752J21851_10023442 | 274 |
| 238 | 3300001978 | JGI24747J21853_1000416 | JGI24747J21853_10004164 | 274 |
| 239 | 3300001990 | JGI24737J22298_10026321 | JGI24737J22298_100263212 | 274 |
| 240 | 3300002155 | JGI24033J26618_1006613 | JGI24033J26618_10066132 | 274 |
| 241 | 3300002239 | JGI24034J26672_10003260 | JGI24034J26672_100032602 | 274 |
| 242 | 3300002244 | JGI24742J22300_10006158 | JGI24742J22300_100061582 | 274 |
| 243 | 3300005327 | Ga0070658_10010428 | Ga0070658_100104288 | 274 |
| 244 | 3300005327 | Ga0070658_10223651 | Ga0070658_102236511 | 274 |
| 245 | 3300005328 | Ga0070676_10021807 | Ga0070676_100218072 | 274 |
| 246 | 3300005328 | Ga0070676_10033957 | Ga0070676_100339574 | 274 |
| 247 | 3300005328 | Ga0070676_10044557 | Ga0070676_100445572 | 274 |
| 248 | 3300005328 | Ga0070676_10228769 | Ga0070676_102287691 | 274 |
| 249 | 3300005329 | Ga0070683_100035699 | Ga0070683_1000356994 | 274 |
| 250 | 3300005329 | Ga0070683_100104562 | Ga0070683_1001045622 | 274 |
| 251 | 3300005329 | Ga0070683_100299069 | Ga0070683_1002990691 | 274 |
| 252 | 3300005330 | Ga0070690_100067434 | Ga0070690_1000674342 | 274 |
| 253 | 3300005331 | Ga0070670_100001361 | Ga0070670_10000136118 | 274 |
| 254 | 3300005331 | Ga0070670_100376144 | Ga0070670_1003761442 | 274 |
| 255 | 3300005333 | Ga0070677_10001351 | Ga0070677_100013516 | 274 |
| 256 | 3300005333 | Ga0070677_10039239 | Ga0070677_100392393 | 274 |
| 257 | 3300005334 | Ga0068869_100016238 | Ga0068869_1000162382 | 274 |
| 258 | 3300005334 | Ga0068869_100182958 | Ga0068869_1001829582 | 274 |
| 259 | 3300005335 | Ga0070666_10058348 | Ga0070666_100583483 | 274 |
| 260 | 3300005335 | Ga0070666_10124781 | Ga0070666_101247812 | 274 |
| 261 | 3300005335 | Ga0070666_10286238 | Ga0070666_102862381 | 274 |
| 262 | 3300005336 | Ga0070680_100130082 | Ga0070680_1001300823 | 274 |
| 263 | 3300005338 | Ga0068868_100001366 | Ga0068868_1000013667 | 274 |
| 264 | 3300005338 | Ga0068868_100005837 | Ga0068868_1000058372 | 274 |
| 265 | 3300005339 | Ga0070660_100008372 | Ga0070660_1000083728 | 274 |
| 266 | 3300005339 | Ga0070660_100014412 | Ga0070660_1000144122 | 274 |
| 267 | 3300005339 | Ga0070660_100036902 | Ga0070660_1000369022 | 274 |
| 268 | 3300005339 | Ga0070660_100116390 | Ga0070660_1001163902 | 274 |
| 269 | 3300005339 | Ga0070660_100173267 | Ga0070660_1001732671 | 274 |
| 270 | 3300005339 | Ga0070660_100219590 | Ga0070660_1002195902 | 274 |
| 271 | 3300005344 | Ga0070661_100001117 | Ga0070661_1000011172 | 274 |
| 272 | 3300005344 | Ga0070661_100003926 | Ga0070661_10000392611 | 274 |
| 273 | 3300005344 | Ga0070661_100012543 | Ga0070661_1000125434 | 274 |
| 274 | 3300005344 | Ga0070661_100049843 | Ga0070661_1000498432 | 274 |
| 275 | 3300005344 | Ga0070661_100076708 | Ga0070661_1000767084 | 274 |
| 276 | 3300005347 | Ga0070668_100001120 | Ga0070668_10000112015 | 274 |
| 277 | 3300005347 | Ga0070668_100047740 | Ga0070668_1000477402 | 274 |
| 278 | 3300005347 | Ga0070668_100204857 | Ga0070668_1002048572 | 274 |
| 279 | 3300005347 | Ga0070668_100236777 | Ga0070668_1002367772 | 274 |
| 280 | 3300005354 | Ga0070675_100013337 | Ga0070675_1000133377 | 274 |
| 281 | 3300005354 | Ga0070675_100092570 | Ga0070675_1000925704 | 274 |
| 282 | 3300005354 | Ga0070675_100150125 | Ga0070675_1001501252 | 274 |
| 283 | 3300005354 | Ga0070675_100186431 | Ga0070675_1001864313 | 274 |
| 284 | 3300005355 | Ga0070671_100001808 | Ga0070671_1000018089 | 274 |
| 285 | 3300005355 | Ga0070671_100001980 | Ga0070671_10000198013 | 274 |
| 286 | 3300005355 | Ga0070671_100003000 | Ga0070671_10000300012 | 274 |
| 287 | 3300005355 | Ga0070671_100409565 | Ga0070671_1004095651 | 274 |
| 288 | 3300005356 | Ga0070674_100000120 | Ga0070674_1000001208 | 274 |
| 289 | 3300005356 | Ga0070674_100003810 | Ga0070674_1000038104 | 274 |
| 290 | 3300005364 | Ga0070673_100007284 | Ga0070673_1000072847 | 274 |
| 291 | 3300005364 | Ga0070673_100007452 | Ga0070673_1000074529 | 274 |
| 292 | 3300005364 | Ga0070673_100209279 | Ga0070673_1002092791 | 274 |
| 293 | 3300005364 | Ga0070673_100238712 | Ga0070673_1002387122 | 274 |
| 294 | 3300005365 | Ga0070688_100026678 | Ga0070688_1000266783 | 274 |
| 295 | 3300005366 | Ga0070659_100010091 | Ga0070659_1000100915 | 274 |
