F474516

General Info

Members Datasets Scaffolds Average Seq Length
676 256 1352 151

Family's Representative Sequence

Representative Sequence 3300014326|Ga0157380_10129943|Ga0157380_101299432
Length 161
Sequence MTTTTAPIHEMQTFTITEEIRVRASLEKTFASIITQLGRQNETGDGKPLPMMLETHPGGRWYRDLGGDNGHLWGFVQSIKRPVLLEIWGPLFMSTGATSNMQYRLTETDGGSLITFKHTVVGPFPEEHRERMGDGWKAMHARVRRTRNQAAASKGDSDGDD

Samples

Sample ID Description Type Environment
1 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
6 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
64 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
65 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
66 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
67 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
68 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
69 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
148 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
153 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
154 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
155 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
156 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
157 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
158 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
159 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
160 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
161 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
162 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
163 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
164 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
165 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
166 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
167 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
168 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
169 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
170 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
171 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
172 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
173 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
174 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
175 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
176 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
177 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
178 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
179 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
180 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
181 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
182 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
183 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
184 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
185 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
186 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
187 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
188 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
189 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
190 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
191 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
192 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
193 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
194 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
195 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
196 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
197 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
198 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
199 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
200 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
215 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
216 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
217 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
218 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
219 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
220 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
221 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
222 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
223 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
224 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
225 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
226 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
227 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
228 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
229 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
230 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
233 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
234 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
235 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
236 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
237 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
238 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
239 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
240 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
241 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
242 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
243 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
244 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
245 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
246 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
247 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
248 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
249 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
250 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
251 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
252 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
253 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
254 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
255 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
256 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.7
Metatranscriptomes 0.3
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.21
Nodule 0
Rhizoplane 3.25
Rhizosphere 89.94
Stem 0
Stem Tuber 0
Unclassified 32.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157380_10129943 3300014326 Bacteria 2147
2 JGI24746J21847_1021023 3300001977 Unclassified 913
3 JGI24033J26618_1015855 3300002155 Unclassified 933
4 JGI24751J29686_10004343 3300002459 Bacteria 2876
5 JGI24751J29686_10072704 3300002459 Unclassified 710
6 JGI24751J29686_10090262 3300002459 Bacteria 637
7 Ga0058859_11797373 3300004798 Bacteria 635
8 Ga0058862_10912993 3300004803 Unclassified 580
9 Ga0065714_10138718 3300005288 Bacteria 1188
10 Ga0065704_10378008 3300005289 Bacteria 777
11 Ga0065712_10006045 3300005290 Unclassified 2711
12 Ga0065712_10079025 3300005290 Unclassified 3269
13 Ga0065712_10080588 3300005290 Bacteria 3090
14 Ga0065712_10122352 3300005290 Unclassified 1653
15 Ga0065712_10196639 3300005290 Unclassified 1125
16 Ga0065712_10486962 3300005290 Bacteria 659
17 Ga0065715_10003716 3300005293 Bacteria 4102
18 Ga0065715_10109450 3300005293 Bacteria 2668
19 Ga0065715_10116087 3300005293 Bacteria 2392
