F474568

General Info

Members Datasets Scaffolds Average Seq Length
677 284 668 278

Family's Representative Sequence

Representative Sequence 3300005335|Ga0070666_10286238|Ga0070666_102862381
Length 310
Sequence MNFALILFVLTSITGAAWLFDKLVLEGRRRERARLALANLDRQMPATVSGDGGAAAPARRADVETAALREPSWVEYSKAFFPVLLIVFLLRSFLAEPFKIPSSSMRPTLEVGDFILVNKFAYGIRLPIIEKKIVPIDDPKRGDVVVFRYPVNPSQDFIKRVIGIGGDVVEYRDKRITVNGQPWPQQTDGTYSYLEGLRFDTLTRMAERTDAAAGARDHMIGLNQNAPAVYPLNVRNFPGRENCDYNERGFTCKVPAGHYLMMGDNRDNSDDSRYWGFVPDDHIRGKAFFIWFNWDDIASFAFKRVGSGIR

Samples

Sample ID Description Type Environment
1 2643221559 Lysobacter sp. Root559 Isolate Unclassified
2 2643221586 Lysobacter sp. Root667 Isolate Unclassified
3 2643221593 Lysobacter sp. Root690 Isolate Unclassified
4 2643221612 Lysobacter sp. Root76 Isolate Unclassified
5 2643221727 Lysobacter sp. Root96 Isolate Unclassified
6 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
7 2952252522 Salinicola sp. DM10 Isolate Unclassified
8 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
9 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
10 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
11 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
12 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
13 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
14 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
15 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
16 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
17 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
18 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
19 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
20 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
21 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
22 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
23 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
24 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
25 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
28 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
29 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
30 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
31 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
32 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
33 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
34 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
35 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
36 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
37 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
38 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
39 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
40 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
41 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
42 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
43 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
44 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
45 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
46 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
47 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
48 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
49 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
50 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
51 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
52 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
53 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
54 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
55 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
56 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
57 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
58 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
59 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
60 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
61 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
62 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
63 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
64 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
65 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
66 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
67 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
68 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
69 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
70 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
71 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
72 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
73 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
74 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
75 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
76 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
77 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
78 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
79 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
80 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
81 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
82 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
83 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
86 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
87 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
88 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
102 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
103 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
104 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
105 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
111 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
112 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
113 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
114 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
115 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
116 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
117 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
118 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
119 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
120 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
123 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
124 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
126 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
127 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
128 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
130 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
195 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
199 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
200 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
201 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
202 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
203 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
204 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
205 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
206 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
207 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
208 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
209 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
210 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
211 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
212 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
213 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
214 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
215 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
216 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
217 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
218 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
219 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
220 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
221 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
222 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
223 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
224 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
225 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
226 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
227 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
228 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
229 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
230 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
231 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
232 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
233 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
234 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
235 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
236 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
237 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
238 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
239 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
240 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
241 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
242 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
243 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
244 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
245 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
246 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
247 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
248 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
249 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
250 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
251 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
252 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
253 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
254 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
255 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
256 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
266 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
267 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
268 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
269 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
270 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
271 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
272 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
273 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
274 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
275 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
276 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
277 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
279 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
280 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
281 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
282 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
283 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
284 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.67
Metatranscriptomes 0
Isolates 1.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.32
Nodule 0
Rhizoplane 4.14
Rhizosphere 88.92
Stem 0
Stem Tuber 0
Unclassified 1.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1002344 3300001976 Bacteria 2519
2 JGI24747J21853_1000416 3300001978 Bacteria 2585
3 JGI24737J22298_10026321 3300001990 Bacteria 1836
4 JGI24033J26618_1006613 3300002155 Bacteria 1305
5 JGI24034J26672_10003260 3300002239 Bacteria 2262
6 JGI24742J22300_10006158 3300002244 Bacteria 1978
7 rootH2_10263331 3300003320 Bacteria 1110
8 Ga0055524_1000206 3300003775 Bacteria 63929
9 Ga0055536_1001400 3300003781 Bacteria 14570
10 Ga0055534_1000164 3300003784 Bacteria 49529
11 Ga0055528_1000027 3300003790 Bacteria 126420
12 Ga0055530_10002733 3300003791 Bacteria 10932
13 Ga0065715_10164276 3300005293 Bacteria 1600
14 Ga0070658_10010428 3300005327 Bacteria 7451
15 Ga0070658_10223651 3300005327 Bacteria 1592
16 Ga0070676_10021807 3300005328 Bacteria 3587
17 Ga0070676_10033957 3300005328 Bacteria 2927
18 Ga0070676_10044557 3300005328 Bacteria 2582
19 Ga0070676_10079311 3300005328 Bacteria 1988
20 Ga0070676_10228769 3300005328 Bacteria 1232
21 Ga0070683_100035699 3300005329 Bacteria 4544
22 Ga0070683_100104562 3300005329 Bacteria 2669
23 Ga0070683_100299069 3300005329 Bacteria 1531
24 Ga0070690_100067434 3300005330 Bacteria 2318
25 Ga0070670_100001361 3300005331 Bacteria 19584
26 Ga0070670_100010473 3300005331 Bacteria 7913
27 Ga0070670_100016063 3300005331 Bacteria 6425
28 Ga0070670_100376144 3300005331 Bacteria 1251
29 Ga0070670_100424371 3300005331 Bacteria 1176
30 Ga0070677_10001351 3300005333 Bacteria 7826
31 Ga0070677_10039239 3300005333 Bacteria 1857
32 Ga0068869_100002085 3300005334 Bacteria 12019
33 Ga0068869_100016238 3300005334 Bacteria 5014
34 Ga0068869_100101091 3300005334 Bacteria 2181
35 Ga0068869_100182958 3300005334 Bacteria 1644
36 Ga0070666_10058348 3300005335 Bacteria 2610
37 Ga0070666_10103753 3300005335 Bacteria 1962
38 Ga0070666_10124781 3300005335 Bacteria 1787
39 Ga0070666_10286238 3300005335 Bacteria 1172
40 Ga0070680_100130082 3300005336 Bacteria 2106
41 Ga0070680_100154792 3300005336 Bacteria 1925
42 Ga0070682_100017775 3300005337 Bacteria 4147
43 Ga0068868_100001366 3300005338 Bacteria 16818
44 Ga0068868_100005837 3300005338 Bacteria 8681
45 Ga0070660_100008372 3300005339 Bacteria 7230
46 Ga0070660_100014412 3300005339 Bacteria 5693
47 Ga0070660_100036902 3300005339 Bacteria 3704
48 Ga0070660_100116390 3300005339 Bacteria 2132
49 Ga0070660_100173267 3300005339 Bacteria 1743
50 Ga0070660_100219590 3300005339 Bacteria 1544
51 Ga0070687_100018652 3300005343 Bacteria 3214
52 Ga0070661_100001117 3300005344 Bacteria 18832
53 Ga0070661_100003926 3300005344 Bacteria 10231
54 Ga0070661_100012543 3300005344 Bacteria 5930
55 Ga0070661_100049843 3300005344 Bacteria 3065
56 Ga0070661_100076708 3300005344 Bacteria 2463
57 Ga0070668_100001120 3300005347 Bacteria 18884
58 Ga0070668_100047740 3300005347 Bacteria 3292
59 Ga0070668_100204857 3300005347 Bacteria 1621
60 Ga0070668_100236777 3300005347 Bacteria 1511
61 Ga0070669_100049666 3300005353 Bacteria 3063
62 Ga0070669_100096618 3300005353 Bacteria 2223
63 Ga0070675_100013337 3300005354 Bacteria 6457
64 Ga0070675_100092570 3300005354 Bacteria 2534
65 Ga0070675_100150125 3300005354 Bacteria 1998
66 Ga0070675_100186431 3300005354 Bacteria 1796
67 Ga0070671_100001808 3300005355 Bacteria 16265
68 Ga0070671_100001980 3300005355 Bacteria 15715