| 296 | 3300005366 | Ga0070659_100025398 | Ga0070659_1000253984 | 274 |
| 297 | 3300005366 | Ga0070659_100027022 | Ga0070659_1000270222 | 274 |
| 298 | 3300005366 | Ga0070659_100027216 | Ga0070659_1000272166 | 274 |
| 299 | 3300005366 | Ga0070659_100168539 | Ga0070659_1001685392 | 274 |
| 300 | 3300005367 | Ga0070667_100007635 | Ga0070667_1000076352 | 274 |
| 301 | 3300005367 | Ga0070667_100026761 | Ga0070667_1000267615 | 274 |
| 302 | 3300005367 | Ga0070667_100171120 | Ga0070667_1001711202 | 274 |
| 303 | 3300005434 | Ga0070709_10072007 | Ga0070709_100720072 | 274 |
| 304 | 3300005434 | Ga0070709_10108278 | Ga0070709_101082781 | 274 |
| 305 | 3300005435 | Ga0070714_100008331 | Ga0070714_1000083311 | 274 |
| 306 | 3300005435 | Ga0070714_100021200 | Ga0070714_1000212006 | 274 |
| 307 | 3300005436 | Ga0070713_100147307 | Ga0070713_1001473073 | 274 |
| 308 | 3300005436 | Ga0070713_100245381 | Ga0070713_1002453811 | 274 |
| 309 | 3300005438 | Ga0070701_10006671 | Ga0070701_100066712 | 274 |
| 310 | 3300005441 | Ga0070700_100003437 | Ga0070700_1000034376 | 274 |
| 311 | 3300005455 | Ga0070663_100003931 | Ga0070663_1000039318 | 274 |
| 312 | 3300005455 | Ga0070663_100004128 | Ga0070663_10000412810 | 274 |
| 313 | 3300005455 | Ga0070663_100047935 | Ga0070663_1000479352 | 274 |
| 314 | 3300005456 | Ga0070678_100001904 | Ga0070678_1000019044 | 274 |
| 315 | 3300005456 | Ga0070678_100069755 | Ga0070678_1000697553 | 274 |
| 316 | 3300005456 | Ga0070678_100150461 | Ga0070678_1001504612 | 274 |
| 317 | 3300005456 | Ga0070678_100241425 | Ga0070678_1002414252 | 274 |
| 318 | 3300005457 | Ga0070662_100000231 | Ga0070662_10000023114 | 274 |
| 319 | 3300005457 | Ga0070662_100298379 | Ga0070662_1002983792 | 274 |
| 320 | 3300005457 | Ga0070662_100339856 | Ga0070662_1003398561 | 274 |
| 321 | 3300005458 | Ga0070681_10001697 | Ga0070681_100016975 | 274 |
| 322 | 3300005458 | Ga0070681_10046933 | Ga0070681_100469335 | 274 |
| 323 | 3300005459 | Ga0068867_100025632 | Ga0068867_1000256322 | 274 |
| 324 | 3300005459 | Ga0068867_100085484 | Ga0068867_1000854844 | 274 |
| 325 | 3300005530 | Ga0070679_100031634 | Ga0070679_1000316343 | 274 |
| 326 | 3300005530 | Ga0070679_100055491 | Ga0070679_1000554912 | 274 |
| 327 | 3300005530 | Ga0070679_100262633 | Ga0070679_1002626332 | 274 |
| 328 | 3300005535 | Ga0070684_100006951 | Ga0070684_10000695110 | 274 |
| 329 | 3300005535 | Ga0070684_100016618 | Ga0070684_1000166187 | 274 |
| 330 | 3300005535 | Ga0070684_100098053 | Ga0070684_1000980532 | 274 |
| 331 | 3300005539 | Ga0068853_100016067 | Ga0068853_1000160672 | 274 |
| 332 | 3300005539 | Ga0068853_100018749 | Ga0068853_1000187498 | 274 |
| 333 | 3300005539 | Ga0068853_100019246 | Ga0068853_1000192465 | 274 |
| 334 | 3300005539 | Ga0068853_100256372 | Ga0068853_1002563722 | 274 |
| 335 | 3300005539 | Ga0068853_100668065 | Ga0068853_1006680651 | 274 |
| 336 | 3300005543 | Ga0070672_100000824 | Ga0070672_10000082414 | 274 |
| 337 | 3300005543 | Ga0070672_100001034 | Ga0070672_10000103412 | 274 |
| 338 | 3300005543 | Ga0070672_100136110 | Ga0070672_1001361101 | 274 |
| 339 | 3300005547 | Ga0070693_100151350 | Ga0070693_1001513502 | 274 |
| 340 | 3300005547 | Ga0070693_100336782 | Ga0070693_1003367821 | 274 |
| 341 | 3300005548 | Ga0070665_100021679 | Ga0070665_1000216797 | 274 |
| 342 | 3300005548 | Ga0070665_100201467 | Ga0070665_1002014673 | 274 |
| 343 | 3300005549 | Ga0070704_100157512 | Ga0070704_1001575122 | 274 |
| 344 | 3300005563 | Ga0068855_100003881 | Ga0068855_1000038815 | 274 |
| 345 | 3300005563 | Ga0068855_100016354 | Ga0068855_1000163542 | 274 |
| 346 | 3300005563 | Ga0068855_100133982 | Ga0068855_1001339823 | 274 |
| 347 | 3300005563 | Ga0068855_100393642 | Ga0068855_1003936423 | 274 |
| 348 | 3300005563 | Ga0068855_100792755 | Ga0068855_1007927551 | 274 |
| 349 | 3300005564 | Ga0070664_100001653 | Ga0070664_1000016533 | 274 |
| 350 | 3300005564 | Ga0070664_100006016 | Ga0070664_1000060164 | 274 |
| 351 | 3300005564 | Ga0070664_100051878 | Ga0070664_1000518784 | 274 |
| 352 | 3300005564 | Ga0070664_100080532 | Ga0070664_1000805322 | 274 |
| 353 | 3300005564 | Ga0070664_100099768 | Ga0070664_1000997682 | 274 |