20 Ga0065715_10254530 3300005293 Unclassified 1156
21 Ga0065715_10321087 3300005293 Bacteria 1002
22 Ga0065707_10023054 3300005295 Unclassified 2007
23 Ga0065707_10114302 3300005295 Unclassified 2301
24 Ga0065707_10127931 3300005295 Unclassified 1974
25 Ga0070676_10035577 3300005328 Bacteria 2865
26 Ga0070676_10207582 3300005328 Unclassified 1287
27 Ga0070676_10244831 3300005328 Unclassified 1194
28 Ga0070690_100172721 3300005330 Unclassified 1488
29 Ga0070670_100048009 3300005331 Bacteria 3674
30 Ga0070670_100076500 3300005331 Bacteria 2876
31 Ga0070670_100124371 3300005331 Unclassified 2226
32 Ga0070670_100181992 3300005331 Bacteria 1825
33 Ga0070670_100194580 3300005331 Unclassified 1761
34 Ga0070670_100412404 3300005331 Unclassified 1193
35 Ga0070670_101041652 3300005331 Unclassified 745
36 Ga0070670_101863460 3300005331 Unclassified 554
37 Ga0070677_10007025 3300005333 Bacteria 3746
38 Ga0070677_10205617 3300005333 Bacteria 953
39 Ga0068869_100020851 3300005334 Bacteria 4501
40 Ga0068869_100021112 3300005334 Bacteria 4476
41 Ga0068869_100058388 3300005334 Bacteria 2821
42 Ga0068869_100492563 3300005334 Unclassified 1022
43 Ga0070666_10001318 3300005335 Bacteria 15043
44 Ga0070666_10025723 3300005335 Bacteria 3839
45 Ga0070666_10100711 3300005335 Bacteria 1991
46 Ga0070682_100523005 3300005337 Bacteria 923
47 Ga0068868_100012160 3300005338 Bacteria 6285
48 Ga0068868_100021537 3300005338 Bacteria 4854
49 Ga0068868_100145459 3300005338 Bacteria 1949
50 Ga0070660_100070444 3300005339 Bacteria 2729
51 Ga0070660_100243614 3300005339 Unclassified 1465
52 Ga0070689_100338700 3300005340 Unclassified 1259
53 Ga0070689_100636083 3300005340 Bacteria 927
54 Ga0070687_100012129 3300005343 Bacteria 3794
55 Ga0070687_100447130 3300005343 Unclassified 859
56 Ga0070661_100025808 3300005344 Bacteria 4223
57 Ga0070692_10107878 3300005345 Bacteria 1536
58 Ga0070692_10540947 3300005345 Bacteria 761
59 Ga0070668_100014091 3300005347 Bacteria 5976
60 Ga0070668_100508346 3300005347 Bacteria 1044
61 Ga0070669_100037579 3300005353 Bacteria 3512
62 Ga0070669_100097328 3300005353 Bacteria 2215
63 Ga0070669_100264515 3300005353 Bacteria 1373
64 Ga0070669_100778053 3300005353 Bacteria 812
65 Ga0070675_100001455 3300005354 Bacteria 17442
66 Ga0070675_100003808 3300005354 Bacteria 11452
67 Ga0070675_100020018 3300005354 Bacteria 5339
68 Ga0070675_100042241 3300005354 Bacteria 3725
69 Ga0070675_100129697 3300005354 Bacteria 2148
70 Ga0070675_100176892 3300005354 Unclassified 1843
71 Ga0070675_100356528 3300005354 Bacteria 1298
72 Ga0070675_100597696 3300005354 Unclassified 1000
73 Ga0070671_100009648 3300005355 Bacteria 7754
74 Ga0070671_100016574 3300005355 Bacteria 5956
75 Ga0070671_100105863 3300005355 Bacteria 2361
76 Ga0070674_100000524 3300005356 Bacteria 19299
77 Ga0070674_100008740 3300005356 Bacteria 6041
78 Ga0070674_100201625 3300005356 Bacteria 1537
79 Ga0070674_100500842 3300005356 Unclassified 1011
80 Ga0070673_100012750 3300005364 Bacteria 5782
81 Ga0070673_100037306 3300005364 Bacteria 3702
82 Ga0070673_100272000 3300005364 Unclassified 1483
83 Ga0070673_100388613 3300005364 Unclassified 1245
84 Ga0070673_100395106 3300005364 Unclassified 1235
85 Ga0070673_100870788 3300005364 Unclassified 834
86 Ga0070673_100912646 3300005364 Unclassified 815
87 Ga0070688_100021822 3300005365 Bacteria 3744
88 Ga0070688_100478419 3300005365 Bacteria 936
89 Ga0070688_100764933 3300005365 Unclassified 753
90 Ga0070667_100017479 3300005367 Bacteria 5944
91 Ga0070667_100033587 3300005367 Bacteria 4289
92 Ga0070703_10047305 3300005406 Bacteria 1362
93 Ga0070701_10111515 3300005438 Bacteria 1529
94 Ga0070701_10365871 3300005438 Unclassified 905
95 Ga0070701_10409037 3300005438 Unclassified 861
96 Ga0070701_10800576 3300005438 Unclassified 643
97 Ga0070700_100024698 3300005441 Bacteria 3532
98 Ga0070700_100247120 3300005441 Unclassified 1278
99 Ga0070700_101149536 3300005441 Unclassified 646
100 Ga0070700_101290624 3300005441 Unclassified 613
101 Ga0070700_101813220 3300005441 Bacteria 526
102 Ga0070694_100328990 3300005444 Unclassified 1178
103 Ga0070694_101207652 3300005444 Unclassified 634
104 Ga0070694_101851788 3300005444 Bacteria 515
105 Ga0070708_100201583 3300005445 Bacteria 1863
106 Ga0070663_100140912 3300005455 Bacteria 1841
107 Ga0070663_101554507 3300005455 Unclassified 589
108 Ga0070678_100030713 3300005456 Bacteria 3697
109 Ga0070678_100171502 3300005456 Bacteria 1767
110 Ga0070678_100234818 3300005456 Bacteria 1530
111 Ga0070678_100316637 3300005456 Bacteria 1331
112 Ga0070678_100319452 3300005456 Unclassified 1325
113 Ga0070678_102129276 3300005456 Bacteria 531
114 Ga0070662_100012810 3300005457 Bacteria 5569
115 Ga0070662_100204727 3300005457 Bacteria 1568
116 Ga0070662_100735464 3300005457 Bacteria 836
117 Ga0070662_101375188 3300005457 Bacteria 608
118 Ga0070681_10045606 3300005458 Bacteria 4385
119 Ga0070681_11144424 3300005458 Bacteria 699
120 Ga0070681_11291014 3300005458 Unclassified 653
121 Ga0068867_100154157 3300005459 Bacteria 1807
122 Ga0068867_100248459 3300005459 Unclassified 1446
123 Ga0068867_100518172 3300005459 Unclassified 1028
124 Ga0070685_10077859 3300005466 Unclassified 1981
125 Ga0070685_10084394 3300005466 Bacteria 1910
126 Ga0070685_10373263 3300005466 Bacteria 981
127 Ga0070699_100221721 3300005518 Unclassified 1685
128 Ga0070672_100018221 3300005543 Bacteria 5071
129 Ga0070672_100029401 3300005543 Bacteria 4120
130 Ga0070672_100158085 3300005543 Bacteria 1878
131 Ga0070672_100310121 3300005543 Bacteria 1339
132 Ga0070686_100045226 3300005544 Bacteria 2772
133 Ga0070686_100118127 3300005544 Bacteria 1817
134 Ga0070686_100331878 3300005544 Bacteria 1137
135 Ga0070686_100508249 3300005544 Unclassified 936
136 Ga0070686_101441068 3300005544 Bacteria 579
137 Ga0070695_100017950 3300005545 Bacteria 4293
138 Ga0070665_100004648 3300005548 Bacteria 14348
139 Ga0070665_100126941 3300005548 Bacteria 2553
140 Ga0070704_100095059 3300005549 Bacteria 2231
141 Ga0070704_100289605 3300005549 Bacteria 1360
142 Ga0070704_100321036 3300005549 Unclassified 1297
143 Ga0070704_100590702 3300005549 Bacteria 975
144 Ga0070664_100008282 3300005564 Bacteria 8411
145 Ga0070664_100259588 3300005564 Unclassified 1563
146 Ga0070664_100390397 3300005564 Unclassified 1272
147 Ga0070664_101070106 3300005564 Unclassified 759
148 Ga0068857_100226951 3300005577 Bacteria 1707
149 Ga0068857_101936808 3300005577 Unclassified 578
150 Ga0070702_100081705 3300005615 Bacteria 1937
151 Ga0068859_100001487 3300005617 Bacteria 23857
152 Ga0068859_100072450 3300005617 Unclassified 3482
153 Ga0068859_100197344 3300005617 Bacteria 2097
154 Ga0068859_100441957 3300005617 Bacteria 1397
155 Ga0068859_100509894 3300005617 Bacteria 1298
156 Ga0068864_100015977 3300005618 Bacteria 6246
157 Ga0068864_100020744 3300005618 Bacteria 5499
158 Ga0068864_100530682 3300005618 Bacteria 1136
159 Ga0068864_101508348 3300005618 Unclassified 675
160 Ga0068866_10004903 3300005718 Bacteria 5498
161 Ga0068866_10704578 3300005718 Bacteria 693
162 Ga0068866_10870159 3300005718 Unclassified 632
163 Ga0068861_100016584 3300005719 Bacteria 5214
164 Ga0068851_10439911 3300005834 Unclassified 773
165 Ga0068870_10003997 3300005840 Bacteria 6295