69 Ga0070671_100003000 3300005355 Bacteria 13142
70 Ga0070671_100068995 3300005355 Bacteria 2948
71 Ga0070671_100409565 3300005355 Bacteria 1160
72 Ga0070674_100000120 3300005356 Bacteria 35826
73 Ga0070674_100003810 3300005356 Bacteria 8524
74 Ga0070673_100004665 3300005364 Bacteria 8700
75 Ga0070673_100007284 3300005364 Bacteria 7285
76 Ga0070673_100007452 3300005364 Bacteria 7217
77 Ga0070673_100070400 3300005364 Bacteria 2807
78 Ga0070673_100209279 3300005364 Bacteria 1683
79 Ga0070673_100238712 3300005364 Bacteria 1579
80 Ga0070688_100026678 3300005365 Bacteria 3434
81 Ga0070688_100288542 3300005365 Bacteria 1182
82 Ga0070659_100010091 3300005366 Bacteria 6953
83 Ga0070659_100025398 3300005366 Bacteria 4549
84 Ga0070659_100027022 3300005366 Bacteria 4418
85 Ga0070659_100027216 3300005366 Bacteria 4403
86 Ga0070659_100168539 3300005366 Bacteria 1793
87 Ga0070667_100007635 3300005367 Bacteria 8971
88 Ga0070667_100010847 3300005367 Bacteria 7534
89 Ga0070667_100026761 3300005367 Bacteria 4799
90 Ga0070667_100171120 3300005367 Bacteria 1917
91 Ga0070667_100203747 3300005367 Bacteria 1756
92 Ga0070709_10072007 3300005434 Bacteria 2233
93 Ga0070709_10108278 3300005434 Bacteria 1864
94 Ga0070714_100008331 3300005435 Bacteria 8088
95 Ga0070714_100021200 3300005435 Bacteria 5314
96 Ga0070713_100147307 3300005436 Bacteria 2091
97 Ga0070713_100245381 3300005436 Bacteria 1632
98 Ga0070701_10006671 3300005438 Bacteria 4874
99 Ga0070701_10178619 3300005438 Bacteria 1241
100 Ga0070705_100097872 3300005440 Bacteria 1845
101 Ga0070700_100003437 3300005441 Bacteria 8167
102 Ga0070700_100043889 3300005441 Bacteria 2751
103 Ga0070694_100124288 3300005444 Bacteria 1855
104 Ga0070663_100003931 3300005455 Bacteria 8666
105 Ga0070663_100004128 3300005455 Bacteria 8487
106 Ga0070663_100047935 3300005455 Bacteria 3028
107 Ga0070678_100001904 3300005456 Bacteria 11247
108 Ga0070678_100069755 3300005456 Bacteria 2625
109 Ga0070678_100150461 3300005456 Bacteria 1874
110 Ga0070678_100241425 3300005456 Bacteria 1511
111 Ga0070662_100000231 3300005457 Bacteria 32882
112 Ga0070662_100298379 3300005457 Bacteria 1308
113 Ga0070662_100339856 3300005457 Bacteria 1228
114 Ga0070681_10001697 3300005458 Bacteria 19691
115 Ga0070681_10046933 3300005458 Bacteria 4318
116 Ga0068867_100025632 3300005459 Bacteria 4232
117 Ga0068867_100085484 3300005459 Bacteria 2385
118 Ga0068867_100105010 3300005459 Bacteria 2163
119 Ga0068867_100174181 3300005459 Bacteria 1706
120 Ga0070679_100031634 3300005530 Bacteria 5230
121 Ga0070679_100055491 3300005530 Bacteria 3944
122 Ga0070679_100262633 3300005530 Bacteria 1682
123 Ga0070684_100006951 3300005535 Bacteria 8790
124 Ga0070684_100016618 3300005535 Bacteria 6018
125 Ga0070684_100098053 3300005535 Bacteria 2614
126 Ga0068853_100016067 3300005539 Bacteria 6156
127 Ga0068853_100018749 3300005539 Bacteria 5731
128 Ga0068853_100019246 3300005539 Bacteria 5658
129 Ga0068853_100256372 3300005539 Bacteria 1607
130 Ga0068853_100668065 3300005539 Bacteria 990
131 Ga0070672_100000824 3300005543 Bacteria 18534
132 Ga0070672_100001034 3300005543 Bacteria 16942
133 Ga0070672_100136110 3300005543 Bacteria 2023
134 Ga0070695_100361054 3300005545 Bacteria 1091
135 Ga0070693_100151350 3300005547 Bacteria 1470
136 Ga0070693_100336782 3300005547 Bacteria 1028
137 Ga0070665_100021679 3300005548 Bacteria 6460
138 Ga0070665_100201467 3300005548 Bacteria 1991
139 Ga0070704_100033352 3300005549 Bacteria 3480
140 Ga0070704_100157512 3300005549 Bacteria 1793
141 Ga0068855_100003881 3300005563 Bacteria 18269
142 Ga0068855_100016354 3300005563 Bacteria 8921
143 Ga0068855_100133982 3300005563 Bacteria 2827
144 Ga0068855_100393642 3300005563 Bacteria 1519
145 Ga0068855_100792755 3300005563 Bacteria 1007
146 Ga0070664_100001653 3300005564 Bacteria 17820
147 Ga0070664_100006016 3300005564 Bacteria 9809
148 Ga0070664_100051878 3300005564 Bacteria 3473
149 Ga0070664_100080532 3300005564 Bacteria 2805
150 Ga0070664_100099768 3300005564 Bacteria 2524
151 Ga0070664_100211756 3300005564 Bacteria 1732
152 Ga0068857_100001618 3300005577 Bacteria 18074
153 Ga0068857_100003665 3300005577 Bacteria 12869
154 Ga0068857_100007108 3300005577 Bacteria 9643
155 Ga0068857_100071383 3300005577 Bacteria 3093
156 Ga0068857_100122755 3300005577 Bacteria 2340
157 Ga0068854_100033434 3300005578 Bacteria 3585
158 Ga0068854_100041971 3300005578 Bacteria 3235
159 Ga0068854_100043770 3300005578 Bacteria 3175
160 Ga0068854_100049070 3300005578 Bacteria 3014
161 Ga0068856_100000352 3300005614 Bacteria 50157
162 Ga0068856_100002212 3300005614 Bacteria 20140
163 Ga0068856_100010244 3300005614 Bacteria 9112
164 Ga0068856_100023580 3300005614 Bacteria 5983
165 Ga0068856_100082032 3300005614 Bacteria 3200
166 Ga0068856_100485290 3300005614 Bacteria 1257
167 Ga0070702_100004488 3300005615 Bacteria 6379
168 Ga0070702_100176194 3300005615 Bacteria 1395
169 Ga0068852_100000773 3300005616 Bacteria 21097
170 Ga0068852_100005811 3300005616 Bacteria 8858
171 Ga0068852_100025659 3300005616 Bacteria 4778
172 Ga0068852_100039439 3300005616 Bacteria 3976
173 Ga0068852_100120862 3300005616 Bacteria 2398
174 Ga0068859_100027011 3300005617 Bacteria 5758
175 Ga0068859_100118329 3300005617 Bacteria 2715
176 Ga0068864_100003658 3300005618 Bacteria 12713
177 Ga0068864_100014257 3300005618 Bacteria 6600
178 Ga0068866_10024168 3300005718 Bacteria 2836
179 Ga0068861_100012379 3300005719 Bacteria 5949
180 Ga0068861_100013855 3300005719 Bacteria 5650
181 Ga0068861_100036482 3300005719 Bacteria 3648
182 Ga0068861_100247724 3300005719 Bacteria 1519
183 Ga0068861_100312575 3300005719 Bacteria 1365
184 Ga0068851_10001455 3300005834 Bacteria 10374
185 Ga0068851_10003070 3300005834 Bacteria 7388
186 Ga0068851_10004826 3300005834 Bacteria 6103
187 Ga0068851_10004891 3300005834 Bacteria 6069
188 Ga0068851_10017890 3300005834 Bacteria 3411
189 Ga0068851_10048826 3300005834 Bacteria 2145
190 Ga0068870_10021432 3300005840 Bacteria 3161
191 Ga0068870_10025835 3300005840 Bacteria 2920
192 Ga0068863_100010535 3300005841 Bacteria 8978
193 Ga0068863_100021979 3300005841 Bacteria 6088
194 Ga0068863_100038684 3300005841 Bacteria 4537
195 Ga0068863_100097455 3300005841 Bacteria 2793
196 Ga0068863_100105963 3300005841 Bacteria 2675
197 Ga0068858_100004907 3300005842 Bacteria 13110
198 Ga0068858_100050068 3300005842 Bacteria 3866
199 Ga0068858_100365351 3300005842 Bacteria 1383
200 Ga0068860_100023880 3300005843 Bacteria 5910
201 Ga0068860_100035130 3300005843 Bacteria 4809
202 Ga0068860_100246236 3300005843 Bacteria 1740
203 Ga0068860_100430199 3300005843 Bacteria 1310
204 Ga0068862_100002754 3300005844 Bacteria 15415
205 Ga0068862_100041670 3300005844 Bacteria 3907
206 Ga0068862_100069554 3300005844 Bacteria 3038
207 Ga0068862_100093716 3300005844 Bacteria 2619
208 Ga0068862_100181208 3300005844 Bacteria 1891
209 Ga0075365_10039010 3300006038 Bacteria 3091
210 Ga0097621_100028347 3300006237 Bacteria 4413
211 Ga0097621_100178212 3300006237 Bacteria 1835
212 Ga0068871_100197758 3300006358 Bacteria 1734
213 Ga0075428_100333134 3300006844 Bacteria 1630
214 Ga0075430_100185269 3300006846 Bacteria 1731
215 Ga0075434_100072667 3300006871 Bacteria 3431
216 Ga0075434_100144958 3300006871 Bacteria 2395
217 Ga0075434_100294240 3300006871 Bacteria 1643
218 Ga0075434_100611294 3300006871 Bacteria 1109
219 Ga0068865_100017947 3300006881 Bacteria 4559
220 Ga0068865_100172881 3300006881 Bacteria 1658
221 Ga0097620_100027012 3300006931 Bacteria 5758
222 Ga0097620_100118327 3300006931 Bacteria 2715
223 Ga0105240_10006454 3300009093 Bacteria 17236
224 Ga0105240_10027454 3300009093 Bacteria 7450
225 Ga0105240_10077525 3300009093 Bacteria 4094
226 Ga0105240_10184091 3300009093 Bacteria 2462
227 Ga0111539_10005900 3300009094 Bacteria 15822
228 Ga0111539_10602031 3300009094 Bacteria 1280
229 Ga0105245_10073338 3300009098 Bacteria 3112
230 Ga0105245_10162224 3300009098 Bacteria 2122
231 Ga0105247_10076894 3300009101 Bacteria 2097
232 Ga0105243_10070666 3300009148 Bacteria 2820
233 Ga0105241_10008892 3300009174 Bacteria 7387
234 Ga0105241_10098206 3300009174 Bacteria 2323
235 Ga0105241_10198326 3300009174 Bacteria 1675
236 Ga0105248_10002044 3300009177 Bacteria 22366
237 Ga0105248_10544378 3300009177 Bacteria 1309
238 Ga0105237_10091743 3300009545 Bacteria 3027
239 Ga0105237_10097875 3300009545 Bacteria 2925
240 Ga0105237_10156383 3300009545 Bacteria 2277
241 Ga0105238_10002047 3300009551 Bacteria 20346
242 Ga0105238_10016725 3300009551 Bacteria 7432
243 Ga0105238_10429890 3300009551 Bacteria 1316
244 Ga0105249_10137822 3300009553 Bacteria 2337
245 Ga0105249_10314581 3300009553 Bacteria 1575
246 Ga0105249_10443664 3300009553 Bacteria 1335
247 Ga0105239_10085572 3300010375 Bacteria 3475
248 Ga0105239_10198582 3300010375 Bacteria 2247
249 Ga0157373_10004347 3300013100 Bacteria 10669
250 Ga0157373_10068500 3300013100 Bacteria 2508
251 Ga0157373_10190282 3300013100 Bacteria 1446
252 Ga0157371_10002076 3300013102 Bacteria 19624
253 Ga0157371_10136062 3300013102 Bacteria 1750
254 Ga0157371_10487890 3300013102 Bacteria 909
255 Ga0157370_10013300 3300013104 Bacteria 8479
256 Ga0157370_10081387 3300013104 Bacteria 3047
257 Ga0157370_10204802 3300013104 Bacteria 1830
258 Ga0157369_10002386 3300013105 Bacteria 22557
259 Ga0157369_10033327 3300013105 Bacteria 5661
260 Ga0157369_10042950 3300013105 Bacteria 4929
261 Ga0157369_10190744 3300013105 Bacteria 2154
262 Ga0157369_10399605 3300013105 Bacteria 1426
263 Ga0157374_10037309 3300013296 Bacteria 4460
264 Ga0157374_10049729 3300013296 Bacteria 3895
265 Ga0157374_10192978 3300013296 Bacteria 1992
266 Ga0157378_10032926 3300013297 Bacteria 4582
267 Ga0157378_10060540 3300013297 Bacteria 3378
268 Ga0157378_10069151 3300013297 Bacteria 3167
269 Ga0157378_10095255 3300013297 Bacteria 2711
270 Ga0163162_10142153 3300013306 Bacteria 2514
271 Ga0163162_10449192 3300013306 Bacteria 1421
272 Ga0157372_10000868 3300013307 Bacteria 32826
273 Ga0157372_10019933 3300013307 Bacteria 7229
274 Ga0157372_10069597 3300013307 Bacteria 3958
275 Ga0157372_10080809 3300013307 Bacteria 3679
276 Ga0157372_10148857 3300013307 Bacteria 2701
277 Ga0157372_10188652 3300013307 Bacteria 2387
278 Ga0157372_10467578 3300013307 Bacteria 1470
279 Ga0157372_10709150 3300013307 Bacteria 1171
280 Ga0157375_10011825 3300013308 Bacteria 7717
281 Ga0157375_10041809 3300013308 Bacteria 4430
282 Ga0157375_10179913 3300013308 Bacteria 2266
283 Ga0163163_10001567 3300014325 Bacteria 19293
284 Ga0163163_10071035 3300014325 Bacteria 3468
285 Ga0163163_10639020 3300014325 Bacteria 1128
286 Ga0157380_10011224 3300014326 Bacteria 6468
287 Ga0157380_10031222 3300014326 Bacteria 4089
288 Ga0157380_10194692 3300014326 Bacteria 1793
289 Ga0182008_10034474 3300014497 Bacteria 2538
290 Ga0157377_10003604 3300014745 Bacteria 7013
291 Ga0157379_10001124 3300014968 Bacteria 21866
292 Ga0157379_10009433 3300014968 Bacteria 8502
293 Ga0157379_10057028 3300014968 Bacteria 3491
294 Ga0157376_10037088 3300014969 Bacteria 3953
295 Ga0157376_10081210 3300014969 Bacteria 2783
296 Ga0157376_10606584 3300014969 Bacteria 1090
297 Ga0183360_10001 3300015689 Bacteria 3943671
298 Ga0163161_10019802 3300017792 Bacteria 4722
299 Ga0207425_1004282 3300025245 Bacteria 4330
300 Ga0209565_1000005 3300025263 Bacteria 947317
301 Ga0207666_1001999 3300025271 Bacteria 2435
302 Ga0209673_1000011 3300025273 Bacteria 586604
303 Ga0209673_1003898 3300025273 Bacteria 8393
304 Ga0209130_1005666 3300025284 Bacteria 4267
305 Ga0209675_1000004 3300025291 Bacteria 947166
306 Ga0209675_1005300 3300025291 Bacteria 5430
307 Ga0209675_1010527 3300025291 Bacteria 3148
308 Ga0209676_1000472 3300025292 Bacteria 67063
309 Ga0209676_1000857 3300025292 Bacteria 39244
310 Ga0209676_1001048 3300025292 Bacteria 31833
311 Ga0209676_1002293 3300025292 Bacteria 13961
312 Ga0209025_1000005 3300025294 Bacteria 1272149
313 Ga0209025_1001267 3300025294 Bacteria 34816
314 Ga0209025_1013136 3300025294 Bacteria 5229
315 Ga0209564_1000018 3300025295 Bacteria 586913
316 Ga0209564_1006241 3300025295 Bacteria 6501
317 Ga0209758_1034629 3300025297 Bacteria 2005
318 Ga0209050_1001432 3300025298 Bacteria 25688
319 Ga0209256_1000031 3300025299 Bacteria 410189
320 Ga0209256_1001506 3300025299 Bacteria 23600
321 Ga0209256_1004781 3300025299 Bacteria 8237
322 Ga0209256_1007727 3300025299 Bacteria 5207
323 Ga0209051_1025684 3300025303 Bacteria 2391
324 Ga0209257_1000255 3300025304 Bacteria 123098
325 Ga0209257_1000715 3300025304 Bacteria 51044
326 Ga0209257_1001117 3300025304 Bacteria 34675
327 Ga0209257_1003071 3300025304 Bacteria 15043
328 Ga0209257_1003627 3300025304 Bacteria 12981
329 Ga0207697_10000570 3300025315 Bacteria 20951
330 Ga0207697_10041953 3300025315 Bacteria 1879
331 Ga0207656_10001877 3300025321 Bacteria 6990
332 Ga0207656_10010980 3300025321 Bacteria 3409
333 Ga0207656_10015078 3300025321 Bacteria 2987
334 Ga0207656_10016205 3300025321 Bacteria 2899
335 Ga0207656_10020774 3300025321 Bacteria 2613
336 Ga0207656_10047132 3300025321 Bacteria 1852
337 Ga0207682_10000037 3300025893 Bacteria 54103
338 Ga0207682_10001668 3300025893 Bacteria 10184
339 Ga0207642_10082365 3300025899 Bacteria 1566
340 Ga0207688_10001415 3300025901 Bacteria 12502
341 Ga0207680_10061796 3300025903 Bacteria 2285
342 Ga0207680_10100108 3300025903 Bacteria 1861
343 Ga0207647_10097086 3300025904 Bacteria 1753
344 Ga0207647_10138966 3300025904 Bacteria 1424
345 Ga0207645_10001825 3300025907 Bacteria 17179
346 Ga0207645_10008253 3300025907 Bacteria 7280
347 Ga0207645_10049429 3300025907 Bacteria 2685
348 Ga0207643_10000184 3300025908 Bacteria 43056
349 Ga0207643_10025680 3300025908 Bacteria 3258
350 Ga0207705_10079161 3300025909 Bacteria 2393
351 Ga0207705_10268454 3300025909 Bacteria 1304
352 Ga0207654_10022758 3300025911 Bacteria 3348
353 Ga0207654_10057677 3300025911 Bacteria 2257
354 Ga0207654_10235128 3300025911 Bacteria 1222
355 Ga0207654_10364875 3300025911 Bacteria 997
356 Ga0207707_10001968 3300025912 Bacteria 18649
357 Ga0207707_10002953 3300025912 Bacteria 15142
358 Ga0207707_10007126 3300025912 Bacteria 9741
359 Ga0207695_10008152 3300025913 Bacteria 13173
360 Ga0207695_10104624 3300025913 Bacteria 2819
361 Ga0207695_10126634 3300025913 Bacteria 2515
362 Ga0207671_10056139 3300025914 Bacteria 2917
363 Ga0207663_10112901 3300025916 Bacteria 1847
364 Ga0207663_10212871 3300025916 Bacteria 1402
365 Ga0207660_10016235 3300025917 Bacteria 4927
366 Ga0207660_10031286 3300025917 Bacteria 3662