| 354 | 3300005564 | Ga0070664_100211756 | Ga0070664_1002117563 | 274 |
| 355 | 3300005577 | Ga0068857_100001618 | Ga0068857_10000161812 | 274 |
| 356 | 3300005577 | Ga0068857_100007108 | Ga0068857_1000071085 | 274 |
| 357 | 3300005577 | Ga0068857_100071383 | Ga0068857_1000713833 | 274 |
| 358 | 3300005577 | Ga0068857_100122755 | Ga0068857_1001227552 | 274 |
| 359 | 3300005578 | Ga0068854_100033434 | Ga0068854_1000334342 | 274 |
| 360 | 3300005578 | Ga0068854_100041971 | Ga0068854_1000419712 | 274 |
| 361 | 3300005578 | Ga0068854_100043770 | Ga0068854_1000437702 | 274 |
| 362 | 3300005614 | Ga0068856_100000352 | Ga0068856_10000035232 | 274 |
| 363 | 3300005614 | Ga0068856_100002212 | Ga0068856_1000022128 | 274 |
| 364 | 3300005614 | Ga0068856_100010244 | Ga0068856_1000102442 | 274 |
| 365 | 3300005614 | Ga0068856_100023580 | Ga0068856_1000235802 | 274 |
| 366 | 3300005614 | Ga0068856_100082032 | Ga0068856_1000820325 | 274 |
| 367 | 3300005614 | Ga0068856_100485290 | Ga0068856_1004852902 | 274 |
| 368 | 3300005615 | Ga0070702_100004488 | Ga0070702_1000044882 | 274 |
| 369 | 3300005616 | Ga0068852_100000773 | Ga0068852_10000077319 | 274 |
| 370 | 3300005616 | Ga0068852_100005811 | Ga0068852_1000058112 | 274 |
| 371 | 3300005616 | Ga0068852_100025659 | Ga0068852_1000256595 | 274 |
| 372 | 3300005616 | Ga0068852_100039439 | Ga0068852_1000394392 | 274 |
| 373 | 3300005616 | Ga0068852_100120862 | Ga0068852_1001208624 | 274 |
| 374 | 3300005617 | Ga0068859_100118329 | Ga0068859_1001183294 | 274 |
| 375 | 3300005718 | Ga0068866_10024168 | Ga0068866_100241683 | 274 |
| 376 | 3300005719 | Ga0068861_100013855 | Ga0068861_1000138554 | 274 |
| 377 | 3300005719 | Ga0068861_100247724 | Ga0068861_1002477242 | 274 |
| 378 | 3300005719 | Ga0068861_100312575 | Ga0068861_1003125753 | 274 |
| 379 | 3300005834 | Ga0068851_10001455 | Ga0068851_100014555 | 274 |
| 380 | 3300005834 | Ga0068851_10003070 | Ga0068851_100030706 | 274 |
| 381 | 3300005834 | Ga0068851_10004826 | Ga0068851_100048267 | 274 |
| 382 | 3300005834 | Ga0068851_10004891 | Ga0068851_100048913 | 274 |
| 383 | 3300005834 | Ga0068851_10017890 | Ga0068851_100178902 | 274 |
| 384 | 3300005834 | Ga0068851_10048826 | Ga0068851_100488262 | 274 |
| 385 | 3300005840 | Ga0068870_10021432 | Ga0068870_100214324 | 274 |
| 386 | 3300005840 | Ga0068870_10025835 | Ga0068870_100258351 | 274 |
| 387 | 3300005841 | Ga0068863_100010535 | Ga0068863_1000105352 | 274 |
| 388 | 3300005842 | Ga0068858_100004907 | Ga0068858_10000490711 | 274 |
| 389 | 3300005842 | Ga0068858_100050068 | Ga0068858_1000500682 | 274 |
| 390 | 3300005842 | Ga0068858_100365351 | Ga0068858_1003653512 | 274 |
| 391 | 3300005843 | Ga0068860_100035130 | Ga0068860_1000351303 | 274 |
| 392 | 3300006237 | Ga0097621_100028347 | Ga0097621_1000283472 | 274 |
| 393 | 3300006237 | Ga0097621_100178212 | Ga0097621_1001782122 | 274 |
| 394 | 3300006358 | Ga0068871_100197758 | Ga0068871_1001977583 | 274 |
| 395 | 3300006844 | Ga0075428_100333134 | Ga0075428_1003331343 | 274 |
| 396 | 3300006846 | Ga0075430_100185269 | Ga0075430_1001852692 | 274 |
| 397 | 3300006871 | Ga0075434_100144958 | Ga0075434_1001449582 | 274 |
| 398 | 3300006871 | Ga0075434_100294240 | Ga0075434_1002942402 | 274 |
| 399 | 3300006881 | Ga0068865_100017947 | Ga0068865_1000179473 | 274 |
| 400 | 3300006931 | Ga0097620_100118327 | Ga0097620_1001183274 | 274 |
| 401 | 3300009093 | Ga0105240_10006454 | Ga0105240_1000645417 | 274 |
| 402 | 3300009093 | Ga0105240_10027454 | Ga0105240_100274543 | 274 |
| 403 | 3300009093 | Ga0105240_10077525 | Ga0105240_100775252 | 274 |
| 404 | 3300009094 | Ga0111539_10005900 | Ga0111539_100059004 | 274 |
| 405 | 3300009098 | Ga0105245_10162224 | Ga0105245_101622241 | 274 |
| 406 | 3300009101 | Ga0105247_10076894 | Ga0105247_100768942 | 274 |
| 407 | 3300009174 | Ga0105241_10008892 | Ga0105241_100088928 | 274 |
| 408 | 3300009174 | Ga0105241_10098206 | Ga0105241_100982062 | 274 |
| 409 | 3300009174 | Ga0105241_10198326 | Ga0105241_101983262 | 274 |
| 410 | 3300009545 | Ga0105237_10091743 | Ga0105237_100917432 | 274 |
| 411 | 3300009545 | Ga0105237_10097875 | Ga0105237_100978752 | 274 |
| 412 | 3300009545 | Ga0105237_10156383 | Ga0105237_101563832 | 274 |