166 Ga0068870_10162065 3300005840 Unclassified 1327
167 Ga0068870_10896203 3300005840 Bacteria 626
168 Ga0068863_100032426 3300005841 Bacteria 4980
169 Ga0068863_100213136 3300005841 Bacteria 1860
170 Ga0068863_100735543 3300005841 Unclassified 982
171 Ga0068858_100045031 3300005842 Bacteria 4089
172 Ga0068860_100033626 3300005843 Bacteria 4918
173 Ga0068860_100070980 3300005843 Bacteria 3311
174 Ga0068860_100542279 3300005843 Bacteria 1165
175 Ga0068862_100012750 3300005844 Bacteria 6956
176 Ga0068862_100375230 3300005844 Bacteria 1325
177 Ga0068862_100780692 3300005844 Unclassified 931
178 Ga0068862_101446403 3300005844 Bacteria 692
179 Ga0075365_10062295 3300006038 Bacteria 2494
180 Ga0075365_10632171 3300006038 Unclassified 757
181 Ga0075368_10114019 3300006042 Bacteria 1116
182 Ga0075368_10367747 3300006042 Unclassified 628
183 Ga0075363_100160739 3300006048 Bacteria 1272
184 Ga0075364_10010264 3300006051 Bacteria 5652
185 Ga0075364_10150705 3300006051 Bacteria 1567
186 Ga0075364_11164507 3300006051 Bacteria 523
187 Ga0075362_10003125 3300006177 Bacteria 5717
188 Ga0075367_10017109 3300006178 Bacteria 3974
189 Ga0075367_10027304 3300006178 Bacteria 3246
190 Ga0075367_10046182 3300006178 Bacteria 2558
191 Ga0075367_10151754 3300006178 Bacteria 1438
192 Ga0075367_10669839 3300006178 Unclassified 660
193 Ga0075366_10056970 3300006195 Bacteria 2322
194 Ga0075366_10078933 3300006195 Bacteria 1964
195 Ga0075366_10268056 3300006195 Unclassified 1043
196 Ga0075366_10498839 3300006195 Bacteria 752
197 Ga0097621_100003561 3300006237 Bacteria 10761
198 Ga0097621_100170051 3300006237 Bacteria 1878
199 Ga0097621_100278642 3300006237 Unclassified 1471
200 Ga0097621_100402853 3300006237 Unclassified 1225
201 Ga0075370_10039601 3300006353 Bacteria 2656
202 Ga0068871_100003227 3300006358 Bacteria 11176
203 Ga0068871_100054703 3300006358 Bacteria 3239
204 Ga0068871_100174791 3300006358 Bacteria 1843
205 Ga0068871_100574553 3300006358 Unclassified 1023
206 Ga0075428_100001028 3300006844 Bacteria 29562
207 Ga0075428_100005255 3300006844 Bacteria 14393
208 Ga0075428_100245363 3300006844 Bacteria 1931
209 Ga0075428_100275370 3300006844 Bacteria 1811
210 Ga0075428_100444042 3300006844 Unclassified 1390
211 Ga0075428_100501264 3300006844 Bacteria 1299
212 Ga0075428_100853823 3300006844 Bacteria 966
213 Ga0075428_101249934 3300006844 Unclassified 782
214 Ga0075430_100131783 3300006846 Bacteria 2083
215 Ga0075430_100279605 3300006846 Bacteria 1381
216 Ga0075430_100334506 3300006846 Bacteria 1251
217 Ga0075431_100004151 3300006847 Bacteria 14148
218 Ga0075431_100013240 3300006847 Bacteria 8331
219 Ga0075433_10000070 3300006852 Bacteria 45584
220 Ga0075433_10032705 3300006852 Bacteria 4456
221 Ga0075433_10161932 3300006852 Unclassified 1991
222 Ga0075433_10164127 3300006852 Unclassified 1977
223 Ga0075434_100000166 3300006871 Bacteria 41896
224 Ga0075434_101141658 3300006871 Bacteria 792
225 Ga0075429_100041072 3300006880 Bacteria 4028
226 Ga0075429_100124400 3300006880 Bacteria 2255
227 Ga0075429_100178211 3300006880 Bacteria 1862
228 Ga0068865_100099915 3300006881 Bacteria 2122
229 Ga0068865_100176846 3300006881 Bacteria 1641
230 Ga0068865_100209992 3300006881 Unclassified 1516
231 Ga0068865_100522733 3300006881 Unclassified 993
232 Ga0097620_100001487 3300006931 Bacteria 23857
233 Ga0097620_100072449 3300006931 Unclassified 3482
234 Ga0097620_100197336 3300006931 Bacteria 2097
235 Ga0097620_100441986 3300006931 Bacteria 1397
236 Ga0097620_100509885 3300006931 Bacteria 1298
237 Ga0075435_100021231 3300007076 Unclassified 4991
238 Ga0075435_100426945 3300007076 Unclassified 1142
239 Ga0075435_101552181 3300007076 Unclassified 581
240 Ga0105240_10288126 3300009093 Bacteria 1884
241 Ga0111539_10000009 3300009094 Bacteria 375223
242 Ga0111539_10004461 3300009094 Bacteria 18298
243 Ga0111539_10043354 3300009094 Bacteria 5393
244 Ga0111539_10096445 3300009094 Bacteria 3473
245 Ga0111539_10113074 3300009094 Bacteria 3185
246 Ga0111539_10315210 3300009094 Unclassified 1820
247 Ga0111539_10366948 3300009094 Unclassified 1676
248 Ga0111539_10367305 3300009094 Bacteria 1675
249 Ga0111539_10772293 3300009094 Unclassified 1118
250 Ga0111539_11124650 3300009094 Bacteria 913
251 Ga0111539_11297615 3300009094 Bacteria 845
252 Ga0111539_12643605 3300009094 Unclassified 582
253 Ga0105245_10006555 3300009098 Bacteria 10220
254 Ga0105245_10845658 3300009098 Unclassified 955
255 Ga0105247_10228926 3300009101 Bacteria 1261
256 Ga0105247_11620298 3300009101 Bacteria 532
257 Ga0114129_10000022 3300009147 Bacteria 119291
258 Ga0114129_10015151 3300009147 Bacteria 10975
259 Ga0114129_10144721 3300009147 Unclassified 3256
260 Ga0114129_10178071 3300009147 Bacteria 2895
261 Ga0114129_10308484 3300009147 Bacteria 2107
262 Ga0114129_10694277 3300009147 Unclassified 1309
263 Ga0114129_11033787 3300009147 Bacteria 1032
264 Ga0114129_11255931 3300009147 Bacteria 920
265 Ga0105243_10037226 3300009148 Bacteria 3780
266 Ga0105242_10099449 3300009176 Bacteria 2462
267 Ga0105242_10124901 3300009176 Bacteria 2213
268 Ga0105242_10182332 3300009176 Bacteria 1853
269 Ga0105242_11573752 3300009176 Bacteria 690
270 Ga0105248_10002920 3300009177 Bacteria 18976
271 Ga0105248_10045899 3300009177 Bacteria 4898
272 Ga0105248_10079443 3300009177 Bacteria 3687
273 Ga0105248_10088070 3300009177 Bacteria 3494
274 Ga0105248_10118263 3300009177 Bacteria 2989
275 Ga0105248_11051664 3300009177 Unclassified 920
276 Ga0105248_11147416 3300009177 Unclassified 878
277 Ga0105248_11163201 3300009177 Bacteria 872
278 Ga0105248_11303670 3300009177 Unclassified 821
279 Ga0105248_11504473 3300009177 Unclassified 762
280 Ga0105238_10062575 3300009551 Bacteria 3722
281 Ga0105249_10024158 3300009553 Bacteria 5461
282 Ga0105249_10247584 3300009553 Bacteria 1765
283 Ga0105249_10520561 3300009553 Bacteria 1237
284 Ga0105249_10640718 3300009553 Bacteria 1120
285 Ga0105249_10943571 3300009553 Unclassified 931
286 Ga0105246_10005371 3300011119 Bacteria 7800
287 Ga0105246_11002329 3300011119 Bacteria 756
288 Ga0157374_10062042 3300013296 Bacteria 3502
289 Ga0157374_10439415 3300013296 Unclassified 1305
290 Ga0157378_10118015 3300013297 Bacteria 2441
291 Ga0157378_10304249 3300013297 Bacteria 1544
292 Ga0157378_10720435 3300013297 Bacteria 1018
293 Ga0157378_11732823 3300013297 Unclassified 672
294 Ga0163162_10007569 3300013306 Bacteria 10576
295 Ga0163162_10039778 3300013306 Bacteria 4699
296 Ga0163162_10109125 3300013306 Bacteria 2864
297 Ga0163162_10250174 3300013306 Unclassified 1904
298 Ga0163162_10468555 3300013306 Bacteria 1391
299 Ga0157375_10006309 3300013308 Bacteria 10331
300 Ga0157375_10126522 3300013308 Bacteria 2670
301 Ga0157375_10169627 3300013308 Bacteria 2329
302 Ga0157375_10331307 3300013308 Unclassified 1687
303 Ga0157375_10417074 3300013308 Unclassified 1509
304 Ga0157375_10495990 3300013308 Unclassified 1385
305 Ga0157375_10653657 3300013308 Unclassified 1207
306 Ga0157375_10955783 3300013308 Unclassified 998
307 Ga0163163_10127614 3300014325 Bacteria 2582
308 Ga0163163_10422529 3300014325 Bacteria 1392
309 Ga0163163_10696674 3300014325 Bacteria 1079
310 Ga0157380_10001081 3300014326 Bacteria 17506
311 Ga0157380_10025613 3300014326 Unclassified 4474