367 Ga0207660_10044661 3300025917 Bacteria 3117
368 Ga0207662_10000381 3300025918 Bacteria 19870
369 Ga0207657_10000102 3300025919 Bacteria 82096
370 Ga0207657_10002428 3300025919 Bacteria 20129
371 Ga0207657_10009399 3300025919 Bacteria 9831
372 Ga0207657_10011151 3300025919 Bacteria 8933
373 Ga0207657_10036598 3300025919 Bacteria 4391
374 Ga0207657_10126002 3300025919 Bacteria 2103
375 Ga0207657_10140579 3300025919 Bacteria 1973
376 Ga0207649_10002170 3300025920 Bacteria 11096
377 Ga0207649_10051585 3300025920 Bacteria 2548
378 Ga0207649_10081247 3300025920 Bacteria 2098
379 Ga0207649_10095164 3300025920 Bacteria 1959
380 Ga0207649_10129175 3300025920 Bacteria 1714
381 Ga0207652_10023450 3300025921 Bacteria 5113
382 Ga0207652_10057299 3300025921 Bacteria 3355
383 Ga0207652_10179700 3300025921 Bacteria 1901
384 Ga0207681_10037717 3300025923 Bacteria 3196
385 Ga0207681_10038997 3300025923 Bacteria 3151
386 Ga0207681_10042134 3300025923 Bacteria 3047
387 Ga0207694_10001672 3300025924 Bacteria 18592
388 Ga0207694_10034094 3300025924 Bacteria 3902
389 Ga0207650_10000534 3300025925 Bacteria 31116
390 Ga0207650_10008143 3300025925 Bacteria 7146
391 Ga0207659_10000713 3300025926 Bacteria 19773
392 Ga0207659_10114925 3300025926 Bacteria 2052
393 Ga0207687_10218575 3300025927 Bacteria 1499
394 Ga0207700_10281408 3300025928 Bacteria 1431
395 Ga0207664_10035335 3300025929 Bacteria 3855
396 Ga0207664_10118805 3300025929 Bacteria 2209
397 Ga0207664_10524888 3300025929 Bacteria 1061
398 Ga0207644_10009523 3300025931 Bacteria 6382
399 Ga0207644_10014319 3300025931 Bacteria 5305
400 Ga0207644_10031990 3300025931 Bacteria 3668
401 Ga0207644_10204817 3300025931 Bacteria 1557
402 Ga0207644_10409472 3300025931 Bacteria 1109
403 Ga0207690_10027829 3300025932 Bacteria 3576
404 Ga0207690_10041228 3300025932 Bacteria 3024
405 Ga0207690_10091333 3300025932 Bacteria 2152
406 Ga0207690_10117117 3300025932 Bacteria 1928
407 Ga0207706_10002115 3300025933 Bacteria 19440
408 Ga0207706_10053287 3300025933 Bacteria 3572
409 Ga0207706_10100135 3300025933 Bacteria 2550
410 Ga0207709_10280449 3300025935 Bacteria 1230
411 Ga0207670_10026331 3300025936 Bacteria 3663
412 Ga0207669_10003118 3300025937 Bacteria 7142
413 Ga0207704_10107855 3300025938 Bacteria 1874
414 Ga0207691_10000024 3300025940 Bacteria 132111
415 Ga0207691_10013184 3300025940 Bacteria 7914
416 Ga0207691_10018214 3300025940 Bacteria 6651
417 Ga0207691_10041073 3300025940 Bacteria 4273
418 Ga0207691_10063836 3300025940 Bacteria 3339
419 Ga0207691_10200399 3300025940 Bacteria 1737
420 Ga0207711_10008833 3300025941 Bacteria 8422
421 Ga0207711_10023627 3300025941 Bacteria 5147
422 Ga0207711_10037186 3300025941 Bacteria 4133
423 Ga0207689_10000280 3300025942 Bacteria 46392
424 Ga0207689_10002437 3300025942 Bacteria 17322
425 Ga0207689_10075595 3300025942 Bacteria 2769
426 Ga0207689_10123682 3300025942 Bacteria 2128
427 Ga0207661_10024176 3300025944 Bacteria 4601
428 Ga0207661_10063257 3300025944 Bacteria 2997
429 Ga0207661_10119981 3300025944 Bacteria 2237
430 Ga0207679_10006518 3300025945 Bacteria 7381
431 Ga0207679_10013121 3300025945 Bacteria 5426
432 Ga0207679_10016676 3300025945 Bacteria 4879
433 Ga0207679_10158946 3300025945 Bacteria 1848
434 Ga0207679_10246892 3300025945 Bacteria 1515
435 Ga0207679_10433889 3300025945 Bacteria 1162
436 Ga0207667_10000233 3300025949 Bacteria 77272
437 Ga0207667_10018851 3300025949 Bacteria 7724
438 Ga0207667_10025679 3300025949 Bacteria 6445
439 Ga0207667_10044309 3300025949 Bacteria 4715
440 Ga0207667_10090024 3300025949 Bacteria 3171
441 Ga0207667_10225883 3300025949 Bacteria 1918
442 Ga0207667_10260994 3300025949 Bacteria 1771
443 Ga0207651_10004138 3300025960 Bacteria 7250
444 Ga0207651_10028815 3300025960 Bacteria 3508
445 Ga0207651_10076105 3300025960 Bacteria 2398
446 Ga0207651_10114650 3300025960 Bacteria 2030
447 Ga0207712_10167314 3300025961 Bacteria 1715
448 Ga0207712_10459604 3300025961 Bacteria 1081
449 Ga0207668_10175414 3300025972 Bacteria 1685
450 Ga0207668_10244377 3300025972 Bacteria 1454
451 Ga0207668_10535704 3300025972 Bacteria 1012
452 Ga0207640_10016411 3300025981 Bacteria 4308
453 Ga0207640_10046246 3300025981 Bacteria 2799
454 Ga0207640_10182204 3300025981 Bacteria 1576
455 Ga0207658_10003432 3300025986 Bacteria 11217
456 Ga0207658_10009658 3300025986 Bacteria 6545
457 Ga0207658_10013773 3300025986 Bacteria 5533
458 Ga0207658_10127141 3300025986 Bacteria 2042
459 Ga0207658_10128740 3300025986 Bacteria 2030
460 Ga0207658_10173026 3300025986 Bacteria 1781
461 Ga0207677_10030187 3300026023 Bacteria 3456
462 Ga0207677_10041599 3300026023 Bacteria 3040
463 Ga0207677_10329241 3300026023 Bacteria 1272
464 Ga0207677_10437407 3300026023 Bacteria 1118
465 Ga0207703_10001378 3300026035 Bacteria 22200
466 Ga0207703_10037884 3300026035 Bacteria 3844
467 Ga0207703_10041259 3300026035 Bacteria 3696
468 Ga0207703_10062016 3300026035 Bacteria 3062
469 Ga0207703_10186588 3300026035 Bacteria 1834
470 Ga0207703_10478288 3300026035 Bacteria 1167
471 Ga0207639_10027674 3300026041 Bacteria 4133
472 Ga0207639_10042399 3300026041 Bacteria 3410
473 Ga0207639_10082677 3300026041 Bacteria 2546
474 Ga0207639_10461026 3300026041 Bacteria 1155
475 Ga0207639_10616462 3300026041 Bacteria 1002
476 Ga0207678_10002265 3300026067 Bacteria 17417
477 Ga0207678_10012930 3300026067 Bacteria 7325
478 Ga0207678_10012994 3300026067 Bacteria 7306
479 Ga0207678_10018535 3300026067 Bacteria 6112
480 Ga0207678_10038834 3300026067 Bacteria 4134
481 Ga0207678_10316043 3300026067 Bacteria 1343
482 Ga0207708_10002250 3300026075 Bacteria 14203
483 Ga0207708_10076007 3300026075 Bacteria 2576
484 Ga0207702_10000597 3300026078 Bacteria 39958
485 Ga0207702_10002745 3300026078 Bacteria 16477
486 Ga0207702_10003655 3300026078 Bacteria 13933
487 Ga0207641_10008312 3300026088 Bacteria 8577
488 Ga0207641_10008392 3300026088 Bacteria 8535
489 Ga0207641_10012888 3300026088 Bacteria 6859
490 Ga0207641_10132766 3300026088 Bacteria 2237
491 Ga0207641_10362301 3300026088 Bacteria 1384
492 Ga0207648_10001593 3300026089 Bacteria 24841
493 Ga0207648_10005178 3300026089 Bacteria 13201
494 Ga0207648_10010379 3300026089 Bacteria 8830
495 Ga0207648_10023595 3300026089 Bacteria 5508
496 Ga0207648_10271111 3300026089 Bacteria 1516
497 Ga0207648_10846984 3300026089 Bacteria 853
498 Ga0207676_10003016 3300026095 Bacteria 12009
499 Ga0207676_10084873 3300026095 Bacteria 2582
500 Ga0207676_10089313 3300026095 Bacteria 2525
501 Ga0207676_10619444 3300026095 Bacteria 1041
502 Ga0207674_10001568 3300026116 Bacteria 29439
503 Ga0207674_10002723 3300026116 Bacteria 22045
504 Ga0207674_10007142 3300026116 Bacteria 13045
505 Ga0207674_10010383 3300026116 Bacteria 10553
506 Ga0207674_10541571 3300026116 Bacteria 1125
507 Ga0207675_100000538 3300026118 Bacteria 36903
508 Ga0207675_100000981 3300026118 Bacteria 28343
509 Ga0207675_100019499 3300026118 Bacteria 6329
510 Ga0207675_100294357 3300026118 Bacteria 1580
511 Ga0207683_10000012 3300026121 Bacteria 134768
512 Ga0207683_10002415 3300026121 Bacteria 16316
513 Ga0207683_10209360 3300026121 Bacteria 1774
514 Ga0207698_10002317 3300026142 Bacteria 11278
515 Ga0207698_10009337 3300026142 Bacteria 6250
516 Ga0207698_10042564 3300026142 Bacteria 3394
517 Ga0207698_10066748 3300026142 Bacteria 2833
518 Ga0207698_10099409 3300026142 Bacteria 2406
519 Ga0207698_10149715 3300026142 Bacteria 2023
520 Ga0209969_1007075 3300027360 Bacteria 1583
521 Ga0209983_1010239 3300027665 Bacteria 1915
522 Ga0209971_1003476 3300027682 Bacteria 3735
523 Ga0209974_10001787 3300027876 Bacteria 7838
524 Ga0209974_10007961 3300027876 Bacteria 3634
525 Ga0207428_10104165 3300027907 Bacteria 2190
526 Ga0268266_10012004 3300028379 Bacteria 7497
527 Ga0268266_10014078 3300028379 Bacteria 6885
528 Ga0268266_10014494 3300028379 Bacteria 6775
529 Ga0268266_10170524 3300028379 Bacteria 1975
530 Ga0268265_10108423 3300028380 Bacteria 2261
531 Ga0268265_10316915 3300028380 Bacteria 1410
532 Ga0268264_10000715 3300028381 Bacteria 38163
533 Ga0268264_10070958 3300028381 Bacteria 2950
534 Ga0268264_10103801 3300028381 Bacteria 2476
535 Ga0268264_10247456 3300028381 Bacteria 1654
536 Ga0316176_1170459 3300030732 Bacteria 3648
537 Ga0314311_1038789 3300030733 Bacteria 3996
538 Ga0307408_100012994 3300031548 Bacteria 5521
539 Ga0307408_100230229 3300031548 Bacteria 1517
540 Ga0307408_100337856 3300031548 Bacteria 1274
541 Ga0316576_10044230 3300031727 Bacteria 3216
542 Ga0316576_10044602 3300031727 Bacteria 3203
543 Ga0316576_10246947 3300031727 Bacteria 1340
544 Ga0316578_10208925 3300031728 Bacteria 1174
545 Ga0307405_10006485 3300031731 Bacteria 5759
546 Ga0307405_10083844 3300031731 Bacteria 2090
547 Ga0307405_10093808 3300031731 Bacteria 1995
548 Ga0307405_10265139 3300031731 Bacteria 1285
549 Ga0316577_10125339 3300031733 Bacteria 1444
550 Ga0307413_10000671 3300031824 Bacteria 11682
551 Ga0307413_10168424 3300031824 Bacteria 1547
552 Ga0307410_10053119 3300031852 Bacteria 2740
553 Ga0307410_10278215 3300031852 Bacteria 1312
554 Ga0307410_10368776 3300031852 Bacteria 1152
555 Ga0307406_10002817 3300031901 Bacteria 9480
556 Ga0307406_10010659 3300031901 Bacteria 5191
557 Ga0307406_10076680 3300031901 Bacteria 2209
558 Ga0307407_10026799 3300031903 Bacteria 3057
559 Ga0307412_10048448 3300031911 Bacteria 2795
560 Ga0307412_10052107 3300031911 Bacteria 2708
561 Ga0307412_10148000 3300031911 Bacteria 1729
562 Ga0307409_100006853 3300031995 Bacteria 6750
563 Ga0307409_100073753 3300031995 Bacteria 2724
564 Ga0307409_100217339 3300031995 Bacteria 1723
565 Ga0307409_100299231 3300031995 Bacteria 1496
566 Ga0307416_100034049 3300032002 Bacteria 3871
567 Ga0307416_100071084 3300032002 Bacteria 2889
568 Ga0307416_100117996 3300032002 Bacteria 2357
569 Ga0307416_100355603 3300032002 Bacteria 1484
570 Ga0307416_100510597 3300032002 Bacteria 1268
571 Ga0307414_10015482 3300032004 Bacteria 4603
572 Ga0307414_10216998 3300032004 Bacteria 1568
573 Ga0307414_10247562 3300032004 Bacteria 1479
574 Ga0307411_10000781 3300032005 Bacteria 11792
575 Ga0307411_10056063 3300032005 Bacteria 2595
576 Ga0307411_10201086 3300032005 Bacteria 1530
577 Ga0307411_10380770 3300032005 Bacteria 1160
578 Ga0307415_100008495 3300032126 Bacteria 5697
579 Ga0373949_0028531 3300035090 Bacteria 1318
580 Ga0373943_0076921 3300035170 Bacteria 1703
581 Ga0373946_0161195 3300035171 Bacteria 1053
582 Ga0373961_0022424 3300035241 Bacteria 1690
583 Ga0316574_0070911 3300035398 Bacteria 2200
584 Ga0316574_0199283 3300035398 Bacteria 1286
585 Ga0316582_0132205 3300036647 Bacteria 1677
586 Ga0316584_0013687 3300036712 Bacteria 5752
587 Ga0316584_0032259 3300036712 Bacteria 3877
588 Ga0373925_0294135 3300037068 Bacteria 1310
589 Ga0395905_0043100 3300037471 Bacteria 4234
590 Ga0242420_015757 3300038996 Bacteria 1310
591 Ga0439447_004281 3300041407 Bacteria 4952
592 Ga0439465_0016994 3300041413 Bacteria 2270
593 Ga0451853_3157308 3300041512 Bacteria 1378
594 Ga0439433_0024590 3300041999 Bacteria 1358
595 Ga0439449_0023590 3300042007 Bacteria 2300
596 Ga0439462_0030597 3300042015 Bacteria 1424
597 Ga0439462_0048193 3300042015 Bacteria 1143
598 Ga0451577_0578595 3300042876 Bacteria 1019
599 Ga0495580_0249396 3300046472 Bacteria 1216
600 Ga0495663_0054621 3300046525 Bacteria 1244
601 Ga0495621_0034478 3300046539 Bacteria 1749
602 Ga0495656_0090655 3300046615 Bacteria 1397
603 Ga0495668_0003858 3300046616 Bacteria 10961
604 Ga0495647_0039929 3300046681 Bacteria 1781
605 Ga0495670_0256772 3300046691 Bacteria 932
606 Ga0495636_0012361 3300047318 Bacteria 3379
607 Ga0495636_0035997 3300047318 Bacteria 2040
608 Ga0495636_0150113 3300047318 Bacteria 1045
609 Ga0496100_0352536 3300048903 Bacteria 1112
610 Ga0496101_0018812 3300048904 Bacteria 4704
611 Ga0496102_0044103 3300048905 Bacteria 4046
612 Ga0496102_0132926 3300048905 Bacteria 2330
613 Ga0496102_0249972 3300048905 Bacteria 1672
614 Ga0496102_0485223 3300048905 Bacteria 1157
615 Ga0496103_0021237 3300048906 Bacteria 3906
616 Ga0496103_0067798 3300048906 Bacteria 2229
617 Ga0496103_0166033 3300048906 Bacteria 1416
618 Ga0496104_0021874 3300048907 Bacteria 5874
619 Ga0496106_0031062 3300048909 Bacteria 3981
620 Ga0496106_0134934 3300048909 Bacteria 1938
621 Ga0496107_0092068 3300048910 Bacteria 2216
622 Ga0496107_0122445 3300048910 Bacteria 1916
623 Ga0496108_0027107 3300048911 Bacteria 4727
624 Ga0496108_0088421 3300048911 Bacteria 2632
625 Ga0496108_0221810 3300048911 Bacteria 1643
626 Ga0496108_0602472 3300048911 Bacteria 957
627 Ga0496109_0018670 3300048912 Bacteria 6095
628 Ga0496109_0053323 3300048912 Bacteria 3687
629 Ga0496109_0081059 3300048912 Bacteria 2990
630 Ga0496110_0010489 3300048913 Bacteria 7540
631 Ga0496110_0320487 3300048913 Bacteria 1412
632 Ga0496111_0021905 3300048914 Bacteria 4467
633 Ga0496112_0003817 3300048915 Bacteria 12593
634 Ga0496112_0199124 3300048915 Bacteria 1963
635 Ga0496113_0385997 3300048916 Bacteria 1124
636 Ga0496114_0024195 3300048917 Bacteria 4956
637 Ga0496121_0002370 3300048924 Bacteria 28968
638 Ga0496124_0206654 3300048927 Bacteria 1489
639 Ga0501032_0037025 3300049569 Bacteria 3328
640 Ga0501034_0173842 3300049571 Bacteria 2120
641 Ga0501038_0047763 3300049574 Bacteria 3707
642 Ga0501039_0072673 3300049575 Bacteria 2673
643 Ga0501040_0307182 3300049576 Bacteria 1134
644 Ga0501042_0171962 3300049578 Bacteria 1563
645 Ga0501043_0061245 3300049579 Bacteria 2955
646 Ga0501046_0311702 3300049580 Bacteria 1148
647 Ga0501047_0205080 3300049581 Bacteria 1831
648 Ga0501071_0107637 3300049587 Bacteria 2059
649 Ga0501072_0105788 3300049588 Bacteria 2238
650 Ga0501072_0117470 3300049588 Bacteria 2119
651 Ga0501202_020523 3300049652 Bacteria 1314
652 Ga0501209_080941 3300049656 Bacteria 936
653 Ga0501223_032335 3300049663 Bacteria 1018
654 Ga0501253_015981 3300049683 Bacteria 1242
655 Ga0501245_022618 3300049708 Bacteria 993
656 Ga0501080_0057521 3300049742 Bacteria 3620
657 Ga0501266_015497 3300049763 Bacteria 1007
658 Ga0501268_001560 3300049765 Bacteria 2880
659 Ga0501270_002433 3300049767 Bacteria 1906
660 Ga0501274_004103 3300049771 Bacteria 1192
661 Ga0501035_0136034 3300049822 Bacteria 2139
662 Ga0501044_0095350 3300049823 Bacteria 2998
663 Ga0501045_0240091 3300049824 Bacteria 1349
664 nmdc:mga0yw44_9694_c1 3300050492 Bacteria 4887
665 nmdc:mga08y16_162705_c1 3300050511 Bacteria 2319
666 nmdc:mga0n895_666919_c1 3300050512 Bacteria 1038
667 nmdc:mga0n895_86311_c1 3300050512 Bacteria 3134
668 nmdc:mga0a205_199027_c1 3300050515 Bacteria 1894