| 413 | 3300009551 | Ga0105238_10002047 | Ga0105238_100020473 | 274 |
| 414 | 3300009551 | Ga0105238_10016725 | Ga0105238_100167252 | 274 |
| 415 | 3300009551 | Ga0105238_10429890 | Ga0105238_104298901 | 274 |
| 416 | 3300009553 | Ga0105249_10137822 | Ga0105249_101378221 | 274 |
| 417 | 3300009553 | Ga0105249_10314581 | Ga0105249_103145813 | 274 |
| 418 | 3300010375 | Ga0105239_10085572 | Ga0105239_100855722 | 274 |
| 419 | 3300010375 | Ga0105239_10198582 | Ga0105239_101985823 | 274 |
| 420 | 3300013100 | Ga0157373_10004347 | Ga0157373_100043479 | 274 |
| 421 | 3300013100 | Ga0157373_10068500 | Ga0157373_100685002 | 274 |
| 422 | 3300013100 | Ga0157373_10190282 | Ga0157373_101902822 | 274 |
| 423 | 3300013102 | Ga0157371_10002076 | Ga0157371_1000207613 | 274 |
| 424 | 3300013102 | Ga0157371_10136062 | Ga0157371_101360623 | 274 |
| 425 | 3300013102 | Ga0157371_10487890 | Ga0157371_104878901 | 274 |
| 426 | 3300013104 | Ga0157370_10013300 | Ga0157370_100133001 | 274 |
| 427 | 3300013104 | Ga0157370_10081387 | Ga0157370_100813872 | 274 |
| 428 | 3300013104 | Ga0157370_10204802 | Ga0157370_102048022 | 274 |
| 429 | 3300013105 | Ga0157369_10002386 | Ga0157369_1000238610 | 274 |
| 430 | 3300013105 | Ga0157369_10033327 | Ga0157369_100333276 | 274 |
| 431 | 3300013105 | Ga0157369_10042950 | Ga0157369_100429506 | 274 |
| 432 | 3300013105 | Ga0157369_10190744 | Ga0157369_101907442 | 274 |
| 433 | 3300013296 | Ga0157374_10037309 | Ga0157374_100373096 | 274 |
| 434 | 3300013296 | Ga0157374_10049729 | Ga0157374_100497294 | 274 |
| 435 | 3300013296 | Ga0157374_10192978 | Ga0157374_101929782 | 274 |
| 436 | 3300013297 | Ga0157378_10032926 | Ga0157378_100329267 | 274 |
| 437 | 3300013297 | Ga0157378_10060540 | Ga0157378_100605405 | 274 |
| 438 | 3300013297 | Ga0157378_10095255 | Ga0157378_100952554 | 274 |
| 439 | 3300013306 | Ga0163162_10142153 | Ga0163162_101421533 | 274 |
| 440 | 3300013306 | Ga0163162_10449192 | Ga0163162_104491922 | 274 |
| 441 | 3300013307 | Ga0157372_10000868 | Ga0157372_1000086813 | 274 |
| 442 | 3300013307 | Ga0157372_10019933 | Ga0157372_100199334 | 274 |
| 443 | 3300013307 | Ga0157372_10069597 | Ga0157372_100695974 | 274 |
| 444 | 3300013307 | Ga0157372_10080809 | Ga0157372_100808095 | 274 |
| 445 | 3300013307 | Ga0157372_10148857 | Ga0157372_101488572 | 274 |
| 446 | 3300013307 | Ga0157372_10188652 | Ga0157372_101886524 | 274 |
| 447 | 3300013307 | Ga0157372_10467578 | Ga0157372_104675782 | 274 |
| 448 | 3300013307 | Ga0157372_10709150 | Ga0157372_107091502 | 274 |
| 449 | 3300013308 | Ga0157375_10011825 | Ga0157375_100118254 | 274 |
| 450 | 3300013308 | Ga0157375_10041809 | Ga0157375_100418096 | 274 |
| 451 | 3300014325 | Ga0163163_10071035 | Ga0163163_100710355 | 274 |
| 452 | 3300014325 | Ga0163163_10639020 | Ga0163163_106390202 | 274 |
| 453 | 3300014326 | Ga0157380_10031222 | Ga0157380_100312223 | 274 |
| 454 | 3300014497 | Ga0182008_10034474 | Ga0182008_100344742 | 274 |
| 455 | 3300014745 | Ga0157377_10003604 | Ga0157377_100036046 | 274 |
| 456 | 3300014968 | Ga0157379_10009433 | Ga0157379_100094339 | 274 |
| 457 | 3300014968 | Ga0157379_10057028 | Ga0157379_100570284 | 274 |
| 458 | 3300014969 | Ga0157376_10037088 | Ga0157376_100370885 | 274 |
| 459 | 3300014969 | Ga0157376_10081210 | Ga0157376_100812103 | 274 |
| 460 | 3300014969 | Ga0157376_10606584 | Ga0157376_106065842 | 274 |
| 461 | 3300017792 | Ga0163161_10019802 | Ga0163161_100198024 | 274 |
| 462 | 3300025271 | Ga0207666_1001999 | Ga0207666_10019993 | 274 |
| 463 | 3300025315 | Ga0207697_10000570 | Ga0207697_1000057014 | 274 |
| 464 | 3300025315 | Ga0207697_10041953 | Ga0207697_100419532 | 274 |
| 465 | 3300025321 | Ga0207656_10001877 | Ga0207656_100018775 | 274 |
| 466 | 3300025321 | Ga0207656_10010980 | Ga0207656_100109802 | 274 |
| 467 | 3300025321 | Ga0207656_10015078 | Ga0207656_100150782 | 274 |
| 468 | 3300025321 | Ga0207656_10016205 | Ga0207656_100162051 | 274 |
| 469 | 3300025321 | Ga0207656_10020774 | Ga0207656_100207741 | 274 |
| 470 | 3300025893 | Ga0207682_10000037 | Ga0207682_1000003727 | 274 |
| 471 | 3300025893 | Ga0207682_10001668 | Ga0207682_100016684 | 274 |
| 472 | 3300025901 | Ga0207688_10001415 | Ga0207688_100014152 | 274 |