312 Ga0157380_10027451 3300014326 Bacteria 4330
313 Ga0157380_10034765 3300014326 Bacteria 3889
314 Ga0157380_10108279 3300014326 Bacteria 2329
315 Ga0157380_10367304 3300014326 Bacteria 1353
316 Ga0157380_10496720 3300014326 Bacteria 1184
317 Ga0157380_10553617 3300014326 Bacteria 1129
318 Ga0157380_10751252 3300014326 Unclassified 987
319 Ga0157380_10880715 3300014326 Unclassified 920
320 Ga0157380_11277294 3300014326 Unclassified 780
321 Ga0157380_11359921 3300014326 Bacteria 759
322 Ga0157377_10181555 3300014745 Unclassified 1324
323 Ga0157377_10777242 3300014745 Unclassified 704
324 Ga0157379_10088131 3300014968 Bacteria 2783
325 Ga0157379_10094525 3300014968 Bacteria 2682
326 Ga0157376_10232074 3300014969 Bacteria 1715
327 Ga0157376_10678571 3300014969 Bacteria 1033
328 Ga0157376_12310533 3300014969 Bacteria 577
329 Ga0163161_10041023 3300017792 Bacteria 3325
330 Ga0163161_10225218 3300017792 Unclassified 1453
331 Ga0163161_10248200 3300017792 Bacteria 1387
332 Ga0163161_11109344 3300017792 Unclassified 680
333 Ga0207697_10004532 3300025315 Bacteria 6620
334 Ga0207653_10394101 3300025885 Unclassified 543
335 Ga0207682_10000614 3300025893 Bacteria 16576
336 Ga0207682_10013681 3300025893 Unclassified 3159
337 Ga0207682_10075510 3300025893 Bacteria 1435
338 Ga0207682_10254533 3300025893 Unclassified 818
339 Ga0207642_10031710 3300025899 Bacteria 2217
340 Ga0207642_10215407 3300025899 Unclassified 1070
341 Ga0207642_10417286 3300025899 Unclassified 806
342 Ga0207642_10470309 3300025899 Unclassified 765
343 Ga0207688_10007026 3300025901 Bacteria 6121
344 Ga0207688_10227991 3300025901 Unclassified 1124
345 Ga0207688_10632944 3300025901 Unclassified 675
346 Ga0207680_10578903 3300025903 Unclassified 802
347 Ga0207680_10666035 3300025903 Bacteria 745
348 Ga0207680_10810913 3300025903 Unclassified 671
349 Ga0207645_10012347 3300025907 Bacteria 5797
350 Ga0207645_10058019 3300025907 Bacteria 2472
351 Ga0207645_10110386 3300025907 Bacteria 1780
352 Ga0207645_10308953 3300025907 Unclassified 1053
353 Ga0207643_10000484 3300025908 Bacteria 25662
354 Ga0207643_10034461 3300025908 Bacteria 2836
355 Ga0207707_10036044 3300025912 Unclassified 4326
356 Ga0207695_10249187 3300025913 Bacteria 1676
357 Ga0207660_10945236 3300025917 Unclassified 703
358 Ga0207660_10984534 3300025917 Bacteria 688
359 Ga0207662_10009435 3300025918 Bacteria 5370
360 Ga0207662_10020115 3300025918 Bacteria 3807
361 Ga0207662_10578850 3300025918 Unclassified 780
362 Ga0207657_10344506 3300025919 Bacteria 1176
363 Ga0207649_10078773 3300025920 Bacteria 2127
364 Ga0207681_10017341 3300025923 Unclassified 4521
365 Ga0207681_10097045 3300025923 Bacteria 2117
366 Ga0207681_10560665 3300025923 Bacteria 941
367 Ga0207681_10591768 3300025923 Bacteria 916
368 Ga0207694_11370989 3300025924 Unclassified 598
369 Ga0207650_10006553 3300025925 Bacteria 7942
370 Ga0207650_10086180 3300025925 Unclassified 2391
371 Ga0207650_10337251 3300025925 Bacteria 1237
372 Ga0207650_10395529 3300025925 Unclassified 1143
373 Ga0207650_10682115 3300025925 Unclassified 867
374 Ga0207650_10771786 3300025925 Unclassified 814
375 Ga0207659_10000406 3300025926 Bacteria 25932
376 Ga0207659_10030786 3300025926 Unclassified 3669
377 Ga0207659_10157589 3300025926 Unclassified 1779
378 Ga0207659_10294840 3300025926 Bacteria 1330
379 Ga0207659_10634201 3300025926 Unclassified 912
380 Ga0207687_10258271 3300025927 Unclassified 1388
381 Ga0207644_10009320 3300025931 Bacteria 6445
382 Ga0207644_10036746 3300025931 Bacteria 3440
383 Ga0207644_10095237 3300025931 Bacteria 2226
384 Ga0207644_11045922 3300025931 Bacteria 686
385 Ga0207706_10001118 3300025933 Bacteria 27297
386 Ga0207706_10145482 3300025933 Unclassified 2085
387 Ga0207706_10325548 3300025933 Bacteria 1337
388 Ga0207706_10821804 3300025933 Bacteria 788
389 Ga0207686_10049380 3300025934 Bacteria 2611
390 Ga0207686_10070629 3300025934 Bacteria 2244
391 Ga0207686_10113059 3300025934 Bacteria 1835
392 Ga0207686_10231198 3300025934 Bacteria 1341
393 Ga0207709_10029270 3300025935 Bacteria 3193
394 Ga0207670_10060530 3300025936 Bacteria 2580
395 Ga0207670_10699797 3300025936 Unclassified 839
396 Ga0207669_10073508 3300025937 Bacteria 2157
397 Ga0207669_10193771 3300025937 Unclassified 1468
398 Ga0207669_10278071 3300025937 Bacteria 1261
399 Ga0207669_10309689 3300025937 Unclassified 1204
400 Ga0207669_10317842 3300025937 Unclassified 1190
401 Ga0207704_10049142 3300025938 Bacteria 2535
402 Ga0207704_10455248 3300025938 Unclassified 1022
403 Ga0207704_10649664 3300025938 Bacteria 869
404 Ga0207704_10707916 3300025938 Unclassified 834
405 Ga0207691_10004848 3300025940 Bacteria 13010
406 Ga0207691_10021676 3300025940 Bacteria 6065
407 Ga0207691_10023287 3300025940 Bacteria 5830
408 Ga0207691_10243165 3300025940 Bacteria 1555
409 Ga0207691_10470138 3300025940 Bacteria 1069
410 Ga0207711_10007595 3300025941 Bacteria 9070
411 Ga0207711_10021400 3300025941 Bacteria 5403
412 Ga0207711_10111909 3300025941 Bacteria 2429
413 Ga0207711_10525141 3300025941 Unclassified 1104
414 Ga0207711_10701528 3300025941 Unclassified 944
415 Ga0207711_10983119 3300025941 Unclassified 783
416 Ga0207711_11006949 3300025941 Unclassified 773
417 Ga0207689_10034547 3300025942 Bacteria 4199
418 Ga0207689_10050655 3300025942 Bacteria 3423
419 Ga0207689_10218775 3300025942 Bacteria 1573
420 Ga0207689_10588056 3300025942 Unclassified 936
421 Ga0207679_10033421 3300025945 Bacteria 3618
422 Ga0207679_10089484 3300025945 Bacteria 2376
423 Ga0207679_10141119 3300025945 Unclassified 1948
424 Ga0207679_10184490 3300025945 Unclassified 1729
425 Ga0207679_10392820 3300025945 Bacteria 1219
426 Ga0207679_10439699 3300025945 Bacteria 1155
427 Ga0207651_10018087 3300025960 Bacteria 4185
428 Ga0207651_10081080 3300025960 Bacteria 2338
429 Ga0207651_10600970 3300025960 Unclassified 961
430 Ga0207651_10823844 3300025960 Unclassified 824
431 Ga0207651_10840425 3300025960 Unclassified 815
432 Ga0207712_10053657 3300025961 Bacteria 2829
433 Ga0207712_10309518 3300025961 Bacteria 1299
434 Ga0207712_10474343 3300025961 Unclassified 1065
435 Ga0207712_10688844 3300025961 Unclassified 891
436 Ga0207668_10042400 3300025972 Bacteria 3082
437 Ga0207668_10175975 3300025972 Bacteria 1683
438 Ga0207668_10426395 3300025972 Bacteria 1127
439 Ga0207668_11411136 3300025972 Unclassified 628
440 Ga0207640_11097685 3300025981 Unclassified 704
441 Ga0207640_11113455 3300025981 Bacteria 699
442 Ga0207658_10029492 3300025986 Bacteria 3875
443 Ga0207658_10077369 3300025986 Unclassified 2538
444 Ga0207677_10024443 3300026023 Bacteria 3754
445 Ga0207677_10113773 3300026023 Bacteria 2020
446 Ga0207677_10833095 3300026023 Unclassified 828
447 Ga0207703_10094370 3300026035 Bacteria 2522
448 Ga0207678_10125175 3300026067 Bacteria 2193
449 Ga0207678_10145880 3300026067 Bacteria 2020
450 Ga0207708_10111345 3300026075 Bacteria 2125
451 Ga0207708_10128064 3300026075 Bacteria 1983
452 Ga0207708_10440503 3300026075 Unclassified 1083
453 Ga0207641_10054408 3300026088 Bacteria 3396
454 Ga0207641_10127723 3300026088 Bacteria 2278
455 Ga0207641_10253207 3300026088 Bacteria 1645
456 Ga0207641_10813559 3300026088 Bacteria 925
457 Ga0207648_10134674 3300026089 Unclassified 2176