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026089 Ga0207648_10846984 Ga0207648_108469841 199
2 3300025940 Ga0207691_10200399 Ga0207691_102003992 210
3 3300035398 Ga0316574_0070911 Ga0316574_0070911_203_1006 231
4 3300035398 Ga0316574_0199283 Ga0316574_0199283_260_1063 231
5 3300036647 Ga0316582_0132205 Ga0316582_0132205_376_1179 231
6 3300036712 Ga0316584_0013687 Ga0316584_0013687_3847_4650 231
7 iso_pu_bacteria 2952252522 2952252651 236
8 3300005334 Ga0068869_100101091 Ga0068869_1001010912 241
9 3300005336 Ga0070680_100154792 Ga0070680_1001547921 241
10 3300005438 Ga0070701_10178619 Ga0070701_101786192 241
11 3300005441 Ga0070700_100043889 Ga0070700_1000438894 241
12 3300005444 Ga0070694_100124288 Ga0070694_1001242882 241
13 3300005545 Ga0070695_100361054 Ga0070695_1003610541 241
14 3300005549 Ga0070704_100033352 Ga0070704_1000333521 241
15 3300005719 Ga0068861_100036482 Ga0068861_1000364822 241
16 3300005844 Ga0068862_100069554 Ga0068862_1000695542 241
17 3300009148 Ga0105243_10070666 Ga0105243_100706662 241
18 3300014326 Ga0157380_10011224 Ga0157380_100112245 241
19 3300014326 Ga0157380_10194692 Ga0157380_101946922 241
20 3300025917 Ga0207660_10031286 Ga0207660_100312862 241
21 3300025935 Ga0207709_10280449 Ga0207709_102804492 241
22 3300025942 Ga0207689_10075595 Ga0207689_100755953 241
23 3300026075 Ga0207708_10076007 Ga0207708_100760074 241
24 3300026118 Ga0207675_100019499 Ga0207675_1000194992 241
25 3300031727 Ga0316576_10044230 Ga0316576_100442303 241
26 3300031727 Ga0316576_10044602 Ga0316576_100446022 241
27 3300031727 Ga0316576_10246947 Ga0316576_102469472 241
28 3300031728 Ga0316578_10208925 Ga0316578_102089252 241
29 3300031731 Ga0307405_10265139 Ga0307405_102651392 241
30 3300031733 Ga0316577_10125339 Ga0316577_101253392 241
31 3300031995 Ga0307409_100217339 Ga0307409_1002173393 241
32 3300049569 Ga0501032_0037025 Ga0501032_0037025_1707_2516 242
33 3300049574 Ga0501038_0047763 Ga0501038_0047763_2476_3285 242
34 3300049575 Ga0501039_0072673 Ga0501039_0072673_1608_2417 242
35 3300049581 Ga0501047_0205080 Ga0501047_0205080_575_1384 242
36 3300049588 Ga0501072_0117470 Ga0501072_0117470_552_1367 242
37 3300049742 Ga0501080_0057521 Ga0501080_0057521_1524_2333 242
38 3300049822 Ga0501035_0136034 Ga0501035_0136034_895_1704 242
39 3300049823 Ga0501044_0095350 Ga0501044_0095350_746_1555 242
40 3300003320 rootH2_10263331 rootH2_102633311 243
41 3300005337 Ga0070682_100017775 Ga0070682_1000177755 243
42 3300009098 Ga0105245_10073338 Ga0105245_100733385 243
43 3300025927 Ga0207687_10218575 Ga0207687_102185753 243
44 3300049587 Ga0501071_0107637 Ga0501071_0107637_1221_2006 243
45 3300049588 Ga0501072_0105788 Ga0501072_0105788_1002_1817 243
46 3300036712 Ga0316584_0032259 Ga0316584_0032259_1230_2030 248
47 iso_pu_bacteria 2643221559 2643818734 249
48 iso_pu_bacteria 2643221586 2643940985 249
49 iso_pu_bacteria 2643221593 2643975810 249
50 iso_pu_bacteria 2643221612 2644079973 249
51 iso_pu_bacteria 2643221727 2644695568 249
52 iso_pu_bacteria 2941489479 2941491431 249
53 iso_pu_bacteria 2995948881 2995952466 249
54 iso_pu_bacteria 8003014200 8003016311 249
55 3300006038 Ga0075365_10039010 Ga0075365_100390104 251
56 3300009093 Ga0105240_10184091 Ga0105240_101840912 251
57 3300031911 Ga0307412_10048448 Ga0307412_100484482 251
58 3300037068 Ga0373925_0294135 Ga0373925_0294135_249_1058 251
59 3300041999 Ga0439433_0024590 Ga0439433_0024590_36_818 251
60 3300050492 nmdc:mga0yw44_9694_c1 nmdc:mga0yw44_9694_c1_3300_4085 251
61 3300003775 Ga0055524_1000206 Ga0055524_100020632 252
62 3300003781 Ga0055536_1001400 Ga0055536_10014002 252
63 3300003784 Ga0055534_1000164 Ga0055534_100016420 252
64 3300003790 Ga0055528_1000027 Ga0055528_100002733 252
65 3300003791 Ga0055530_10002733 Ga0055530_100027335 252
66 3300005367 Ga0070667_100203747 Ga0070667_1002037473 252
67 3300015689 Ga0183360_10001 Ga0183360_10001756 252
68 3300025245 Ga0207425_1004282 Ga0207425_10042822 252
69 3300025263 Ga0209565_1000005 Ga0209565_1000005366 252
70 3300025273 Ga0209673_1000011 Ga0209673_100001121 252
71 3300025273 Ga0209673_1003898 Ga0209673_10038985 252
72 3300025284 Ga0209130_1005666 Ga0209130_10056663 252
73 3300025291 Ga0209675_1000004 Ga0209675_1000004366 252
74 3300025291 Ga0209675_1005300 Ga0209675_10053002 252
75 3300025291 Ga0209675_1010527 Ga0209675_10105273 252
76 3300025292 Ga0209676_1000472 Ga0209676_100047211 252
77 3300025292 Ga0209676_1000857 Ga0209676_100085716 252
78 3300025292 Ga0209676_1001048 Ga0209676_100104823 252
79 3300025292 Ga0209676_1002293 Ga0209676_100229314 252
80 3300025294 Ga0209025_1000005 Ga0209025_100000534 252
81 3300025294 Ga0209025_1001267 Ga0209025_100126731 252
82 3300025294 Ga0209025_1013136 Ga0209025_10131367 252
83 3300025295 Ga0209564_1000018 Ga0209564_100001821 252
84 3300025295 Ga0209564_1006241 Ga0209564_10062415 252
85 3300025297 Ga0209758_1034629 Ga0209758_10346292 252
86 3300025298 Ga0209050_1001432 Ga0209050_100143217 252
87 3300025299 Ga0209256_1000031 Ga0209256_1000031365 252
88 3300025299 Ga0209256_1001506 Ga0209256_10015066 252
89 3300025299 Ga0209256_1004781 Ga0209256_10047812 252
90 3300025299 Ga0209256_1007727 Ga0209256_10077272 252
91 3300025303 Ga0209051_1025684 Ga0209051_10256842 252
92 3300025304 Ga0209257_1000255 Ga0209257_10002555 252
93 3300025304 Ga0209257_1000715 Ga0209257_100071557 252
94 3300025304 Ga0209257_1001117 Ga0209257_10011171 252
95 3300025304 Ga0209257_1003071 Ga0209257_10030715 252
96 3300025304 Ga0209257_1003627 Ga0209257_10036272 252
97 3300025986 Ga0207658_10173026 Ga0207658_101730263 252
98 3300031901 Ga0307406_10002817 Ga0307406_100028172 252
99 3300032002 Ga0307416_100510597 Ga0307416_1005105972 252
100 3300032004 Ga0307414_10015482 Ga0307414_100154822 252
101 3300041407 Ga0439447_004281 Ga0439447_004281_3224_4009 252
102 3300041413 Ga0439465_0016994 Ga0439465_0016994_620_1405 252
103 3300042007 Ga0439449_0023590 Ga0439449_0023590_343_1128 252
104 3300042015 Ga0439462_0030597 Ga0439462_0030597_428_1213 252
105 3300042015 Ga0439462_0048193 Ga0439462_0048193_306_1091 252
106 3300046616 Ga0495668_0003858 Ga0495668_0003858_9734_10519 252
107 3300047318 Ga0495636_0012361 Ga0495636_0012361_2443_3228 252
108 3300048924 Ga0496121_0002370 Ga0496121_0002370_673_1458 252
109 3300049579 Ga0501043_0061245 Ga0501043_0061245_348_1133 252
110 3300049824 Ga0501045_0240091 Ga0501045_0240091_109_894 252
111 3300005331 Ga0070670_100424371 Ga0070670_1004243711 253
112 3300005355 Ga0070671_100068995 Ga0070671_1000689952 253
113 3300005364 Ga0070673_100070400 Ga0070673_1000704003 253
114 3300005615 Ga0070702_100176194 Ga0070702_1001761942 253
115 3300005618 Ga0068864_100014257 Ga0068864_1000142575 253
116 3300005841 Ga0068863_100097455 Ga0068863_1000974552 253
117 3300005844 Ga0068862_100093716 Ga0068862_1000937163 253
118 3300009177 Ga0105248_10544378 Ga0105248_105443782 253
119 3300025931 Ga0207644_10204817 Ga0207644_102048172 253
120 3300025960 Ga0207651_10076105 Ga0207651_100761052 253
121 3300026095 Ga0207676_10089313 Ga0207676_100893132 253
122 3300030732 Ga0316176_1170459 Ga0316176_11704595 253
123 3300030733 Ga0314311_1038789 Ga0314311_10387896 253
124 3300031548 Ga0307408_100230229 Ga0307408_1002302292 253
125 3300031548 Ga0307408_100337856 Ga0307408_1003378562 253
126 3300031731 Ga0307405_10083844 Ga0307405_100838442 253
127 3300031824 Ga0307413_10168424 Ga0307413_101684242 253
128 3300031852 Ga0307410_10053119 Ga0307410_100531194 253
129 3300031901 Ga0307406_10076680 Ga0307406_100766803 253
130 3300032002 Ga0307416_100071084 Ga0307416_1000710842 253
131 3300032002 Ga0307416_100117996 Ga0307416_1001179962 253
132 3300032004 Ga0307414_10247562 Ga0307414_102475622 253
133 3300032005 Ga0307411_10056063 Ga0307411_100560632 253
134 3300032005 Ga0307411_10201086 Ga0307411_102010863 253
135 3300046525 Ga0495663_0054621 Ga0495663_0054621_235_1032 253
136 3300046615 Ga0495656_0090655 Ga0495656_0090655_177_974 253
137 3300046691 Ga0495670_0256772 Ga0495670_0256772_65_862 253
138 3300047318 Ga0495636_0035997 Ga0495636_0035997_128_925 253
139 3300047318 Ga0495636_0150113 Ga0495636_0150113_195_992 253
140 3300048905 Ga0496102_0485223 Ga0496102_0485223_342_1139 253
141 3300048910 Ga0496107_0092068 Ga0496107_0092068_993_1790 253
142 3300048911 Ga0496108_0602472 Ga0496108_0602472_15_812 253
143 3300048912 Ga0496109_0053323 Ga0496109_0053323_835_1632 253
144 3300048914 Ga0496111_0021905 Ga0496111_0021905_3395_4192 253
145 3300048915 Ga0496112_0199124 Ga0496112_0199124_579_1376 253
146 3300048927 Ga0496124_0206654 Ga0496124_0206654_254_1051 253
147 3300049652 Ga0501202_020523 Ga0501202_020523_38_835 253
148 3300049656 Ga0501209_080941 Ga0501209_080941_87_884 253
149 3300049663 Ga0501223_032335 Ga0501223_032335_143_940 253
150 3300049683 Ga0501253_015981 Ga0501253_015981_195_992 253
151 3300049708 Ga0501245_022618 Ga0501245_022618_144_941 253
152 3300049763 Ga0501266_015497 Ga0501266_015497_28_825 253
153 3300049765 Ga0501268_001560 Ga0501268_001560_553_1350 253
154 3300049767 Ga0501270_002433 Ga0501270_002433_1035_1832 253
155 3300049771 Ga0501274_004103 Ga0501274_004103_293_1090 253
156 3300005353 Ga0070669_100049666 Ga0070669_1000496662 254
157 3300041512 Ga0451853_3157308 Ga0451853_3157308_449_1252 254
158 3300049571 Ga0501034_0173842 Ga0501034_0173842_446_1249 254
159 3300025904 Ga0207647_10138966 Ga0207647_101389662 262
160 3300006871 Ga0075434_100072667 Ga0075434_1000726671 270
161 3300013105 Ga0157369_10399605 Ga0157369_103996052 271
162 3300025321 Ga0207656_10047132 Ga0207656_100471322 271
163 3300005293 Ga0065715_10164276 Ga0065715_101642761 273
164 3300005328 Ga0070676_10079311 Ga0070676_100793112 273
165 3300005331 Ga0070670_100010473 Ga0070670_1000104738 273
166 3300005331 Ga0070670_100016063 Ga0070670_1000160633 273
167 3300005334 Ga0068869_100002085 Ga0068869_10000208510 273
168 3300005335 Ga0070666_10103753 Ga0070666_101037532 273
169 3300005343 Ga0070687_100018652 Ga0070687_1000186522 273
170 3300005353 Ga0070669_100096618 Ga0070669_1000966182 273
171 3300005364 Ga0070673_100004665 Ga0070673_1000046653 273