| 473 | 3300025903 | Ga0207680_10061796 | Ga0207680_100617961 | 274 |
| 474 | 3300025903 | Ga0207680_10100108 | Ga0207680_101001082 | 274 |
| 475 | 3300025904 | Ga0207647_10097086 | Ga0207647_100970862 | 274 |
| 476 | 3300025907 | Ga0207645_10001825 | Ga0207645_1000182512 | 274 |
| 477 | 3300025907 | Ga0207645_10049429 | Ga0207645_100494292 | 274 |
| 478 | 3300025908 | Ga0207643_10000184 | Ga0207643_1000018418 | 274 |
| 479 | 3300025908 | Ga0207643_10025680 | Ga0207643_100256804 | 274 |
| 480 | 3300025909 | Ga0207705_10079161 | Ga0207705_100791614 | 274 |
| 481 | 3300025909 | Ga0207705_10268454 | Ga0207705_102684542 | 274 |
| 482 | 3300025911 | Ga0207654_10022758 | Ga0207654_100227585 | 274 |
| 483 | 3300025911 | Ga0207654_10057677 | Ga0207654_100576773 | 274 |
| 484 | 3300025911 | Ga0207654_10235128 | Ga0207654_102351281 | 274 |
| 485 | 3300025911 | Ga0207654_10364875 | Ga0207654_103648751 | 274 |
| 486 | 3300025912 | Ga0207707_10001968 | Ga0207707_1000196814 | 274 |
| 487 | 3300025912 | Ga0207707_10002953 | Ga0207707_100029532 | 274 |
| 488 | 3300025912 | Ga0207707_10007126 | Ga0207707_100071262 | 274 |
| 489 | 3300025913 | Ga0207695_10008152 | Ga0207695_100081523 | 274 |
| 490 | 3300025913 | Ga0207695_10104624 | Ga0207695_101046242 | 274 |
| 491 | 3300025913 | Ga0207695_10126634 | Ga0207695_101266342 | 274 |
| 492 | 3300025914 | Ga0207671_10056139 | Ga0207671_100561393 | 274 |
| 493 | 3300025916 | Ga0207663_10112901 | Ga0207663_101129012 | 274 |
| 494 | 3300025916 | Ga0207663_10212871 | Ga0207663_102128713 | 274 |
| 495 | 3300025917 | Ga0207660_10016235 | Ga0207660_100162356 | 274 |
| 496 | 3300025917 | Ga0207660_10044661 | Ga0207660_100446614 | 274 |
| 497 | 3300025918 | Ga0207662_10000381 | Ga0207662_1000038114 | 274 |
| 498 | 3300025919 | Ga0207657_10000102 | Ga0207657_1000010271 | 274 |
| 499 | 3300025919 | Ga0207657_10002428 | Ga0207657_1000242817 | 274 |
| 500 | 3300025919 | Ga0207657_10009399 | Ga0207657_1000939910 | 274 |
| 501 | 3300025919 | Ga0207657_10011151 | Ga0207657_100111518 | 274 |
| 502 | 3300025919 | Ga0207657_10036598 | Ga0207657_100365984 | 274 |
| 503 | 3300025919 | Ga0207657_10126002 | Ga0207657_101260022 | 274 |
| 504 | 3300025919 | Ga0207657_10140579 | Ga0207657_101405793 | 274 |
| 505 | 3300025920 | Ga0207649_10002170 | Ga0207649_100021702 | 274 |
| 506 | 3300025920 | Ga0207649_10051585 | Ga0207649_100515853 | 274 |
| 507 | 3300025920 | Ga0207649_10081247 | Ga0207649_100812471 | 274 |
| 508 | 3300025920 | Ga0207649_10095164 | Ga0207649_100951641 | 274 |
| 509 | 3300025920 | Ga0207649_10129175 | Ga0207649_101291752 | 274 |
| 510 | 3300025921 | Ga0207652_10023450 | Ga0207652_100234503 | 274 |
| 511 | 3300025921 | Ga0207652_10057299 | Ga0207652_100572992 | 274 |
| 512 | 3300025921 | Ga0207652_10179700 | Ga0207652_101797002 | 274 |
| 513 | 3300025923 | Ga0207681_10042134 | Ga0207681_100421342 | 274 |
| 514 | 3300025924 | Ga0207694_10001672 | Ga0207694_100016722 | 274 |
| 515 | 3300025924 | Ga0207694_10034094 | Ga0207694_100340942 | 274 |
| 516 | 3300025925 | Ga0207650_10000534 | Ga0207650_100005346 | 274 |
| 517 | 3300025926 | Ga0207659_10000713 | Ga0207659_100007136 | 274 |
| 518 | 3300025926 | Ga0207659_10114925 | Ga0207659_101149252 | 274 |
| 519 | 3300025928 | Ga0207700_10281408 | Ga0207700_102814082 | 274 |
| 520 | 3300025929 | Ga0207664_10035335 | Ga0207664_100353353 | 274 |
| 521 | 3300025929 | Ga0207664_10118805 | Ga0207664_101188051 | 274 |
| 522 | 3300025929 | Ga0207664_10524888 | Ga0207664_105248881 | 274 |
| 523 | 3300025931 | Ga0207644_10009523 | Ga0207644_100095235 | 274 |
| 524 | 3300025931 | Ga0207644_10014319 | Ga0207644_100143194 | 274 |
| 525 | 3300025931 | Ga0207644_10031990 | Ga0207644_100319902 | 274 |
| 526 | 3300025931 | Ga0207644_10409472 | Ga0207644_104094722 | 274 |
| 527 | 3300025932 | Ga0207690_10027829 | Ga0207690_100278292 | 274 |
| 528 | 3300025932 | Ga0207690_10041228 | Ga0207690_100412281 | 274 |
| 529 | 3300025932 | Ga0207690_10091333 | Ga0207690_100913331 | 274 |
| 530 | 3300025932 | Ga0207690_10117117 | Ga0207690_101171172 | 274 |
| 531 | 3300025933 | Ga0207706_10002115 | Ga0207706_1000211514 | 274 |
| 532 | 3300025933 | Ga0207706_10053287 | Ga0207706_100532872 | 274 |