458 Ga0207648_10171257 3300026089 Bacteria 1919
459 Ga0207676_10703136 3300026095 Unclassified 979
460 Ga0207676_10958281 3300026095 Unclassified 841
461 Ga0207676_11578835 3300026095 Unclassified 654
462 Ga0207674_10145830 3300026116 Bacteria 2326
463 Ga0207674_10157999 3300026116 Bacteria 2222
464 Ga0207675_100014473 3300026118 Bacteria 7356
465 Ga0207675_100162486 3300026118 Bacteria 2131
466 Ga0207675_100309750 3300026118 Unclassified 1540
467 Ga0207683_10048884 3300026121 Bacteria 3701
468 Ga0207683_10065699 3300026121 Bacteria 3198
469 Ga0207683_10067393 3300026121 Bacteria 3158
470 Ga0207683_10100819 3300026121 Bacteria 2578
471 Ga0207683_10134905 3300026121 Bacteria 2222
472 Ga0207683_10253225 3300026121 Bacteria 1607
473 Ga0207683_10757405 3300026121 Bacteria 901
474 Ga0209813_10197698 3300027866 Bacteria 743
475 Ga0207428_10000005 3300027907 Bacteria 520045
476 Ga0207428_10100198 3300027907 Unclassified 2239
477 Ga0207428_10312861 3300027907 Bacteria 1161
478 Ga0207428_10349282 3300027907 Unclassified 1088
479 Ga0207428_10572743 3300027907 Bacteria 815
480 Ga0268266_10012564 3300028379 Bacteria 7318
481 Ga0268265_10423643 3300028380 Unclassified 1236
482 Ga0268265_10840945 3300028380 Bacteria 897
483 Ga0268265_11203509 3300028380 Unclassified 755
484 Ga0268265_12341825 3300028380 Unclassified 541
485 Ga0268264_10059168 3300028381 Bacteria 3210
486 Ga0268264_10439586 3300028381 Unclassified 1262
487 Ga0268264_10475141 3300028381 Bacteria 1215
488 Ga0268264_10664193 3300028381 Unclassified 1033
489 Ga0268264_10902681 3300028381 Unclassified 887
490 Ga0307408_100112813 3300031548 Bacteria 2091
491 Ga0307405_10056086 3300031731 Unclassified 2469
492 Ga0307405_11066260 3300031731 Bacteria 693
493 Ga0307413_10386280 3300031824 Bacteria 1092
494 Ga0307410_10031075 3300031852 Unclassified 3422
495 Ga0307410_10955136 3300031852 Unclassified 737
496 Ga0307410_11216007 3300031852 Bacteria 657
497 Ga0307407_10025113 3300031903 Bacteria 3136
498 Ga0307407_10071413 3300031903 Bacteria 2067
499 Ga0307412_10335146 3300031911 Bacteria 1209
500 Ga0307409_100008311 3300031995 Bacteria 6291
501 Ga0307409_100537550 3300031995 Bacteria 1145
502 Ga0307409_100948940 3300031995 Unclassified 876
503 Ga0307409_100958962 3300031995 Unclassified 871
504 Ga0307416_100049811 3300032002 Unclassified 3333
505 Ga0307416_100123623 3300032002 Unclassified 2313
506 Ga0307416_100418031 3300032002 Unclassified 1384
507 Ga0307416_101147670 3300032002 Bacteria 882
508 Ga0307414_10099720 3300032004 Unclassified 2183
509 Ga0307414_10494466 3300032004 Bacteria 1081
510 Ga0307411_10280201 3300032005 Bacteria 1326
511 Ga0307411_10568888 3300032005 Bacteria 970
512 Ga0307411_10678543 3300032005 Unclassified 895
513 Ga0307411_11830589 3300032005 Bacteria 564
514 Ga0307415_100377415 3300032126 Bacteria 1203
515 Ga0307415_100471570 3300032126 Bacteria 1090
516 Ga0307415_101071812 3300032126 Viruses 753
517 Ga0373961_0273561 3300035241 Unclassified 618
518 Ga0373931_0337945 3300035691 Unclassified 940
519 Ga0373933_0524027 3300035724 Bacteria 777
520 Ga0373937_0716183 3300036401 Unclassified 948
521 Ga0436365_0196003 3300039437 Unclassified 527
522 Ga0439439_0016621 3300041406 Bacteria 1804
523 Ga0451800_0242012 3300041459 Bacteria 1274
524 Ga0451800_1238156 3300041459 Bacteria 607
525 Ga0451807_2744671 3300041486 Unclassified 636
526 Ga0451849_0011593 3300041505 Bacteria 517
527 Ga0451853_0962947 3300041512 Bacteria 1177
528 Ga0439431_0096157 3300041997 Bacteria 811
529 Ga0439450_042936 3300042008 Unclassified 1055
530 Ga0439462_0005546 3300042015 Bacteria 3113
531 Ga0450911_024327 3300042115 Unclassified 787
532 Ga0439446_0001569 3300042156 Bacteria 5249
533 Ga0439434_0007256 3300042435 Bacteria 3248
534 Ga0439435_0072364 3300042436 Bacteria 1022
535 Ga0439435_0074476 3300042436 Unclassified 1010
536 Ga0439444_0018807 3300042437 Unclassified 1200
537 Ga0439460_0206125 3300042461 Bacteria 671
538 Ga0450916_008748 3300042530 Bacteria 1238
539 Ga0450893_0022762 3300042532 Bacteria 1087
540 Ga0495603_0144222 3300046455 Bacteria 1385
541 Ga0495603_0283792 3300046455 Bacteria 952
542 Ga0495638_0041112 3300046460 Bacteria 2927
543 Ga0495598_0342271 3300046537 Unclassified 574
544 Ga0496102_0101243 3300048905 Bacteria 2676
545 Ga0496103_0076703 3300048906 Bacteria 2098
546 Ga0496104_0228089 3300048907 Bacteria 1775
547 Ga0496105_0767573 3300048908 Unclassified 735
548 Ga0496106_0487218 3300048909 Unclassified 991
549 Ga0496107_0036415 3300048910 Bacteria 3530
550 Ga0496108_0191075 3300048911 Bacteria 1775
551 Ga0496108_0429931 3300048911 Bacteria 1153
552 Ga0496108_0652798 3300048911 Bacteria 914
553 Ga0496109_0668447 3300048912 Unclassified 976
554 Ga0496110_0158361 3300048913 Unclassified 2052
555 Ga0496110_0270169 3300048913 Bacteria 1548
556 Ga0496111_0388491 3300048914 Bacteria 1032
557 Ga0496112_0087860 3300048915 Bacteria 3076
558 Ga0496112_0353918 3300048915 Bacteria 1411
559 Ga0496113_0278859 3300048916 Bacteria 1336
560 Ga0496113_0281362 3300048916 Unclassified 1330
561 Ga0496114_0063126 3300048917 Bacteria 3101
562 Ga0496114_0412109 3300048917 Unclassified 1197
563 Ga0501031_0707988 3300049568 Bacteria 646
564 Ga0501032_0027604 3300049569 Bacteria 3901
565 Ga0501032_0161690 3300049569 Unclassified 1470
566 Ga0501033_0237124 3300049570 Unclassified 1294
567 Ga0501034_0039952 3300049571 Bacteria 4751
568 Ga0501034_0641310 3300049571 Bacteria 964
569 Ga0501036_0016973 3300049572 Bacteria 6082
570 Ga0501037_0066290 3300049573 Bacteria 2630
571 Ga0501038_0014527 3300049574 Bacteria 7176
572 Ga0501038_0688473 3300049574 Bacteria 767
573 Ga0501039_0039567 3300049575 Bacteria 3641
574 Ga0501039_0139705 3300049575 Unclassified 1903
575 Ga0501041_0467770 3300049577 Bacteria 801
576 Ga0501042_0204244 3300049578 Bacteria 1425
577 Ga0501043_0009137 3300049579 Bacteria 7796
578 Ga0501046_0105626 3300049580 Bacteria 2156
579 Ga0501046_0210252 3300049580 Bacteria 1444
580 Ga0501047_0003455 3300049581 Bacteria 14928
581 Ga0501047_0043057 3300049581 Bacteria 4362
582 Ga0501047_0147321 3300049581 Bacteria 2230
583 Ga0501048_0278126 3300049582 Bacteria 1190
584 Ga0501067_0139405 3300049583 Unclassified 1350
585 Ga0501067_0204935 3300049583 Bacteria 1098
586 Ga0501068_0012479 3300049584 Bacteria 4821
587 Ga0501070_0087886 3300049586 Bacteria 2573
588 Ga0501070_0176264 3300049586 Unclassified 1760
589 Ga0501070_0340515 3300049586 Bacteria 1218
590 Ga0501072_0041273 3300049588 Unclassified 3624
591 Ga0501072_0132481 3300049588 Unclassified 1987
592 Ga0501073_0050809 3300049589 Unclassified 2904
593 Ga0501073_0052222 3300049589 Bacteria 2862
594 Ga0501073_0158184 3300049589 Bacteria 1570
595 Ga0501074_0087092 3300049590 Bacteria 2237
596 Ga0501075_0685711 3300049591 Unclassified 781
597 Ga0501076_0236787 3300049592 Bacteria 1493
598 Ga0501076_0545857 3300049592 Bacteria 956
599 Ga0501077_0165747 3300049593 Bacteria 1404
600 Ga0501077_0804427 3300049593 Unclassified 604
601 Ga0501216_029435 3300049660 Unclassified 1007
602 Ga0501249_198843 3300049679 Unclassified 525
603 Ga0501259_061533 3300049688 Unclassified 785
604 Ga0501261_088615 3300049690 Viruses 571
605 Ga0501079_0171663 3300049741 Bacteria 1691
606 Ga0501080_0070575 3300049742 Bacteria 3249