172 3300005365 Ga0070688_100288542 Ga0070688_1002885422 273
173 3300005367 Ga0070667_100010847 Ga0070667_1000108477 273
174 3300005440 Ga0070705_100097872 Ga0070705_1000978723 273
175 3300005459 Ga0068867_100105010 Ga0068867_1001050101 273
176 3300005459 Ga0068867_100174181 Ga0068867_1001741811 273
177 3300005577 Ga0068857_100003665 Ga0068857_10000366511 273
178 3300005578 Ga0068854_100049070 Ga0068854_1000490702 273
179 3300005617 Ga0068859_100027011 Ga0068859_1000270115 273
180 3300005618 Ga0068864_100003658 Ga0068864_10000365813 273
181 3300005719 Ga0068861_100012379 Ga0068861_1000123797 273
182 3300005841 Ga0068863_100021979 Ga0068863_1000219795 273
183 3300005841 Ga0068863_100038684 Ga0068863_1000386846 273
184 3300005841 Ga0068863_100105963 Ga0068863_1001059632 273
185 3300005843 Ga0068860_100023880 Ga0068860_1000238803 273
186 3300005843 Ga0068860_100246236 Ga0068860_1002462362 273
187 3300005843 Ga0068860_100430199 Ga0068860_1004301992 273
188 3300005844 Ga0068862_100002754 Ga0068862_10000275413 273
189 3300005844 Ga0068862_100041670 Ga0068862_1000416705 273
190 3300005844 Ga0068862_100181208 Ga0068862_1001812083 273
191 3300006871 Ga0075434_100611294 Ga0075434_1006112942 273
192 3300006881 Ga0068865_100172881 Ga0068865_1001728812 273
193 3300006931 Ga0097620_100027012 Ga0097620_1000270125 273
194 3300009094 Ga0111539_10602031 Ga0111539_106020312 273
195 3300009177 Ga0105248_10002044 Ga0105248_1000204420 273
196 3300009553 Ga0105249_10443664 Ga0105249_104436641 273
197 3300013297 Ga0157378_10069151 Ga0157378_100691514 273
198 3300013308 Ga0157375_10179913 Ga0157375_101799132 273
199 3300014325 Ga0163163_10001567 Ga0163163_100015676 273
200 3300014968 Ga0157379_10001124 Ga0157379_100011248 273
201 3300025899 Ga0207642_10082365 Ga0207642_100823652 273
202 3300025907 Ga0207645_10008253 Ga0207645_100082532 273
203 3300025923 Ga0207681_10037717 Ga0207681_100377172 273
204 3300025923 Ga0207681_10038997 Ga0207681_100389972 273
205 3300025925 Ga0207650_10008143 Ga0207650_100081435 273
206 3300025941 Ga0207711_10008833 Ga0207711_100088332 273
207 3300025942 Ga0207689_10000280 Ga0207689_1000028020 273
208 3300025961 Ga0207712_10459604 Ga0207712_104596041 273
209 3300025972 Ga0207668_10175414 Ga0207668_101754141 273
210 3300025986 Ga0207658_10009658 Ga0207658_100096586 273
211 3300025986 Ga0207658_10127141 Ga0207658_101271412 273
212 3300026023 Ga0207677_10030187 Ga0207677_100301872 273
213 3300026035 Ga0207703_10001378 Ga0207703_100013784 273
214 3300026088 Ga0207641_10008312 Ga0207641_100083125 273
215 3300026088 Ga0207641_10012888 Ga0207641_100128885 273
216 3300026088 Ga0207641_10362301 Ga0207641_103623012 273
217 3300026089 Ga0207648_10005178 Ga0207648_1000517813 273
218 3300026095 Ga0207676_10003016 Ga0207676_1000301611 273
219 3300026116 Ga0207674_10007142 Ga0207674_100071423 273
220 3300026118 Ga0207675_100000981 Ga0207675_10000098115 273
221 3300028380 Ga0268265_10108423 Ga0268265_101084233 273
222 3300028381 Ga0268264_10000715 Ga0268264_1000071513 273
223 3300028381 Ga0268264_10070958 Ga0268264_100709582 273
224 3300031731 Ga0307405_10093808 Ga0307405_100938082 273
225 3300031852 Ga0307410_10278215 Ga0307410_102782152 273
226 3300031852 Ga0307410_10368776 Ga0307410_103687761 273
227 3300031911 Ga0307412_10148000 Ga0307412_101480003 273
228 3300031995 Ga0307409_100073753 Ga0307409_1000737533 273
229 3300032002 Ga0307416_100355603 Ga0307416_1003556032 273
230 3300032004 Ga0307414_10216998 Ga0307414_102169982 273
231 3300032005 Ga0307411_10380770 Ga0307411_103807701 273
232 3300048903 Ga0496100_0352536 Ga0496100_0352536_147_974 273
233 3300048906 Ga0496103_0021237 Ga0496103_0021237_1362_2189 273
234 3300048911 Ga0496108_0088421 Ga0496108_0088421_171_998 273
235 3300048912 Ga0496109_0018670 Ga0496109_0018670_4952_5779 273
236 3300048912 Ga0496109_0081059 Ga0496109_0081059_1032_1853 273
237 3300001976 JGI24752J21851_1002344 JGI24752J21851_10023442 274
238 3300001978 JGI24747J21853_1000416 JGI24747J21853_10004164 274
239 3300001990 JGI24737J22298_10026321 JGI24737J22298_100263212 274
240 3300002155 JGI24033J26618_1006613 JGI24033J26618_10066132 274
241 3300002239 JGI24034J26672_10003260 JGI24034J26672_100032602 274
242 3300002244 JGI24742J22300_10006158 JGI24742J22300_100061582 274
243 3300005327 Ga0070658_10010428 Ga0070658_100104288 274
244 3300005327 Ga0070658_10223651 Ga0070658_102236511 274
245 3300005328 Ga0070676_10021807 Ga0070676_100218072 274
246 3300005328 Ga0070676_10033957 Ga0070676_100339574 274
247 3300005328 Ga0070676_10044557 Ga0070676_100445572 274
248 3300005328 Ga0070676_10228769 Ga0070676_102287691 274
249 3300005329 Ga0070683_100035699 Ga0070683_1000356994 274
250 3300005329 Ga0070683_100104562 Ga0070683_1001045622 274
251 3300005329 Ga0070683_100299069 Ga0070683_1002990691 274
252 3300005330 Ga0070690_100067434 Ga0070690_1000674342 274
253 3300005331 Ga0070670_100001361 Ga0070670_10000136118 274
254 3300005331 Ga0070670_100376144 Ga0070670_1003761442 274
255 3300005333 Ga0070677_10001351 Ga0070677_100013516 274
256 3300005333 Ga0070677_10039239 Ga0070677_100392393 274
257 3300005334 Ga0068869_100016238 Ga0068869_1000162382 274
258 3300005334 Ga0068869_100182958 Ga0068869_1001829582 274
259 3300005335 Ga0070666_10058348 Ga0070666_100583483 274
260 3300005335 Ga0070666_10124781 Ga0070666_101247812 274
261 3300005335 Ga0070666_10286238 Ga0070666_102862381 274
262 3300005336 Ga0070680_100130082 Ga0070680_1001300823 274
263 3300005338 Ga0068868_100001366 Ga0068868_1000013667 274
264 3300005338 Ga0068868_100005837 Ga0068868_1000058372 274
265 3300005339 Ga0070660_100008372 Ga0070660_1000083728 274
266 3300005339 Ga0070660_100014412 Ga0070660_1000144122 274
267 3300005339 Ga0070660_100036902 Ga0070660_1000369022 274
268 3300005339 Ga0070660_100116390 Ga0070660_1001163902 274
269 3300005339 Ga0070660_100173267 Ga0070660_1001732671 274
270 3300005339 Ga0070660_100219590 Ga0070660_1002195902 274
271 3300005344 Ga0070661_100001117 Ga0070661_1000011172 274
272 3300005344 Ga0070661_100003926 Ga0070661_10000392611 274
273 3300005344 Ga0070661_100012543 Ga0070661_1000125434 274
274 3300005344 Ga0070661_100049843 Ga0070661_1000498432 274
275 3300005344 Ga0070661_100076708 Ga0070661_1000767084 274
276 3300005347 Ga0070668_100001120 Ga0070668_10000112015 274
277 3300005347 Ga0070668_100047740 Ga0070668_1000477402 274
278 3300005347 Ga0070668_100204857 Ga0070668_1002048572 274
279 3300005347 Ga0070668_100236777 Ga0070668_1002367772 274
280 3300005354 Ga0070675_100013337 Ga0070675_1000133377 274
281 3300005354 Ga0070675_100092570 Ga0070675_1000925704 274
282 3300005354 Ga0070675_100150125 Ga0070675_1001501252 274
283 3300005354 Ga0070675_100186431 Ga0070675_1001864313 274
284 3300005355 Ga0070671_100001808 Ga0070671_1000018089 274
285 3300005355 Ga0070671_100001980 Ga0070671_10000198013 274
286 3300005355 Ga0070671_100003000 Ga0070671_10000300012 274
287 3300005355 Ga0070671_100409565 Ga0070671_1004095651 274
288 3300005356 Ga0070674_100000120 Ga0070674_1000001208 274
289 3300005356 Ga0070674_100003810 Ga0070674_1000038104 274
290 3300005364 Ga0070673_100007284 Ga0070673_1000072847 274
291 3300005364 Ga0070673_100007452 Ga0070673_1000074529 274
292 3300005364 Ga0070673_100209279 Ga0070673_1002092791 274
293 3300005364 Ga0070673_100238712 Ga0070673_1002387122 274
294 3300005365 Ga0070688_100026678 Ga0070688_1000266783 274
295 3300005366 Ga0070659_100010091 Ga0070659_1000100915 274
296 3300005366 Ga0070659_100025398 Ga0070659_1000253984 274
297 3300005366 Ga0070659_100027022 Ga0070659_1000270222 274
298 3300005366 Ga0070659_100027216 Ga0070659_1000272166 274
299 3300005366 Ga0070659_100168539 Ga0070659_1001685392 274
300 3300005367 Ga0070667_100007635 Ga0070667_1000076352 274
301 3300005367 Ga0070667_100026761 Ga0070667_1000267615 274
302 3300005367 Ga0070667_100171120 Ga0070667_1001711202 274
303 3300005434 Ga0070709_10072007 Ga0070709_100720072 274
304 3300005434 Ga0070709_10108278 Ga0070709_101082781 274
305 3300005435 Ga0070714_100008331 Ga0070714_1000083311 274
306 3300005435 Ga0070714_100021200 Ga0070714_1000212006 274
307 3300005436 Ga0070713_100147307 Ga0070713_1001473073 274
308 3300005436 Ga0070713_100245381 Ga0070713_1002453811 274
309 3300005438 Ga0070701_10006671 Ga0070701_100066712 274
310 3300005441 Ga0070700_100003437 Ga0070700_1000034376 274
311 3300005455 Ga0070663_100003931 Ga0070663_1000039318 274
312 3300005455 Ga0070663_100004128 Ga0070663_10000412810 274
313 3300005455 Ga0070663_100047935 Ga0070663_1000479352 274
314 3300005456 Ga0070678_100001904 Ga0070678_1000019044 274
315 3300005456 Ga0070678_100069755 Ga0070678_1000697553 274
316 3300005456 Ga0070678_100150461 Ga0070678_1001504612 274
317 3300005456 Ga0070678_100241425 Ga0070678_1002414252 274
318 3300005457 Ga0070662_100000231 Ga0070662_10000023114 274
319 3300005457 Ga0070662_100298379 Ga0070662_1002983792 274
320 3300005457 Ga0070662_100339856 Ga0070662_1003398561 274
321 3300005458 Ga0070681_10001697 Ga0070681_100016975 274
322 3300005458 Ga0070681_10046933 Ga0070681_100469335 274
323 3300005459 Ga0068867_100025632 Ga0068867_1000256322 274
324 3300005459 Ga0068867_100085484 Ga0068867_1000854844 274
325 3300005530 Ga0070679_100031634 Ga0070679_1000316343 274
326 3300005530 Ga0070679_100055491 Ga0070679_1000554912 274
327 3300005530 Ga0070679_100262633 Ga0070679_1002626332 274
328 3300005535 Ga0070684_100006951 Ga0070684_10000695110 274
329 3300005535 Ga0070684_100016618 Ga0070684_1000166187 274
330 3300005535 Ga0070684_100098053 Ga0070684_1000980532 274
331 3300005539 Ga0068853_100016067 Ga0068853_1000160672 274
332 3300005539 Ga0068853_100018749 Ga0068853_1000187498 274
333 3300005539 Ga0068853_100019246 Ga0068853_1000192465 274
334 3300005539 Ga0068853_100256372 Ga0068853_1002563722 274
335 3300005539 Ga0068853_100668065 Ga0068853_1006680651 274
336 3300005543 Ga0070672_100000824 Ga0070672_10000082414 274
337 3300005543 Ga0070672_100001034 Ga0070672_10000103412 274
338 3300005543 Ga0070672_100136110 Ga0070672_1001361101 274