| 533 | 3300025933 | Ga0207706_10100135 | Ga0207706_101001353 | 274 |
| 534 | 3300025936 | Ga0207670_10026331 | Ga0207670_100263315 | 274 |
| 535 | 3300025937 | Ga0207669_10003118 | Ga0207669_100031188 | 274 |
| 536 | 3300025938 | Ga0207704_10107855 | Ga0207704_101078553 | 274 |
| 537 | 3300025940 | Ga0207691_10000024 | Ga0207691_1000002432 | 274 |
| 538 | 3300025940 | Ga0207691_10013184 | Ga0207691_100131844 | 274 |
| 539 | 3300025940 | Ga0207691_10018214 | Ga0207691_100182143 | 274 |
| 540 | 3300025940 | Ga0207691_10041073 | Ga0207691_100410735 | 274 |
| 541 | 3300025940 | Ga0207691_10063836 | Ga0207691_100638362 | 274 |
| 542 | 3300025941 | Ga0207711_10023627 | Ga0207711_100236274 | 274 |
| 543 | 3300025941 | Ga0207711_10037186 | Ga0207711_100371863 | 274 |
| 544 | 3300025942 | Ga0207689_10002437 | Ga0207689_1000243711 | 274 |
| 545 | 3300025942 | Ga0207689_10123682 | Ga0207689_101236822 | 274 |
| 546 | 3300025944 | Ga0207661_10024176 | Ga0207661_100241764 | 274 |
| 547 | 3300025944 | Ga0207661_10063257 | Ga0207661_100632574 | 274 |
| 548 | 3300025944 | Ga0207661_10119981 | Ga0207661_101199811 | 274 |
| 549 | 3300025945 | Ga0207679_10006518 | Ga0207679_100065185 | 274 |
| 550 | 3300025945 | Ga0207679_10013121 | Ga0207679_100131212 | 274 |
| 551 | 3300025945 | Ga0207679_10016676 | Ga0207679_100166765 | 274 |
| 552 | 3300025945 | Ga0207679_10158946 | Ga0207679_101589463 | 274 |
| 553 | 3300025945 | Ga0207679_10246892 | Ga0207679_102468922 | 274 |
| 554 | 3300025945 | Ga0207679_10433889 | Ga0207679_104338892 | 274 |
| 555 | 3300025949 | Ga0207667_10000233 | Ga0207667_1000023327 | 274 |
| 556 | 3300025949 | Ga0207667_10018851 | Ga0207667_100188513 | 274 |
| 557 | 3300025949 | Ga0207667_10025679 | Ga0207667_100256794 | 274 |
| 558 | 3300025949 | Ga0207667_10044309 | Ga0207667_100443092 | 274 |
| 559 | 3300025949 | Ga0207667_10090024 | Ga0207667_100900243 | 274 |
| 560 | 3300025949 | Ga0207667_10225883 | Ga0207667_102258832 | 274 |
| 561 | 3300025949 | Ga0207667_10260994 | Ga0207667_102609943 | 274 |
| 562 | 3300025960 | Ga0207651_10004138 | Ga0207651_100041385 | 274 |
| 563 | 3300025960 | Ga0207651_10028815 | Ga0207651_100288155 | 274 |
| 564 | 3300025960 | Ga0207651_10114650 | Ga0207651_101146503 | 274 |
| 565 | 3300025961 | Ga0207712_10167314 | Ga0207712_101673142 | 274 |
| 566 | 3300025972 | Ga0207668_10244377 | Ga0207668_102443771 | 274 |
| 567 | 3300025972 | Ga0207668_10535704 | Ga0207668_105357041 | 274 |
| 568 | 3300025981 | Ga0207640_10016411 | Ga0207640_100164113 | 274 |
| 569 | 3300025981 | Ga0207640_10046246 | Ga0207640_100462463 | 274 |
| 570 | 3300025981 | Ga0207640_10182204 | Ga0207640_101822041 | 274 |
| 571 | 3300025986 | Ga0207658_10003432 | Ga0207658_100034328 | 274 |
| 572 | 3300025986 | Ga0207658_10013773 | Ga0207658_100137732 | 274 |
| 573 | 3300025986 | Ga0207658_10128740 | Ga0207658_101287401 | 274 |
| 574 | 3300026023 | Ga0207677_10041599 | Ga0207677_100415994 | 274 |
| 575 | 3300026023 | Ga0207677_10329241 | Ga0207677_103292411 | 274 |
| 576 | 3300026023 | Ga0207677_10437407 | Ga0207677_104374071 | 274 |
| 577 | 3300026035 | Ga0207703_10037884 | Ga0207703_100378843 | 274 |
| 578 | 3300026035 | Ga0207703_10041259 | Ga0207703_100412592 | 274 |
| 579 | 3300026035 | Ga0207703_10062016 | Ga0207703_100620164 | 274 |
| 580 | 3300026035 | Ga0207703_10186588 | Ga0207703_101865882 | 274 |
| 581 | 3300026035 | Ga0207703_10478288 | Ga0207703_104782881 | 274 |
| 582 | 3300026041 | Ga0207639_10027674 | Ga0207639_100276744 | 274 |
| 583 | 3300026041 | Ga0207639_10042399 | Ga0207639_100423992 | 274 |
| 584 | 3300026041 | Ga0207639_10082677 | Ga0207639_100826773 | 274 |
| 585 | 3300026041 | Ga0207639_10461026 | Ga0207639_104610261 | 274 |
| 586 | 3300026041 | Ga0207639_10616462 | Ga0207639_106164621 | 274 |
| 587 | 3300026067 | Ga0207678_10002265 | Ga0207678_100022652 | 274 |
| 588 | 3300026067 | Ga0207678_10012930 | Ga0207678_100129307 | 274 |
| 589 | 3300026067 | Ga0207678_10012994 | Ga0207678_100129949 | 274 |
| 590 | 3300026067 | Ga0207678_10018535 | Ga0207678_100185356 | 274 |
| 591 | 3300026067 | Ga0207678_10038834 | Ga0207678_100388342 | 274 |
| 592 | 3300026067 | Ga0207678_10316043 | Ga0207678_103160432 | 274 |