607 Ga0501080_0116751 3300049742 Bacteria 2473
608 Ga0501083_0001245 3300049744 Bacteria 17292
609 Ga0501083_0023297 3300049744 Bacteria 4295
610 Ga0501035_0064275 3300049822 Bacteria 3261
611 Ga0501044_0050570 3300049823 Bacteria 4287
612 Ga0501044_0319471 3300049823 Bacteria 1477
613 Ga0501045_0441509 3300049824 Bacteria 968
614 Ga0501045_0657404 3300049824 Bacteria 774
615 nmdc:mga03683_2791_c1 3300050489 Bacteria 5497
616 nmdc:mga03n38_167005_c1 3300050490 Bacteria 1118
617 nmdc:mga00v17_25660_c2 3300050491 Unclassified 922
618 nmdc:mga00v17_326562_c1 3300050491 Bacteria 997
619 nmdc:mga00v17_722563_c1 3300050491 Bacteria 638
620 nmdc:mga0yw44_2948_c1 3300050492 Bacteria 7412
621 nmdc:mga0yw44_568646_c1 3300050492 Archaea 770
622 nmdc:mga0k408_13489_c1 3300050493 Bacteria 4483
623 nmdc:mga0k408_269396_c1 3300050493 Bacteria 1017
624 nmdc:mga0k408_327502_c1 3300050493 Unclassified 914
625 nmdc:mga0k408_52801_c1 3300050493 Bacteria 2356
626 nmdc:mga06z11_283575_c1 3300050494 Bacteria 982
627 nmdc:mga06z11_5832_c1 3300050494 Bacteria 4971
628 nmdc:mga06z11_74866_c1 3300050494 Bacteria 1801
629 nmdc:mga04h51_156190_c1 3300050495 Bacteria 875
630 nmdc:mga04h51_301092_c1 3300050495 Unclassified 653
631 nmdc:mga04h51_87258_c1 3300050495 Bacteria 1117
632 nmdc:mga07m45_13897_c2 3300050496 Bacteria 2222
633 nmdc:mga05p37_131392_c1 3300050507 Bacteria 3072
634 nmdc:mga05p37_251387_c1 3300050507 Bacteria 2120
635 nmdc:mga05p37_407531_c1 3300050507 Unclassified 1586
636 nmdc:mga05p37_663193_c1 3300050507 Bacteria 1166
637 nmdc:mga05p37_83_c1 3300050507 Bacteria 83944
638 nmdc:mga09592_104665_c1 3300050508 Bacteria 2425
639 nmdc:mga09592_685727_c1 3300050508 Unclassified 873
640 nmdc:mga0qj67_1153884_c1 3300050509 Unclassified 604
641 nmdc:mga0qj67_219014_c1 3300050509 Bacteria 1545
642 nmdc:mga0qj67_438521_c1 3300050509 Bacteria 1052
643 nmdc:mga0qj67_480266_c1 3300050509 Bacteria 1000
644 nmdc:mga0qj67_6989_c1 3300050509 Bacteria 8315
645 nmdc:mga06r32_107309_c1 3300050510 Bacteria 2744
646 nmdc:mga08y16_1012617_c1 3300050511 Bacteria 810
647 nmdc:mga08y16_127599_c1 3300050511 Unclassified 2646
648 nmdc:mga08y16_256660_c1 3300050511 Bacteria 1806
649 nmdc:mga08y16_25973_c1 3300050511 Bacteria 6179
650 nmdc:mga08y16_288984_c1 3300050511 Bacteria 1690
651 nmdc:mga08y16_5042_c1 3300050511 Bacteria 13804
652 nmdc:mga08y16_513016_c1 3300050511 Bacteria 1217
653 nmdc:mga08y16_6792_c1 3300050511 Bacteria 12007
654 nmdc:mga08y16_94922_c1 3300050511 Bacteria 3107
655 nmdc:mga08y16_9_c1 3300050511 Bacteria 566088
656 nmdc:mga0n895_1108405_c1 3300050512 Bacteria 769
657 nmdc:mga0n895_15068_c1 3300050512 Bacteria 7045
658 nmdc:mga0n895_2039_c1 3300050512 Bacteria 15534
659 nmdc:mga0rr50_144118_c1 3300050513 Unclassified 1919
660 nmdc:mga0rr50_1471371_c1 3300050513 Unclassified 576
661 nmdc:mga0a205_11547_c1 3300050515 Bacteria 8137
662 nmdc:mga0a205_212874_c1 3300050515 Unclassified 1820
663 nmdc:mga0a205_72607_c1 3300050515 Bacteria 3325
664 nmdc:mga0a205_92_c1 3300050515 Bacteria 50403
665 Ga0500646_0007759 3300053090 Bacteria 2743
666 Ga0500555_011682 3300053103 Unclassified 2525
667 Ga0500628_061837 3300053129 Bacteria 917
668 Ga0500652_032995 3300053131 Bacteria 2044
669 Ga0501084_0009505 3300054114 Bacteria 8044
670 Ga0501084_0684878 3300054114 Bacteria 865
671 Ga0501084_0753719 3300054114 Bacteria 820
672 Ga0590071_002122 3300059421 Bacteria 5057
673 Ga0590077_001671 3300059426 Bacteria 5075
674 Ga0501082_0074877 3300060353 Unclassified 2916
675 Ga0501082_0285896 3300060353 Unclassified 1435
676 Ga0501082_0321459 3300060353 Bacteria 1348
677 Ga0157380_10129943
678 JGI24746J21847_1021023
679 JGI24033J26618_1015855
680 JGI24751J29686_10004343
681 JGI24751J29686_10072704
682 JGI24751J29686_10090262
683 Ga0058859_11797373
684 Ga0058862_10912993
685 Ga0065714_10138718
686 Ga0065704_10378008
687 Ga0065712_10006045
688 Ga0065712_10079025
689 Ga0065712_10080588
690 Ga0065712_10122352
691 Ga0065712_10196639
692 Ga0065712_10486962
693 Ga0065715_10003716
694 Ga0065715_10109450
695 Ga0065715_10116087
696 Ga0065715_10254530
697 Ga0065715_10321087
698 Ga0065707_10023054
699 Ga0065707_10114302
700 Ga0065707_10127931
701 Ga0070676_10035577
702 Ga0070676_10207582
703 Ga0070676_10244831
704 Ga0070690_100172721
705 Ga0070670_100048009
706 Ga0070670_100076500
707 Ga0070670_100124371
708 Ga0070670_100181992
709 Ga0070670_100194580
710 Ga0070670_100412404
711 Ga0070670_101041652
712 Ga0070670_101863460
713 Ga0070677_10007025
714 Ga0070677_10205617
715 Ga0068869_100020851
716 Ga0068869_100021112
717 Ga0068869_100058388
718 Ga0068869_100492563
719 Ga0070666_10001318
720 Ga0070666_10025723
721 Ga0070666_10100711
722 Ga0070682_100523005
723 Ga0068868_100012160
724 Ga0068868_100021537
725 Ga0068868_100145459
726 Ga0070660_100070444
727 Ga0070660_100243614
728 Ga0070689_100338700
729 Ga0070689_100636083
730 Ga0070687_100012129
731 Ga0070687_100447130
732 Ga0070661_100025808
733 Ga0070692_10107878
734 Ga0070692_10540947
735 Ga0070668_100014091
736 Ga0070668_100508346
737 Ga0070669_100037579
738 Ga0070669_100097328
739 Ga0070669_100264515
740 Ga0070669_100778053
741 Ga0070675_100001455
742 Ga0070675_100003808
743 Ga0070675_100020018
744 Ga0070675_100042241
745 Ga0070675_100129697
746 Ga0070675_100176892
747 Ga0070675_100356528
748 Ga0070675_100597696
749 Ga0070671_100009648
750 Ga0070671_100016574
751 Ga0070671_100105863
752 Ga0070674_100000524
753 Ga0070674_100008740
754 Ga0070674_100201625
755 Ga0070674_100500842
756 Ga0070673_100012750
757 Ga0070673_100037306
758 Ga0070673_100272000
759 Ga0070673_100388613
760 Ga0070673_100395106
761 Ga0070673_100870788
762 Ga0070673_100912646
763 Ga0070688_100021822
764 Ga0070688_100478419
765 Ga0070688_100764933
766 Ga0070667_100017479
767 Ga0070667_100033587
768 Ga0070703_10047305
769 Ga0070701_10111515
770 Ga0070701_10365871
771 Ga0070701_10409037
772 Ga0070701_10800576
773 Ga0070700_100024698
774 Ga0070700_100247120
775 Ga0070700_101149536
776 Ga0070700_101290624
777 Ga0070700_101813220
778 Ga0070694_100328990
779 Ga0070694_101207652
780 Ga0070694_101851788
781 Ga0070708_100201583
782 Ga0070663_100140912
783 Ga0070663_101554507
784 Ga0070678_100030713
785 Ga0070678_100171502
786 Ga0070678_100234818
787 Ga0070678_100316637
788 Ga0070678_100319452
789 Ga0070678_102129276
790 Ga0070662_100012810
791 Ga0070662_100204727
792 Ga0070662_100735464
793 Ga0070662_101375188
794 Ga0070681_10045606
795 Ga0070681_11144424
796 Ga0070681_11291014
797 Ga0068867_100154157
798 Ga0068867_100248459
799 Ga0068867_100518172
800 Ga0070685_10077859
801 Ga0070685_10084394
802 Ga0070685_10373263
803 Ga0070699_100221721
804 Ga0070672_100018221
805 Ga0070672_100029401
806 Ga0070672_100158085
807 Ga0070672_100310121
808 Ga0070686_100045226
809 Ga0070686_100118127
810 Ga0070686_100331878
811 Ga0070686_100508249
812 Ga0070686_101441068
813 Ga0070695_100017950
814 Ga0070665_100004648
815 Ga0070665_100126941
816 Ga0070704_100095059
817 Ga0070704_100289605
818 Ga0070704_100321036
819 Ga0070704_100590702
820 Ga0070664_100008282
821 Ga0070664_100259588
822 Ga0070664_100390397
823 Ga0070664_101070106
824 Ga0068857_100226951
825 Ga0068857_101936808
826 Ga0070702_100081705