339 3300005547 Ga0070693_100151350 Ga0070693_1001513502 274
340 3300005547 Ga0070693_100336782 Ga0070693_1003367821 274
341 3300005548 Ga0070665_100021679 Ga0070665_1000216797 274
342 3300005548 Ga0070665_100201467 Ga0070665_1002014673 274
343 3300005549 Ga0070704_100157512 Ga0070704_1001575122 274
344 3300005563 Ga0068855_100003881 Ga0068855_1000038815 274
345 3300005563 Ga0068855_100016354 Ga0068855_1000163542 274
346 3300005563 Ga0068855_100133982 Ga0068855_1001339823 274
347 3300005563 Ga0068855_100393642 Ga0068855_1003936423 274
348 3300005563 Ga0068855_100792755 Ga0068855_1007927551 274
349 3300005564 Ga0070664_100001653 Ga0070664_1000016533 274
350 3300005564 Ga0070664_100006016 Ga0070664_1000060164 274
351 3300005564 Ga0070664_100051878 Ga0070664_1000518784 274
352 3300005564 Ga0070664_100080532 Ga0070664_1000805322 274
353 3300005564 Ga0070664_100099768 Ga0070664_1000997682 274
354 3300005564 Ga0070664_100211756 Ga0070664_1002117563 274
355 3300005577 Ga0068857_100001618 Ga0068857_10000161812 274
356 3300005577 Ga0068857_100007108 Ga0068857_1000071085 274
357 3300005577 Ga0068857_100071383 Ga0068857_1000713833 274
358 3300005577 Ga0068857_100122755 Ga0068857_1001227552 274
359 3300005578 Ga0068854_100033434 Ga0068854_1000334342 274
360 3300005578 Ga0068854_100041971 Ga0068854_1000419712 274
361 3300005578 Ga0068854_100043770 Ga0068854_1000437702 274
362 3300005614 Ga0068856_100000352 Ga0068856_10000035232 274
363 3300005614 Ga0068856_100002212 Ga0068856_1000022128 274
364 3300005614 Ga0068856_100010244 Ga0068856_1000102442 274
365 3300005614 Ga0068856_100023580 Ga0068856_1000235802 274
366 3300005614 Ga0068856_100082032 Ga0068856_1000820325 274
367 3300005614 Ga0068856_100485290 Ga0068856_1004852902 274
368 3300005615 Ga0070702_100004488 Ga0070702_1000044882 274
369 3300005616 Ga0068852_100000773 Ga0068852_10000077319 274
370 3300005616 Ga0068852_100005811 Ga0068852_1000058112 274
371 3300005616 Ga0068852_100025659 Ga0068852_1000256595 274
372 3300005616 Ga0068852_100039439 Ga0068852_1000394392 274
373 3300005616 Ga0068852_100120862 Ga0068852_1001208624 274
374 3300005617 Ga0068859_100118329 Ga0068859_1001183294 274
375 3300005718 Ga0068866_10024168 Ga0068866_100241683 274
376 3300005719 Ga0068861_100013855 Ga0068861_1000138554 274
377 3300005719 Ga0068861_100247724 Ga0068861_1002477242 274
378 3300005719 Ga0068861_100312575 Ga0068861_1003125753 274
379 3300005834 Ga0068851_10001455 Ga0068851_100014555 274
380 3300005834 Ga0068851_10003070 Ga0068851_100030706 274
381 3300005834 Ga0068851_10004826 Ga0068851_100048267 274
382 3300005834 Ga0068851_10004891 Ga0068851_100048913 274
383 3300005834 Ga0068851_10017890 Ga0068851_100178902 274
384 3300005834 Ga0068851_10048826 Ga0068851_100488262 274
385 3300005840 Ga0068870_10021432 Ga0068870_100214324 274
386 3300005840 Ga0068870_10025835 Ga0068870_100258351 274
387 3300005841 Ga0068863_100010535 Ga0068863_1000105352 274
388 3300005842 Ga0068858_100004907 Ga0068858_10000490711 274
389 3300005842 Ga0068858_100050068 Ga0068858_1000500682 274
390 3300005842 Ga0068858_100365351 Ga0068858_1003653512 274
391 3300005843 Ga0068860_100035130 Ga0068860_1000351303 274
392 3300006237 Ga0097621_100028347 Ga0097621_1000283472 274
393 3300006237 Ga0097621_100178212 Ga0097621_1001782122 274
394 3300006358 Ga0068871_100197758 Ga0068871_1001977583 274
395 3300006844 Ga0075428_100333134 Ga0075428_1003331343 274
396 3300006846 Ga0075430_100185269 Ga0075430_1001852692 274
397 3300006871 Ga0075434_100144958 Ga0075434_1001449582 274
398 3300006871 Ga0075434_100294240 Ga0075434_1002942402 274
399 3300006881 Ga0068865_100017947 Ga0068865_1000179473 274
400 3300006931 Ga0097620_100118327 Ga0097620_1001183274 274
401 3300009093 Ga0105240_10006454 Ga0105240_1000645417 274
402 3300009093 Ga0105240_10027454 Ga0105240_100274543 274
403 3300009093 Ga0105240_10077525 Ga0105240_100775252 274
404 3300009094 Ga0111539_10005900 Ga0111539_100059004 274
405 3300009098 Ga0105245_10162224 Ga0105245_101622241 274
406 3300009101 Ga0105247_10076894 Ga0105247_100768942 274
407 3300009174 Ga0105241_10008892 Ga0105241_100088928 274
408 3300009174 Ga0105241_10098206 Ga0105241_100982062 274
409 3300009174 Ga0105241_10198326 Ga0105241_101983262 274
410 3300009545 Ga0105237_10091743 Ga0105237_100917432 274
411 3300009545 Ga0105237_10097875 Ga0105237_100978752 274
412 3300009545 Ga0105237_10156383 Ga0105237_101563832 274
413 3300009551 Ga0105238_10002047 Ga0105238_100020473 274
414 3300009551 Ga0105238_10016725 Ga0105238_100167252 274
415 3300009551 Ga0105238_10429890 Ga0105238_104298901 274
416 3300009553 Ga0105249_10137822 Ga0105249_101378221 274
417 3300009553 Ga0105249_10314581 Ga0105249_103145813 274
418 3300010375 Ga0105239_10085572 Ga0105239_100855722 274
419 3300010375 Ga0105239_10198582 Ga0105239_101985823 274
420 3300013100 Ga0157373_10004347 Ga0157373_100043479 274
421 3300013100 Ga0157373_10068500 Ga0157373_100685002 274
422 3300013100 Ga0157373_10190282 Ga0157373_101902822 274
423 3300013102 Ga0157371_10002076 Ga0157371_1000207613 274
424 3300013102 Ga0157371_10136062 Ga0157371_101360623 274
425 3300013102 Ga0157371_10487890 Ga0157371_104878901 274
426 3300013104 Ga0157370_10013300 Ga0157370_100133001 274
427 3300013104 Ga0157370_10081387 Ga0157370_100813872 274
428 3300013104 Ga0157370_10204802 Ga0157370_102048022 274
429 3300013105 Ga0157369_10002386 Ga0157369_1000238610 274
430 3300013105 Ga0157369_10033327 Ga0157369_100333276 274
431 3300013105 Ga0157369_10042950 Ga0157369_100429506 274
432 3300013105 Ga0157369_10190744 Ga0157369_101907442 274
433 3300013296 Ga0157374_10037309 Ga0157374_100373096 274
434 3300013296 Ga0157374_10049729 Ga0157374_100497294 274
435 3300013296 Ga0157374_10192978 Ga0157374_101929782 274
436 3300013297 Ga0157378_10032926 Ga0157378_100329267 274
437 3300013297 Ga0157378_10060540 Ga0157378_100605405 274
438 3300013297 Ga0157378_10095255 Ga0157378_100952554 274
439 3300013306 Ga0163162_10142153 Ga0163162_101421533 274
440 3300013306 Ga0163162_10449192 Ga0163162_104491922 274
441 3300013307 Ga0157372_10000868 Ga0157372_1000086813 274
442 3300013307 Ga0157372_10019933 Ga0157372_100199334 274
443 3300013307 Ga0157372_10069597 Ga0157372_100695974 274
444 3300013307 Ga0157372_10080809 Ga0157372_100808095 274
445 3300013307 Ga0157372_10148857 Ga0157372_101488572 274
446 3300013307 Ga0157372_10188652 Ga0157372_101886524 274
447 3300013307 Ga0157372_10467578 Ga0157372_104675782 274
448 3300013307 Ga0157372_10709150 Ga0157372_107091502 274
449 3300013308 Ga0157375_10011825 Ga0157375_100118254 274
450 3300013308 Ga0157375_10041809 Ga0157375_100418096 274
451 3300014325 Ga0163163_10071035 Ga0163163_100710355 274
452 3300014325 Ga0163163_10639020 Ga0163163_106390202 274
453 3300014326 Ga0157380_10031222 Ga0157380_100312223 274
454 3300014497 Ga0182008_10034474 Ga0182008_100344742 274
455 3300014745 Ga0157377_10003604 Ga0157377_100036046 274
456 3300014968 Ga0157379_10009433 Ga0157379_100094339 274
457 3300014968 Ga0157379_10057028 Ga0157379_100570284 274
458 3300014969 Ga0157376_10037088 Ga0157376_100370885 274
459 3300014969 Ga0157376_10081210 Ga0157376_100812103 274
460 3300014969 Ga0157376_10606584 Ga0157376_106065842 274
461 3300017792 Ga0163161_10019802 Ga0163161_100198024 274
462 3300025271 Ga0207666_1001999 Ga0207666_10019993 274
463 3300025315 Ga0207697_10000570 Ga0207697_1000057014 274
464 3300025315 Ga0207697_10041953 Ga0207697_100419532 274
465 3300025321 Ga0207656_10001877 Ga0207656_100018775 274
466 3300025321 Ga0207656_10010980 Ga0207656_100109802 274
467 3300025321 Ga0207656_10015078 Ga0207656_100150782 274
468 3300025321 Ga0207656_10016205 Ga0207656_100162051 274
469 3300025321 Ga0207656_10020774 Ga0207656_100207741 274
470 3300025893 Ga0207682_10000037 Ga0207682_1000003727 274
471 3300025893 Ga0207682_10001668 Ga0207682_100016684 274
472 3300025901 Ga0207688_10001415 Ga0207688_100014152 274
473 3300025903 Ga0207680_10061796 Ga0207680_100617961 274
474 3300025903 Ga0207680_10100108 Ga0207680_101001082 274
475 3300025904 Ga0207647_10097086 Ga0207647_100970862 274
476 3300025907 Ga0207645_10001825 Ga0207645_1000182512 274
477 3300025907 Ga0207645_10049429 Ga0207645_100494292 274
478 3300025908 Ga0207643_10000184 Ga0207643_1000018418 274
479 3300025908 Ga0207643_10025680 Ga0207643_100256804 274
480 3300025909 Ga0207705_10079161 Ga0207705_100791614 274
481 3300025909 Ga0207705_10268454 Ga0207705_102684542 274
482 3300025911 Ga0207654_10022758 Ga0207654_100227585 274
483 3300025911 Ga0207654_10057677 Ga0207654_100576773 274
484 3300025911 Ga0207654_10235128 Ga0207654_102351281 274
485 3300025911 Ga0207654_10364875 Ga0207654_103648751 274
486 3300025912 Ga0207707_10001968 Ga0207707_1000196814 274
487 3300025912 Ga0207707_10002953 Ga0207707_100029532 274
488 3300025912 Ga0207707_10007126 Ga0207707_100071262 274
489 3300025913 Ga0207695_10008152 Ga0207695_100081523 274
490 3300025913 Ga0207695_10104624 Ga0207695_101046242 274
491 3300025913 Ga0207695_10126634 Ga0207695_101266342 274
492 3300025914 Ga0207671_10056139 Ga0207671_100561393 274
493 3300025916 Ga0207663_10112901 Ga0207663_101129012 274
494 3300025916 Ga0207663_10212871 Ga0207663_102128713 274
495 3300025917 Ga0207660_10016235 Ga0207660_100162356 274
496 3300025917 Ga0207660_10044661 Ga0207660_100446614 274
497 3300025918 Ga0207662_10000381 Ga0207662_1000038114 274
498 3300025919 Ga0207657_10000102 Ga0207657_1000010271 274
499 3300025919 Ga0207657_10002428 Ga0207657_1000242817 274
500 3300025919 Ga0207657_10009399 Ga0207657_1000939910 274
501 3300025919 Ga0207657_10011151 Ga0207657_100111518 274
502 3300025919 Ga0207657_10036598 Ga0207657_100365984 274
503 3300025919 Ga0207657_10126002 Ga0207657_101260022 274
504 3300025919 Ga0207657_10140579 Ga0207657_101405793 274
505 3300025920 Ga0207649_10002170 Ga0207649_100021702 274
506 3300025920 Ga0207649_10051585 Ga0207649_100515853 274
507 3300025920 Ga0207649_10081247 Ga0207649_100812471 274
508 3300025920 Ga0207649_10095164 Ga0207649_100951641 274
509 3300025920 Ga0207649_10129175 Ga0207649_101291752 274
510 3300025921 Ga0207652_10023450 Ga0207652_100234503 274
511 3300025921 Ga0207652_10057299 Ga0207652_100572992 274
512 3300025921 Ga0207652_10179700 Ga0207652_101797002 274
513 3300025923 Ga0207681_10042134 Ga0207681_100421342 274
514 3300025924 Ga0207694_10001672 Ga0207694_100016722 274
515 3300025924 Ga0207694_10034094 Ga0207694_100340942 274
516 3300025925 Ga0207650_10000534 Ga0207650_100005346 274
517 3300025926 Ga0207659_10000713 Ga0207659_100007136 274
518 3300025926 Ga0207659_10114925 Ga0207659_101149252 274
519 3300025928 Ga0207700_10281408 Ga0207700_102814082 274
520 3300025929 Ga0207664_10035335 Ga0207664_100353353 274
521 3300025929 Ga0207664_10118805 Ga0207664_101188051 274
522 3300025929 Ga0207664_10524888 Ga0207664_105248881 274
523 3300025931 Ga0207644_10009523 Ga0207644_100095235 274
524 3300025931 Ga0207644_10014319 Ga0207644_100143194 274
525 3300025931 Ga0207644_10031990 Ga0207644_100319902 274
526 3300025931 Ga0207644_10409472 Ga0207644_104094722 274
527 3300025932 Ga0207690_10027829 Ga0207690_100278292 274
528 3300025932 Ga0207690_10041228 Ga0207690_100412281 274
529 3300025932 Ga0207690_10091333 Ga0207690_100913331 274
530 3300025932 Ga0207690_10117117 Ga0207690_101171172 274
531 3300025933 Ga0207706_10002115 Ga0207706_1000211514 274
532 3300025933 Ga0207706_10053287 Ga0207706_100532872 274
533 3300025933 Ga0207706_10100135 Ga0207706_101001353 274
534 3300025936 Ga0207670_10026331 Ga0207670_100263315 274
535 3300025937 Ga0207669_10003118 Ga0207669_100031188 274
536 3300025938 Ga0207704_10107855 Ga0207704_101078553 274
537 3300025940 Ga0207691_10000024 Ga0207691_1000002432 274
538 3300025940 Ga0207691_10013184 Ga0207691_100131844 274
539 3300025940 Ga0207691_10018214 Ga0207691_100182143 274
540 3300025940 Ga0207691_10041073 Ga0207691_100410735 274
541 3300025940 Ga0207691_10063836 Ga0207691_100638362 274
542 3300025941 Ga0207711_10023627 Ga0207711_100236274 274
543 3300025941 Ga0207711_10037186 Ga0207711_100371863 274
544 3300025942 Ga0207689_10002437 Ga0207689_1000243711 274
545 3300025942 Ga0207689_10123682 Ga0207689_101236822 274
546 3300025944 Ga0207661_10024176 Ga0207661_100241764 274
547 3300025944 Ga0207661_10063257 Ga0207661_100632574 274
548 3300025944 Ga0207661_10119981 Ga0207661_101199811 274
549 3300025945 Ga0207679_10006518 Ga0207679_100065185 274
550 3300025945 Ga0207679_10013121 Ga0207679_100131212 274
551 3300025945 Ga0207679_10016676 Ga0207679_100166765 274
552 3300025945 Ga0207679_10158946 Ga0207679_101589463 274
553 3300025945 Ga0207679_10246892 Ga0207679_102468922 274
554 3300025945 Ga0207679_10433889 Ga0207679_104338892 274
555 3300025949 Ga0207667_10000233 Ga0207667_1000023327 274
556 3300025949 Ga0207667_10018851 Ga0207667_100188513 274
557 3300025949 Ga0207667_10025679 Ga0207667_100256794 274
558 3300025949 Ga0207667_10044309 Ga0207667_100443092 274
559 3300025949 Ga0207667_10090024 Ga0207667_100900243 274
560 3300025949 Ga0207667_10225883 Ga0207667_102258832 274
561 3300025949 Ga0207667_10260994 Ga0207667_102609943 274
562 3300025960 Ga0207651_10004138 Ga0207651_100041385 274
563 3300025960 Ga0207651_10028815 Ga0207651_100288155 274
564 3300025960 Ga0207651_10114650 Ga0207651_101146503 274
565 3300025961 Ga0207712_10167314 Ga0207712_101673142 274
566 3300025972 Ga0207668_10244377 Ga0207668_102443771 274
567 3300025972 Ga0207668_10535704 Ga0207668_105357041 274
568 3300025981 Ga0207640_10016411 Ga0207640_100164113 274
569 3300025981 Ga0207640_10046246 Ga0207640_100462463 274
570 3300025981 Ga0207640_10182204 Ga0207640_101822041 274
571 3300025986 Ga0207658_10003432 Ga0207658_100034328 274
572 3300025986 Ga0207658_10013773 Ga0207658_100137732 274
573 3300025986 Ga0207658_10128740 Ga0207658_101287401 274
574 3300026023 Ga0207677_10041599 Ga0207677_100415994 274
575 3300026023 Ga0207677_10329241 Ga0207677_103292411 274
576 3300026023 Ga0207677_10437407 Ga0207677_104374071 274
577 3300026035 Ga0207703_10037884 Ga0207703_100378843 274
578 3300026035 Ga0207703_10041259 Ga0207703_100412592 274
579 3300026035 Ga0207703_10062016 Ga0207703_100620164 274
580 3300026035 Ga0207703_10186588 Ga0207703_101865882 274
581 3300026035 Ga0207703_10478288 Ga0207703_104782881 274
582 3300026041 Ga0207639_10027674 Ga0207639_100276744 274
583 3300026041 Ga0207639_10042399 Ga0207639_100423992 274
584 3300026041 Ga0207639_10082677 Ga0207639_100826773 274
585 3300026041 Ga0207639_10461026 Ga0207639_104610261 274
586 3300026041 Ga0207639_10616462 Ga0207639_106164621 274
587 3300026067 Ga0207678_10002265 Ga0207678_100022652 274
588 3300026067 Ga0207678_10012930 Ga0207678_100129307 274
589 3300026067 Ga0207678_10012994 Ga0207678_100129949 274
590 3300026067 Ga0207678_10018535 Ga0207678_100185356 274
591 3300026067 Ga0207678_10038834 Ga0207678_100388342 274
592 3300026067 Ga0207678_10316043 Ga0207678_103160432 274
593 3300026075 Ga0207708_10002250 Ga0207708_1000225010 274
594 3300026078 Ga0207702_10000597 Ga0207702_1000059713 274
595 3300026078 Ga0207702_10002745 Ga0207702_100027452 274
596 3300026078 Ga0207702_10003655 Ga0207702_1000365514 274
597 3300026088 Ga0207641_10008392 Ga0207641_100083922 274
598 3300026088 Ga0207641_10132766 Ga0207641_101327662 274
599 3300026089 Ga0207648_10001593 Ga0207648_100015936 274
600 3300026089 Ga0207648_10010379 Ga0207648_100103799 274
601 3300026089 Ga0207648_10023595 Ga0207648_100235951 274
602 3300026089 Ga0207648_10271111 Ga0207648_102711112 274
603 3300026095 Ga0207676_10084873 Ga0207676_100848734 274
604 3300026095 Ga0207676_10619444 Ga0207676_106194441 274
605 3300026116 Ga0207674_10001568 Ga0207674_1000156821 274
606 3300026116 Ga0207674_10002723 Ga0207674_100027239 274
607 3300026116 Ga0207674_10010383 Ga0207674_100103837 274
608 3300026116 Ga0207674_10541571 Ga0207674_105415711 274
609 3300026118 Ga0207675_100000538 Ga0207675_10000053815 274
610 3300026118 Ga0207675_100294357 Ga0207675_1002943572 274
611 3300026121 Ga0207683_10000012 Ga0207683_1000001266 274
612 3300026121 Ga0207683_10002415 Ga0207683_100024154 274
613 3300026121 Ga0207683_10209360 Ga0207683_102093602 274
614 3300026142 Ga0207698_10002317 Ga0207698_1000231711 274
615 3300026142 Ga0207698_10009337 Ga0207698_100093376 274
616 3300026142 Ga0207698_10042564 Ga0207698_100425642 274
617 3300026142 Ga0207698_10066748 Ga0207698_100667483 274
618 3300026142 Ga0207698_10099409 Ga0207698_100994093 274
619 3300026142 Ga0207698_10149715 Ga0207698_101497151 274
620 3300027360 Ga0209969_1007075 Ga0209969_10070752 274
621 3300027665 Ga0209983_1010239 Ga0209983_10102392 274
622 3300027682 Ga0209971_1003476 Ga0209971_10034762 274
623 3300027876 Ga0209974_10001787 Ga0209974_100017872 274
624 3300027876 Ga0209974_10007961 Ga0209974_100079614 274
625 3300027907 Ga0207428_10104165 Ga0207428_101041652 274
626 3300028379 Ga0268266_10012004 Ga0268266_100120046 274
627 3300028379 Ga0268266_10014078 Ga0268266_100140785 274
628 3300028379 Ga0268266_10014494 Ga0268266_100144946 274
629 3300028379 Ga0268266_10170524 Ga0268266_101705242 274
630 3300028380 Ga0268265_10316915 Ga0268265_103169152 274
631 3300028381 Ga0268264_10103801 Ga0268264_101038012 274
632 3300028381 Ga0268264_10247456 Ga0268264_102474563 274
633 3300031548 Ga0307408_100012994 Ga0307408_1000129942 274
634 3300031731 Ga0307405_10006485 Ga0307405_100064856 274
635 3300031824 Ga0307413_10000671 Ga0307413_100006713 274
636 3300031901 Ga0307406_10010659 Ga0307406_100106594 274
637 3300031903 Ga0307407_10026799 Ga0307407_100267992 274
638 3300031911 Ga0307412_10052107 Ga0307412_100521072 274
639 3300031995 Ga0307409_100006853 Ga0307409_1000068534 274
640 3300031995 Ga0307409_100299231 Ga0307409_1002992312 274
641 3300032002 Ga0307416_100034049 Ga0307416_1000340494 274
642 3300032005 Ga0307411_10000781 Ga0307411_100007813 274
643 3300032126 Ga0307415_100008495 Ga0307415_1000084956 274
644 3300035090 Ga0373949_0028531 Ga0373949_0028531_31_855 274
645 3300035170 Ga0373943_0076921 Ga0373943_0076921_348_1172 274
646 3300035171 Ga0373946_0161195 Ga0373946_0161195_43_867 274
647 3300035241 Ga0373961_0022424 Ga0373961_0022424_245_1069 274
648 3300037471 Ga0395905_0043100 Ga0395905_0043100_1526_2350 274
649 3300038996 Ga0242420_015757 Ga0242420_015757_384_1208 274
650 3300042876 Ga0451577_0578595 Ga0451577_0578595_16_840 274
651 3300046472 Ga0495580_0249396 Ga0495580_0249396_348_1172 274
652 3300046539 Ga0495621_0034478 Ga0495621_0034478_58_882 274
653 3300046681 Ga0495647_0039929 Ga0495647_0039929_721_1545 274
654 3300048904 Ga0496101_0018812 Ga0496101_0018812_1379_2203 274
655 3300048905 Ga0496102_0044103 Ga0496102_0044103_1026_1850 274
656 3300048905 Ga0496102_0132926 Ga0496102_0132926_997_1821 274
657 3300048905 Ga0496102_0249972 Ga0496102_0249972_509_1333 274
658 3300048906 Ga0496103_0067798 Ga0496103_0067798_524_1348 274
659 3300048906 Ga0496103_0166033 Ga0496103_0166033_67_891 274
660 3300048907 Ga0496104_0021874 Ga0496104_0021874_2900_3724 274
661 3300048909 Ga0496106_0031062 Ga0496106_0031062_1547_2371 274
662 3300048909 Ga0496106_0134934 Ga0496106_0134934_600_1424 274
663 3300048910 Ga0496107_0122445 Ga0496107_0122445_445_1269 274
664 3300048911 Ga0496108_0027107 Ga0496108_0027107_3060_3884 274
665 3300048911 Ga0496108_0221810 Ga0496108_0221810_180_1004 274
666 3300048913 Ga0496110_0010489 Ga0496110_0010489_2003_2827 274
667 3300048913 Ga0496110_0320487 Ga0496110_0320487_149_973 274
668 3300048915 Ga0496112_0003817 Ga0496112_0003817_2416_3342 274
669 3300048916 Ga0496113_0385997 Ga0496113_0385997_94_1020 274
670 3300048917 Ga0496114_0024195 Ga0496114_0024195_1828_2652 274
671 3300049576 Ga0501040_0307182 Ga0501040_0307182_261_1088 274
672 3300049578 Ga0501042_0171962 Ga0501042_0171962_130_957 274
673 3300049580 Ga0501046_0311702 Ga0501046_0311702_67_894 274
674 3300050511 nmdc:mga08y16_162705_c1 nmdc:mga08y16_162705_c1_617_1441 274
675 3300050512 nmdc:mga0n895_666919_c1 nmdc:mga0n895_666919_c1_62_886 274
676 3300050512 nmdc:mga0n895_86311_c1 nmdc:mga0n895_86311_c1_73_1002 274
677 3300050515 nmdc:mga0a205_199027_c1 nmdc:mga0a205_199027_c1_542_1366 274

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10502

Peptidase_S26

Signal peptidase, peptidase S26

73

294

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
1b12-assembly4.cif.gz_D crystal structure of type 1 signal peptidase from escherichia coli in complex with a beta-lactam inhibitor 0.7447 56 274
4n31-assembly1.cif.gz_B structure and activity of streptococcus pyogenes sipa: a signal peptidase homologue essential for pilus polymerisation 0.7363 58 251
1b12-assembly3.cif.gz_C crystal structure of type 1 signal peptidase from escherichia coli in complex with a beta-lactam inhibitor 0.7348 57 274
1b12-assembly2.cif.gz_B crystal structure of type 1 signal peptidase from escherichia coli in complex with a beta-lactam inhibitor 0.7326 58 274
1b12-assembly4.cif.gz_D crystal structure of type 1 signal peptidase from escherichia coli in complex with a beta-lactam inhibitor 0.7324 56 274
ID Description Score Start End Superfamily
af_O74800_20_156_2.10.109.10 Mainly Beta;Ribbon;Umud Fragment, subunit A;Umud Fragment, subunit A 0.8132 55 254 2.10.109.10
af_Q7XS59_25_161_2.10.109.10 Mainly Beta;Ribbon;Umud Fragment, subunit A;Umud Fragment, subunit A 0.7975 56 274 2.10.109.10
1b12C01 Mainly Beta;Ribbon;Umud Fragment, subunit A;Umud Fragment, subunit A 0.7927 57 270 2.10.109.10
1b12C01 Mainly Beta;Ribbon;Umud Fragment, subunit A;Umud Fragment, subunit A 0.7807 57 270 2.10.109.10
af_Q54RP1_162_281_2.10.109.10 Mainly Beta;Ribbon;Umud Fragment, subunit A;Umud Fragment, subunit A 0.7803 54 251 2.10.109.10
ID Description Score Start End GO Terms
AF-A0A496WHA3-F1-model_v4 Signal peptidase I (EC 3.4.21.89) 0.9447 3 147 GO:0004252
GO:0006465
GO:0016020
AF-A0A1G3VVU4-F1-model_v4 Signal peptidase I (EC 3.4.21.89) 0.9358 48 147 GO:0004252
GO:0006465
GO:0016020
AF-A0A7Y5DH24-F1-model_v4 Signal peptidase I (EC 3.4.21.89) 0.9334 1 274 GO:0004252
GO:0006465
GO:0016020
AF-A0A356QGF6-F1-model_v4 Signal peptidase I (EC 3.4.21.89) 0.9322 47 136 GO:0004252
GO:0006465
GO:0016020
AF-A0A7I8EAQ8-F1-model_v4 Signal peptidase I (EC 3.4.21.89) 0.9303 4 274 GO:0004252
GO:0006465
GO:0016020

Feature Viewer

pLDDT pTM Quality
87.29 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map