| 593 | 3300026075 | Ga0207708_10002250 | Ga0207708_1000225010 | 274 |
| 594 | 3300026078 | Ga0207702_10000597 | Ga0207702_1000059713 | 274 |
| 595 | 3300026078 | Ga0207702_10002745 | Ga0207702_100027452 | 274 |
| 596 | 3300026078 | Ga0207702_10003655 | Ga0207702_1000365514 | 274 |
| 597 | 3300026088 | Ga0207641_10008392 | Ga0207641_100083922 | 274 |
| 598 | 3300026088 | Ga0207641_10132766 | Ga0207641_101327662 | 274 |
| 599 | 3300026089 | Ga0207648_10001593 | Ga0207648_100015936 | 274 |
| 600 | 3300026089 | Ga0207648_10010379 | Ga0207648_100103799 | 274 |
| 601 | 3300026089 | Ga0207648_10023595 | Ga0207648_100235951 | 274 |
| 602 | 3300026089 | Ga0207648_10271111 | Ga0207648_102711112 | 274 |
| 603 | 3300026095 | Ga0207676_10084873 | Ga0207676_100848734 | 274 |
| 604 | 3300026095 | Ga0207676_10619444 | Ga0207676_106194441 | 274 |
| 605 | 3300026116 | Ga0207674_10001568 | Ga0207674_1000156821 | 274 |
| 606 | 3300026116 | Ga0207674_10002723 | Ga0207674_100027239 | 274 |
| 607 | 3300026116 | Ga0207674_10010383 | Ga0207674_100103837 | 274 |
| 608 | 3300026116 | Ga0207674_10541571 | Ga0207674_105415711 | 274 |
| 609 | 3300026118 | Ga0207675_100000538 | Ga0207675_10000053815 | 274 |
| 610 | 3300026118 | Ga0207675_100294357 | Ga0207675_1002943572 | 274 |
| 611 | 3300026121 | Ga0207683_10000012 | Ga0207683_1000001266 | 274 |
| 612 | 3300026121 | Ga0207683_10002415 | Ga0207683_100024154 | 274 |
| 613 | 3300026121 | Ga0207683_10209360 | Ga0207683_102093602 | 274 |
| 614 | 3300026142 | Ga0207698_10002317 | Ga0207698_1000231711 | 274 |
| 615 | 3300026142 | Ga0207698_10009337 | Ga0207698_100093376 | 274 |
| 616 | 3300026142 | Ga0207698_10042564 | Ga0207698_100425642 | 274 |
| 617 | 3300026142 | Ga0207698_10066748 | Ga0207698_100667483 | 274 |
| 618 | 3300026142 | Ga0207698_10099409 | Ga0207698_100994093 | 274 |
| 619 | 3300026142 | Ga0207698_10149715 | Ga0207698_101497151 | 274 |
| 620 | 3300027360 | Ga0209969_1007075 | Ga0209969_10070752 | 274 |
| 621 | 3300027665 | Ga0209983_1010239 | Ga0209983_10102392 | 274 |
| 622 | 3300027682 | Ga0209971_1003476 | Ga0209971_10034762 | 274 |
| 623 | 3300027876 | Ga0209974_10001787 | Ga0209974_100017872 | 274 |
| 624 | 3300027876 | Ga0209974_10007961 | Ga0209974_100079614 | 274 |
| 625 | 3300027907 | Ga0207428_10104165 | Ga0207428_101041652 | 274 |
| 626 | 3300028379 | Ga0268266_10012004 | Ga0268266_100120046 | 274 |
| 627 | 3300028379 | Ga0268266_10014078 | Ga0268266_100140785 | 274 |
| 628 | 3300028379 | Ga0268266_10014494 | Ga0268266_100144946 | 274 |
| 629 | 3300028379 | Ga0268266_10170524 | Ga0268266_101705242 | 274 |
| 630 | 3300028380 | Ga0268265_10316915 | Ga0268265_103169152 | 274 |
| 631 | 3300028381 | Ga0268264_10103801 | Ga0268264_101038012 | 274 |
| 632 | 3300028381 | Ga0268264_10247456 | Ga0268264_102474563 | 274 |
| 633 | 3300031548 | Ga0307408_100012994 | Ga0307408_1000129942 | 274 |
| 634 | 3300031731 | Ga0307405_10006485 | Ga0307405_100064856 | 274 |
| 635 | 3300031824 | Ga0307413_10000671 | Ga0307413_100006713 | 274 |
| 636 | 3300031901 | Ga0307406_10010659 | Ga0307406_100106594 | 274 |
| 637 | 3300031903 | Ga0307407_10026799 | Ga0307407_100267992 | 274 |
| 638 | 3300031911 | Ga0307412_10052107 | Ga0307412_100521072 | 274 |
| 639 | 3300031995 | Ga0307409_100006853 | Ga0307409_1000068534 | 274 |
| 640 | 3300031995 | Ga0307409_100299231 | Ga0307409_1002992312 | 274 |
| 641 | 3300032002 | Ga0307416_100034049 | Ga0307416_1000340494 | 274 |
| 642 | 3300032005 | Ga0307411_10000781 | Ga0307411_100007813 | 274 |
| 643 | 3300032126 | Ga0307415_100008495 | Ga0307415_1000084956 | 274 |
| 644 | 3300035090 | Ga0373949_0028531 | Ga0373949_0028531_31_855 | 274 |
| 645 | 3300035170 | Ga0373943_0076921 | Ga0373943_0076921_348_1172 | 274 |
| 646 | 3300035171 | Ga0373946_0161195 | Ga0373946_0161195_43_867 | 274 |
| 647 | 3300035241 | Ga0373961_0022424 | Ga0373961_0022424_245_1069 | 274 |
| 648 | 3300037471 | Ga0395905_0043100 | Ga0395905_0043100_1526_2350 | 274 |
| 649 | 3300038996 | Ga0242420_015757 | Ga0242420_015757_384_1208 | 274 |
| 650 | 3300042876 | Ga0451577_0578595 | Ga0451577_0578595_16_840 | 274 |
| 651 | 3300046472 | Ga0495580_0249396 | Ga0495580_0249396_348_1172 | 274 |
| 652 | 3300046539 | Ga0495621_0034478 | Ga0495621_0034478_58_882 | 274 |