827 Ga0068859_100001487
828 Ga0068859_100072450
829 Ga0068859_100197344
830 Ga0068859_100441957
831 Ga0068859_100509894
832 Ga0068864_100015977
833 Ga0068864_100020744
834 Ga0068864_100530682
835 Ga0068864_101508348
836 Ga0068866_10004903
837 Ga0068866_10704578
838 Ga0068866_10870159
839 Ga0068861_100016584
840 Ga0068851_10439911
841 Ga0068870_10003997
842 Ga0068870_10162065
843 Ga0068870_10896203
844 Ga0068863_100032426
845 Ga0068863_100213136
846 Ga0068863_100735543
847 Ga0068858_100045031
848 Ga0068860_100033626
849 Ga0068860_100070980
850 Ga0068860_100542279
851 Ga0068862_100012750
852 Ga0068862_100375230
853 Ga0068862_100780692
854 Ga0068862_101446403
855 Ga0075365_10062295
856 Ga0075365_10632171
857 Ga0075368_10114019
858 Ga0075368_10367747
859 Ga0075363_100160739
860 Ga0075364_10010264
861 Ga0075364_10150705
862 Ga0075364_11164507
863 Ga0075362_10003125
864 Ga0075367_10017109
865 Ga0075367_10027304
866 Ga0075367_10046182
867 Ga0075367_10151754
868 Ga0075367_10669839
869 Ga0075366_10056970
870 Ga0075366_10078933
871 Ga0075366_10268056
872 Ga0075366_10498839
873 Ga0097621_100003561
874 Ga0097621_100170051
875 Ga0097621_100278642
876 Ga0097621_100402853
877 Ga0075370_10039601
878 Ga0068871_100003227
879 Ga0068871_100054703
880 Ga0068871_100174791
881 Ga0068871_100574553
882 Ga0075428_100001028
883 Ga0075428_100005255
884 Ga0075428_100245363
885 Ga0075428_100275370
886 Ga0075428_100444042
887 Ga0075428_100501264
888 Ga0075428_100853823
889 Ga0075428_101249934
890 Ga0075430_100131783
891 Ga0075430_100279605
892 Ga0075430_100334506
893 Ga0075431_100004151
894 Ga0075431_100013240
895 Ga0075433_10000070
896 Ga0075433_10032705
897 Ga0075433_10161932
898 Ga0075433_10164127
899 Ga0075434_100000166
900 Ga0075434_101141658
901 Ga0075429_100041072
902 Ga0075429_100124400
903 Ga0075429_100178211
904 Ga0068865_100099915
905 Ga0068865_100176846
906 Ga0068865_100209992
907 Ga0068865_100522733
908 Ga0097620_100001487
909 Ga0097620_100072449
910 Ga0097620_100197336
911 Ga0097620_100441986
912 Ga0097620_100509885
913 Ga0075435_100021231
914 Ga0075435_100426945
915 Ga0075435_101552181
916 Ga0105240_10288126
917 Ga0111539_10000009
918 Ga0111539_10004461
919 Ga0111539_10043354
920 Ga0111539_10096445
921 Ga0111539_10113074
922 Ga0111539_10315210
923 Ga0111539_10366948
924 Ga0111539_10367305
925 Ga0111539_10772293
926 Ga0111539_11124650
927 Ga0111539_11297615
928 Ga0111539_12643605
929 Ga0105245_10006555
930 Ga0105245_10845658
931 Ga0105247_10228926
932 Ga0105247_11620298
933 Ga0114129_10000022
934 Ga0114129_10015151
935 Ga0114129_10144721
936 Ga0114129_10178071
937 Ga0114129_10308484
938 Ga0114129_10694277
939 Ga0114129_11033787
940 Ga0114129_11255931
941 Ga0105243_10037226
942 Ga0105242_10099449
943 Ga0105242_10124901
944 Ga0105242_10182332
945 Ga0105242_11573752
946 Ga0105248_10002920
947 Ga0105248_10045899
948 Ga0105248_10079443
949 Ga0105248_10088070
950 Ga0105248_10118263
951 Ga0105248_11051664
952 Ga0105248_11147416
953 Ga0105248_11163201
954 Ga0105248_11303670
955 Ga0105248_11504473
956 Ga0105238_10062575
957 Ga0105249_10024158
958 Ga0105249_10247584
959 Ga0105249_10520561
960 Ga0105249_10640718
961 Ga0105249_10943571
962 Ga0105246_10005371
963 Ga0105246_11002329
964 Ga0157374_10062042
965 Ga0157374_10439415
966 Ga0157378_10118015
967 Ga0157378_10304249
968 Ga0157378_10720435
969 Ga0157378_11732823
970 Ga0163162_10007569
971 Ga0163162_10039778
972 Ga0163162_10109125
973 Ga0163162_10250174
974 Ga0163162_10468555
975 Ga0157375_10006309
976 Ga0157375_10126522
977 Ga0157375_10169627
978 Ga0157375_10331307
979 Ga0157375_10417074
980 Ga0157375_10495990
981 Ga0157375_10653657
982 Ga0157375_10955783
983 Ga0163163_10127614
984 Ga0163163_10422529
985 Ga0163163_10696674
986 Ga0157380_10001081
987 Ga0157380_10025613
988 Ga0157380_10027451
989 Ga0157380_10034765
990 Ga0157380_10108279
991 Ga0157380_10367304
992 Ga0157380_10496720
993 Ga0157380_10553617
994 Ga0157380_10751252
995 Ga0157380_10880715
996 Ga0157380_11277294
997 Ga0157380_11359921
998 Ga0157377_10181555
999 Ga0157377_10777242
1000 Ga0157379_10088131
1001 Ga0157379_10094525
1002 Ga0157376_10232074
1003 Ga0157376_10678571
1004 Ga0157376_12310533
1005 Ga0163161_10041023
1006 Ga0163161_10225218
1007 Ga0163161_10248200
1008 Ga0163161_11109344
1009 Ga0207697_10004532
1010 Ga0207653_10394101
1011 Ga0207682_10000614
1012 Ga0207682_10013681
1013 Ga0207682_10075510
1014 Ga0207682_10254533
1015 Ga0207642_10031710
1016 Ga0207642_10215407
1017 Ga0207642_10417286
1018 Ga0207642_10470309
1019 Ga0207688_10007026
1020 Ga0207688_10227991
1021 Ga0207688_10632944
1022 Ga0207680_10578903
1023 Ga0207680_10666035
1024 Ga0207680_10810913
1025 Ga0207645_10012347
1026 Ga0207645_10058019
1027 Ga0207645_10110386
1028 Ga0207645_10308953
1029 Ga0207643_10000484
1030 Ga0207643_10034461
1031 Ga0207707_10036044
1032 Ga0207695_10249187
1033 Ga0207660_10945236
1034 Ga0207660_10984534
1035 Ga0207662_10009435
1036 Ga0207662_10020115
1037 Ga0207662_10578850
1038 Ga0207657_10344506
1039 Ga0207649_10078773
1040 Ga0207681_10017341
1041 Ga0207681_10097045
1042 Ga0207681_10560665
1043 Ga0207681_10591768
1044 Ga0207694_11370989
1045 Ga0207650_10006553
1046 Ga0207650_10086180
1047 Ga0207650_10337251
1048 Ga0207650_10395529
1049 Ga0207650_10682115
1050 Ga0207650_10771786
1051 Ga0207659_10000406
1052 Ga0207659_10030786
1053 Ga0207659_10157589
1054 Ga0207659_10294840
1055 Ga0207659_10634201
1056 Ga0207687_10258271
1057 Ga0207644_10009320
1058 Ga0207644_10036746
1059 Ga0207644_10095237
1060 Ga0207644_11045922
1061 Ga0207706_10001118
1062 Ga0207706_10145482
1063 Ga0207706_10325548
1064 Ga0207706_10821804
1065 Ga0207686_10049380
1066 Ga0207686_10070629
1067 Ga0207686_10113059
1068 Ga0207686_10231198
1069 Ga0207709_10029270
1070 Ga0207670_10060530
1071 Ga0207670_10699797
1072 Ga0207669_10073508
1073 Ga0207669_10193771
1074 Ga0207669_10278071
1075 Ga0207669_10309689
1076 Ga0207669_10317842
1077 Ga0207704_10049142
1078 Ga0207704_10455248
1079 Ga0207704_10649664
1080 Ga0207704_10707916
1081 Ga0207691_10004848
1082 Ga0207691_10021676
1083 Ga0207691_10023287
1084 Ga0207691_10243165
1085 Ga0207691_10470138
1086 Ga0207711_10007595
1087 Ga0207711_10021400
1088 Ga0207711_10111909
1089 Ga0207711_10525141
1090 Ga0207711_10701528
1091 Ga0207711_10983119
1092 Ga0207711_11006949
1093 Ga0207689_10034547
1094 Ga0207689_10050655
1095 Ga0207689_10218775
1096 Ga0207689_10588056
1097 Ga0207679_10033421
1098 Ga0207679_10089484
1099 Ga0207679_10141119
1100 Ga0207679_10184490
1101 Ga0207679_10392820
1102 Ga0207679_10439699
1103 Ga0207651_10018087
1104 Ga0207651_10081080
1105 Ga0207651_10600970
1106 Ga0207651_10823844
1107 Ga0207651_10840425
1108 Ga0207712_10053657
1109 Ga0207712_10309518
1110 Ga0207712_10474343
1111 Ga0207712_10688844
1112 Ga0207668_10042400
1113 Ga0207668_10175975
1114 Ga0207668_10426395
1115 Ga0207668_11411136
1116 Ga0207640_11097685
1117 Ga0207640_11113455
1118 Ga0207658_10029492
1119 Ga0207658_10077369
1120 Ga0207677_10024443
1121 Ga0207677_10113773
1122 Ga0207677_10833095
1123 Ga0207703_10094370
1124 Ga0207678_10125175
1125 Ga0207678_10145880
1126 Ga0207708_10111345
1127 Ga0207708_10128064
1128 Ga0207708_10440503
1129 Ga0207641_10054408
1130 Ga0207641_10127723
1131 Ga0207641_10253207
1132 Ga0207641_10813559
1133 Ga0207648_10134674
1134 Ga0207648_10171257
1135 Ga0207676_10703136
1136 Ga0207676_10958281
1137 Ga0207676_11578835
1138 Ga0207674_10145830
1139 Ga0207674_10157999
1140 Ga0207675_100014473
1141 Ga0207675_100162486
1142 Ga0207675_100309750
1143 Ga0207683_10048884
1144 Ga0207683_10065699
1145 Ga0207683_10067393
1146 Ga0207683_10100819
1147 Ga0207683_10134905
1148 Ga0207683_10253225
1149 Ga0207683_10757405
1150 Ga0209813_10197698
1151 Ga0207428_10000005
1152 Ga0207428_10100198
1153 Ga0207428_10312861
1154 Ga0207428_10349282
1155 Ga0207428_10572743
1156 Ga0268266_10012564
1157 Ga0268265_10423643
1158 Ga0268265_10840945
1159 Ga0268265_11203509
1160 Ga0268265_12341825
1161 Ga0268264_10059168
1162 Ga0268264_10439586
1163 Ga0268264_10475141
1164 Ga0268264_10664193
1165 Ga0268264_10902681
1166 Ga0307408_100112813
1167 Ga0307405_10056086
1168 Ga0307405_11066260
1169 Ga0307413_10386280
1170 Ga0307410_10031075
1171 Ga0307410_10955136
1172 Ga0307410_11216007
1173 Ga0307407_10025113
1174 Ga0307407_10071413
1175 Ga0307412_10335146
1176 Ga0307409_100008311
1177 Ga0307409_100537550
1178 Ga0307409_100948940
1179 Ga0307409_100958962
1180 Ga0307416_100049811
1181 Ga0307416_100123623
1182 Ga0307416_100418031
1183 Ga0307416_101147670
1184 Ga0307414_10099720
1185 Ga0307414_10494466
1186 Ga0307411_10280201
1187 Ga0307411_10568888
1188 Ga0307411_10678543
1189 Ga0307411_11830589
1190 Ga0307415_100377415
1191 Ga0307415_100471570
1192 Ga0307415_101071812
1193 Ga0373961_0273561
1194 Ga0373931_0337945
1195 Ga0373933_0524027
1196 Ga0373937_0716183
1197 Ga0436365_0196003
1198 Ga0439439_0016621
1199 Ga0451800_0242012
1200 Ga0451800_1238156
1201 Ga0451807_2744671
1202 Ga0451849_0011593
1203 Ga0451853_0962947
1204 Ga0439431_0096157
1205 Ga0439450_042936
1206 Ga0439462_0005546
1207 Ga0450911_024327
1208 Ga0439446_0001569
1209 Ga0439434_0007256
1210 Ga0439435_0072364
1211 Ga0439435_0074476
1212 Ga0439444_0018807
1213 Ga0439460_0206125
1214 Ga0450916_008748
1215 Ga0450893_0022762
1216 Ga0495603_0144222
1217 Ga0495603_0283792
1218 Ga0495638_0041112
1219 Ga0495598_0342271
1220 Ga0496102_0101243
1221 Ga0496103_0076703
1222 Ga0496104_0228089
1223 Ga0496105_0767573
1224 Ga0496106_0487218
1225 Ga0496107_0036415
1226 Ga0496108_0191075
1227 Ga0496108_0429931
1228 Ga0496108_0652798
1229 Ga0496109_0668447
1230 Ga0496110_0158361
1231 Ga0496110_0270169
1232 Ga0496111_0388491
1233 Ga0496112_0087860
1234 Ga0496112_0353918
1235 Ga0496113_0278859
1236 Ga0496113_0281362
1237 Ga0496114_0063126
1238 Ga0496114_0412109
1239 Ga0501031_0707988
1240 Ga0501032_0027604
1241 Ga0501032_0161690
1242 Ga0501033_0237124
1243 Ga0501034_0039952
1244 Ga0501034_0641310
1245 Ga0501036_0016973
1246 Ga0501037_0066290
1247 Ga0501038_0014527
1248 Ga0501038_0688473
1249 Ga0501039_0039567
1250 Ga0501039_0139705
1251 Ga0501041_0467770
1252 Ga0501042_0204244
1253 Ga0501043_0009137
1254 Ga0501046_0105626
1255 Ga0501046_0210252
1256 Ga0501047_0003455
1257 Ga0501047_0043057
1258 Ga0501047_0147321
1259 Ga0501048_0278126
1260 Ga0501067_0139405
1261 Ga0501067_0204935
1262 Ga0501068_0012479
1263 Ga0501070_0087886
1264 Ga0501070_0176264
1265 Ga0501070_0340515
1266 Ga0501072_0041273
1267 Ga0501072_0132481
1268 Ga0501073_0050809
1269 Ga0501073_0052222
1270 Ga0501073_0158184
1271 Ga0501074_0087092
1272 Ga0501075_0685711
1273 Ga0501076_0236787
1274 Ga0501076_0545857
1275 Ga0501077_0165747
1276 Ga0501077_0804427
1277 Ga0501216_029435
1278 Ga0501249_198843
1279 Ga0501259_061533
1280 Ga0501261_088615
1281 Ga0501079_0171663
1282 Ga0501080_0070575
1283 Ga0501080_0116751
1284 Ga0501083_0001245
1285 Ga0501083_0023297
1286 Ga0501035_0064275
1287 Ga0501044_0050570
1288 Ga0501044_0319471
1289 Ga0501045_0441509
1290 Ga0501045_0657404
1291 nmdc:mga03683_2791_c1
1292 nmdc:mga03n38_167005_c1
1293 nmdc:mga00v17_25660_c2
1294 nmdc:mga00v17_326562_c1
1295 nmdc:mga00v17_722563_c1
1296 nmdc:mga0yw44_2948_c1
1297 nmdc:mga0yw44_568646_c1
1298 nmdc:mga0k408_13489_c1
1299 nmdc:mga0k408_269396_c1
1300 nmdc:mga0k408_327502_c1
1301 nmdc:mga0k408_52801_c1
1302 nmdc:mga06z11_283575_c1
1303 nmdc:mga06z11_5832_c1
1304 nmdc:mga06z11_74866_c1
1305 nmdc:mga04h51_156190_c1
1306 nmdc:mga04h51_301092_c1
1307 nmdc:mga04h51_87258_c1
1308 nmdc:mga07m45_13897_c2
1309 nmdc:mga05p37_131392_c1
1310 nmdc:mga05p37_251387_c1
1311 nmdc:mga05p37_407531_c1
1312 nmdc:mga05p37_663193_c1
1313 nmdc:mga05p37_83_c1
1314 nmdc:mga09592_104665_c1
1315 nmdc:mga09592_685727_c1
1316 nmdc:mga0qj67_1153884_c1
1317 nmdc:mga0qj67_219014_c1
1318 nmdc:mga0qj67_438521_c1
1319 nmdc:mga0qj67_480266_c1
1320 nmdc:mga0qj67_6989_c1
1321 nmdc:mga06r32_107309_c1
1322 nmdc:mga08y16_1012617_c1
1323 nmdc:mga08y16_127599_c1
1324 nmdc:mga08y16_256660_c1
1325 nmdc:mga08y16_25973_c1
1326 nmdc:mga08y16_288984_c1
1327 nmdc:mga08y16_5042_c1
1328 nmdc:mga08y16_513016_c1
1329 nmdc:mga08y16_6792_c1
1330 nmdc:mga08y16_94922_c1
1331 nmdc:mga08y16_9_c1
1332 nmdc:mga0n895_1108405_c1
1333 nmdc:mga0n895_15068_c1
1334 nmdc:mga0n895_2039_c1
1335 nmdc:mga0rr50_144118_c1
1336 nmdc:mga0rr50_1471371_c1
1337 nmdc:mga0a205_11547_c1
1338 nmdc:mga0a205_212874_c1
1339 nmdc:mga0a205_72607_c1
1340 nmdc:mga0a205_92_c1
1341 Ga0500646_0007759
1342 Ga0500555_011682
1343 Ga0500628_061837
1344 Ga0500652_032995
1345 Ga0501084_0009505
1346 Ga0501084_0684878
1347 Ga0501084_0753719
1348 Ga0590071_002122
1349 Ga0590077_001671
1350 Ga0501082_0074877
1351 Ga0501082_0285896
1352 Ga0501082_0321459

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3otl-assembly1.cif.gz_B three-dimensional structure of the putative uncharacterized protein from rhizobium leguminosarum at the resolution 1.9a, northeast structural genomics consortium target rlr261 0.7877 11 147
1z94-assembly1.cif.gz_B x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.7792 14 147
3put-assembly1.cif.gz_B crystal structure of the cert start domain (mutant v151e) from rhizobium etli at the resolution 1.8a, northeast structural genomics consortium target rer239. 0.7785 11 146
2nn5-assembly1.cif.gz_A structure of conserved protein of unknown function ef2215 from enterococcus faecalis 0.7632 9 147
3q64-assembly1.cif.gz_A-2 x-ray crystal structure of protein mll3774 from mesorhizobium loti, northeast structural genomics consortium target mlr405. 0.7539 12 150
ID Description Score Start End Superfamily
af_Q9P782_203_333_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.762 10 144 3.30.530.20
af_Q93168_208_339_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7503 10 142 3.30.530.20
3putA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7454 11 145 3.30.530.20
3q64A00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7443 12 150 3.30.530.20
3q63F00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7413 10 146 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A1Q6YCI0-F1-model_v4 ATPase 0.9821 11 149
AF-A0A1N6DVP4-F1-model_v4 Activator of Hsp90 ATPase homolog 1-like protein 0.9731 11 147
AF-A0A5C6A9R2-F1-model_v4 Activator of Hsp90 ATPase homologue 1/2-like C-terminal domain-containing protein 0.9725 11 147
AF-A0A177RD76-F1-model_v4 deleted 0.9703 11 147
AF-A0A2I6QKH7-F1-model_v4 Activator of Hsp90 ATPase homologue 1/2-like C-terminal domain-containing protein 0.9446 1 151

Map