| 653 | 3300046681 | Ga0495647_0039929 | Ga0495647_0039929_721_1545 | 274 |
| 654 | 3300048904 | Ga0496101_0018812 | Ga0496101_0018812_1379_2203 | 274 |
| 655 | 3300048905 | Ga0496102_0044103 | Ga0496102_0044103_1026_1850 | 274 |
| 656 | 3300048905 | Ga0496102_0132926 | Ga0496102_0132926_997_1821 | 274 |
| 657 | 3300048905 | Ga0496102_0249972 | Ga0496102_0249972_509_1333 | 274 |
| 658 | 3300048906 | Ga0496103_0067798 | Ga0496103_0067798_524_1348 | 274 |
| 659 | 3300048906 | Ga0496103_0166033 | Ga0496103_0166033_67_891 | 274 |
| 660 | 3300048907 | Ga0496104_0021874 | Ga0496104_0021874_2900_3724 | 274 |
| 661 | 3300048909 | Ga0496106_0031062 | Ga0496106_0031062_1547_2371 | 274 |
| 662 | 3300048909 | Ga0496106_0134934 | Ga0496106_0134934_600_1424 | 274 |
| 663 | 3300048910 | Ga0496107_0122445 | Ga0496107_0122445_445_1269 | 274 |
| 664 | 3300048911 | Ga0496108_0027107 | Ga0496108_0027107_3060_3884 | 274 |
| 665 | 3300048911 | Ga0496108_0221810 | Ga0496108_0221810_180_1004 | 274 |
| 666 | 3300048913 | Ga0496110_0010489 | Ga0496110_0010489_2003_2827 | 274 |
| 667 | 3300048913 | Ga0496110_0320487 | Ga0496110_0320487_149_973 | 274 |
| 668 | 3300048915 | Ga0496112_0003817 | Ga0496112_0003817_2416_3342 | 274 |
| 669 | 3300048916 | Ga0496113_0385997 | Ga0496113_0385997_94_1020 | 274 |
| 670 | 3300048917 | Ga0496114_0024195 | Ga0496114_0024195_1828_2652 | 274 |
| 671 | 3300049576 | Ga0501040_0307182 | Ga0501040_0307182_261_1088 | 274 |
| 672 | 3300049578 | Ga0501042_0171962 | Ga0501042_0171962_130_957 | 274 |
| 673 | 3300049580 | Ga0501046_0311702 | Ga0501046_0311702_67_894 | 274 |
| 674 | 3300050511 | nmdc:mga08y16_162705_c1 | nmdc:mga08y16_162705_c1_617_1441 | 274 |
| 675 | 3300050512 | nmdc:mga0n895_666919_c1 | nmdc:mga0n895_666919_c1_62_886 | 274 |
| 676 | 3300050512 | nmdc:mga0n895_86311_c1 | nmdc:mga0n895_86311_c1_73_1002 | 274 |
| 677 | 3300050515 | nmdc:mga0a205_199027_c1 | nmdc:mga0a205_199027_c1_542_1366 | 274 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1b12-assembly4.cif.gz_D | crystal structure of type 1 signal peptidase from escherichia coli in complex with a beta-lactam inhibitor | 0.7447 | 56 | 274 |
| 4n31-assembly1.cif.gz_B | structure and activity of streptococcus pyogenes sipa: a signal peptidase homologue essential for pilus polymerisation | 0.7363 | 58 | 251 |
| 1b12-assembly3.cif.gz_C | crystal structure of type 1 signal peptidase from escherichia coli in complex with a beta-lactam inhibitor | 0.7348 | 57 | 274 |
| 1b12-assembly2.cif.gz_B | crystal structure of type 1 signal peptidase from escherichia coli in complex with a beta-lactam inhibitor | 0.7326 | 58 | 274 |
| 1b12-assembly4.cif.gz_D | crystal structure of type 1 signal peptidase from escherichia coli in complex with a beta-lactam inhibitor | 0.7324 | 56 | 274 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O74800_20_156_2.10.109.10 | Mainly Beta;Ribbon;Umud Fragment, subunit A;Umud Fragment, subunit A | 0.8132 | 55 | 254 | 2.10.109.10 |
| af_Q7XS59_25_161_2.10.109.10 | Mainly Beta;Ribbon;Umud Fragment, subunit A;Umud Fragment, subunit A | 0.7975 | 56 | 274 | 2.10.109.10 |
| 1b12C01 | Mainly Beta;Ribbon;Umud Fragment, subunit A;Umud Fragment, subunit A | 0.7927 | 57 | 270 | 2.10.109.10 |
| 1b12C01 | Mainly Beta;Ribbon;Umud Fragment, subunit A;Umud Fragment, subunit A | 0.7807 | 57 | 270 | 2.10.109.10 |
| af_Q54RP1_162_281_2.10.109.10 | Mainly Beta;Ribbon;Umud Fragment, subunit A;Umud Fragment, subunit A | 0.7803 | 54 | 251 | 2.10.109.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A496WHA3-F1-model_v4 | Signal peptidase I (EC 3.4.21.89) | 0.9447 | 3 | 147 |
GO:0004252
GO:0006465 GO:0016020 |
| AF-A0A1G3VVU4-F1-model_v4 | Signal peptidase I (EC 3.4.21.89) | 0.9358 | 48 | 147 |
GO:0004252
GO:0006465 GO:0016020 |
| AF-A0A7Y5DH24-F1-model_v4 | Signal peptidase I (EC 3.4.21.89) | 0.9334 | 1 | 274 |
GO:0004252
GO:0006465 GO:0016020 |
| AF-A0A356QGF6-F1-model_v4 | Signal peptidase I (EC 3.4.21.89) | 0.9322 | 47 | 136 |
GO:0004252
GO:0006465 GO:0016020 |
| AF-A0A7I8EAQ8-F1-model_v4 | Signal peptidase I (EC 3.4.21.89) | 0.9303 | 4 | 274 |
GO:0004252
GO:0006465 GO:0016020 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar