F474500

General Info

Members Datasets Scaffolds Average Seq Length
676 276 1352 375

Family's Representative Sequence

Representative Sequence 3300006163|Ga0070715_10058338|Ga0070715_100583382
Length 433
Sequence MSHVKPKCRADPAMRFRCRSSRKKPCPGSHLSVSSRSKSSDSXGTWLSVADATIDCMDGATYRGALAAAPRVAEHFSRHIEAARASSTEPMAFAPDVQSLEAIIDAAFWASLRREEGFAPKISLAFLPPEQGVRPMMFERPLALDASALARVAPAVERAGIHLGIWPREGQLAVWGTTRTIPSYCFVLEVASPGLLVIKHHRGDVSGKFVNVAVLEGDRLKIIDERGSNLPDCPPLVTSLLGFQEPASWEHSVNVLVQLAVSMRGHGRGGALLVVPAGSNTWRESMVRPISYVVAPHFSELADLMRDPSDHRRVWQEALARAVDTIAGLTAVDGATIITDDYDLVAFGAKISRREGSARIEAVNVTEPIEGAVSTTLNPSELGGTRHLSAAQFVHDQPDAVALVASQDGRFTVFAWSPCETMVHAHRVETLLL

Samples

Sample ID Description Type Environment
1 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
72 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
73 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
74 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
75 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
76 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
77 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
78 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
83 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
84 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
85 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
86 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
87 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
88 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
89 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
90 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
92 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
93 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
101 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
102 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
103 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
104 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
105 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
106 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
107 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
108 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
109 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
110 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
111 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
112 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
113 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
114 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
115 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
116 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
117 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
118 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
119 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
169 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
173 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
174 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
175 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
176 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
177 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
178 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
179 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
180 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
181 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
182 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
183 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
184 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
185 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
186 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
187 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
188 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
189 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
190 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
191 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
192 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
193 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
194 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
195 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
196 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
197 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
198 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
199 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
200 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
201 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
202 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
203 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
204 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
205 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
206 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
207 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
208 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
209 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
210 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
211 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
212 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
213 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
214 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
215 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
216 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
217 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
218 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
219 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
220 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
221 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
222 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
223 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
224 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
225 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
226 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
227 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
228 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
229 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
230 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
231 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
232 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
233 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
234 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
235 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
236 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
237 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
238 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
239 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
240 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
241 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
242 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
243 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
244 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
245 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
246 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
247 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
248 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
249 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
253 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
254 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
255 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
256 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
257 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
258 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
259 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
260 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
261 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
262 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
263 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
264 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
265 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
266 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
267 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
268 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
269 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
270 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
271 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
272 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
273 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
274 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
275 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
276 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.7
Metatranscriptomes 0
Isolates 0.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.37
Nodule 0
Rhizoplane 2.66
Rhizosphere 93.64
Stem 0
Stem Tuber 0
Unclassified 16.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070715_10058338 3300006163 Bacteria 1685
2 JGI24751J29686_10011708 3300002459 Bacteria 1809
3 JGI25406J46586_10006766 3300003203 Bacteria 5266
4 rootH1_10347148 3300003323 Unclassified 3145
5 Ga0065712_10082940 3300005290 Bacteria 2873
6 Ga0065712_10119174 3300005290 Bacteria 1695
7 Ga0065715_10089905 3300005293 Bacteria 8178
8 Ga0065715_10092529 3300005293 Bacteria 5072
9 Ga0065715_10118577 3300005293 Bacteria 2312
10 Ga0065715_10205673 3300005293 Unclassified 1339
11 Ga0065707_10004084 3300005295 Bacteria 6282
12 Ga0065707_10004157 3300005295 Bacteria 4485
13 Ga0070658_10082870 3300005327 Bacteria 2636
14 Ga0070676_10010407 3300005328 Bacteria 5046
15 Ga0070676_10138166 3300005328 Bacteria 1548
16 Ga0070683_100000003 3300005329 Bacteria 375084
17 Ga0070683_100005545 3300005329 Bacteria 10544
18 Ga0070683_100005681 3300005329 Bacteria 10414
19 Ga0070683_100008700 3300005329 Bacteria 8631
20 Ga0070683_100030053 3300005329 Bacteria 4927
21 Ga0070683_100078549 3300005329 Unclassified 3088
22 Ga0070683_100116108 3300005329 Bacteria 2527
23 Ga0070683_100123777 3300005329 Bacteria 2444
24 Ga0070683_100178469 3300005329 Unclassified 2016
25 Ga0070683_100227206 3300005329 Unclassified 1774
26 Ga0070690_100025217 3300005330 Bacteria 3661
27 Ga0070690_100129423 3300005330 Bacteria 1703
28 Ga0070670_100017071 3300005331 Bacteria 6228
29 Ga0070670_100231365 3300005331 Bacteria 1609
30 Ga0068869_100019780 3300005334 Bacteria 4608
31 Ga0068869_100087067 3300005334 Bacteria 2343
32 Ga0070666_10144138 3300005335 Bacteria 1660
33 Ga0070680_100059238 3300005336 Unclassified 3132
34 Ga0068868_100064235 3300005338 Bacteria 2914
35 Ga0068868_100081652 3300005338 Bacteria 2592
36 Ga0068868_100155737 3300005338 Bacteria 1884
37 Ga0070660_100018240 3300005339 Bacteria 5125
38 Ga0070660_100026222 3300005339 Unclassified 4337
39 Ga0070660_100330796 3300005339 Bacteria 1253
40 Ga0070689_100107508 3300005340 Bacteria 2215
41 Ga0070687_100033540 3300005343 Bacteria 2535
42 Ga0070661_100067756 3300005344 Bacteria 2623
43 Ga0070661_100283733 3300005344 Bacteria 1285
44 Ga0070692_10075586 3300005345 Bacteria 1804
45 Ga0070669_100010911 3300005353 Bacteria 6450
46 Ga0070669_100060769 3300005353 Unclassified 2776
47 Ga0070669_100066343 3300005353 Bacteria 2660
48 Ga0070675_100007001 3300005354 Bacteria 8666
49 Ga0070675_100042355 3300005354 Bacteria 3720
50 Ga0070675_100097144 3300005354 Bacteria 2476
51 Ga0070671_100042393 3300005355 Bacteria 3782
52 Ga0070674_100016804 3300005356 Bacteria 4591
53 Ga0070674_100115096 3300005356 Bacteria 1982
54 Ga0070674_100117583 3300005356 Bacteria 1963
55 Ga0070673_100006024 3300005364 Bacteria 7851
56 Ga0070673_100007431 3300005364 Bacteria 7225
57 Ga0070673_100221825 3300005364 Bacteria 1636
58 Ga0070688_100012764 3300005365 Bacteria 4717
59 Ga0070659_100050801 3300005366 Unclassified 3259
60 Ga0070659_100181218 3300005366 Bacteria 1729
61 Ga0070667_100002989 3300005367 Bacteria 14522
62 Ga0070709_10009341 3300005434 Bacteria 5406
63 Ga0070714_100001312 3300005435 Bacteria 17968
64 Ga0070714_100046544 3300005435 Bacteria 3681
65 Ga0070713_100001763 3300005436 Bacteria 13961
66 Ga0070713_100014614 3300005436 Bacteria 5839
67 Ga0070713_100116657 3300005436 Bacteria 2335
68 Ga0070701_10021215 3300005438 Bacteria 3096
69 Ga0070701_10046329 3300005438 Bacteria 2235
70 Ga0070711_100017621 3300005439 Bacteria 4550
71 Ga0070711_100146555 3300005439 Unclassified 1776
72 Ga0070700_100014231 3300005441 Bacteria 4488
73 Ga0070694_100033768 3300005444 Bacteria 3370
74 Ga0070708_100021281 3300005445 Bacteria 5482
75 Ga0070708_100035939 3300005445 Bacteria 4319
76 Ga0070663_100180808 3300005455 Bacteria 1636
77 Ga0070678_100075741 3300005456 Bacteria 2532
78 Ga0070678_100190224 3300005456 Unclassified 1687
79 Ga0070681_10001224 3300005458 Bacteria 22324
80 Ga0070681_10022544 3300005458 Bacteria 6324
81 Ga0070681_10050055 3300005458 Bacteria 4170
82 Ga0070681_10050812 3300005458 Bacteria 4136
83 Ga0070681_10058860 3300005458 Bacteria 3822
84 Ga0068867_100120775 3300005459 Bacteria 2025
85 Ga0070706_100185425 3300005467 Bacteria 1944
86 Ga0070707_100004048 3300005468 Bacteria 13782
87 Ga0070707_100290995 3300005468 Bacteria 1587
88 Ga0070698_100032447 3300005471 Bacteria 5410
89 Ga0070698_100080977 3300005471 Bacteria 3242
90 Ga0070698_100165557 3300005471 Unclassified 2154
91 Ga0070699_100007866 3300005518 Bacteria 9262
92 Ga0070699_100104459 3300005518 Bacteria 2484
93 Ga0070679_100054914 3300005530 Bacteria 3967
94 Ga0070679_100185539 3300005530 Bacteria 2051
95 Ga0070679_100386128 3300005530 Bacteria 1347
96 Ga0070684_100000014 3300005535 Bacteria 158815
97 Ga0070684_100044167 3300005535 Unclassified 3853
98 Ga0070684_100054563 3300005535 Bacteria 3482
99 Ga0070684_100083841 3300005535 Bacteria 2825
100 Ga0070697_100231844 3300005536 Unclassified 1575
101 Ga0068853_100111955 3300005539 Unclassified 2425
102 Ga0068853_100228715 3300005539 Bacteria 1700
103 Ga0070672_100008628 3300005543 Bacteria 6982
104 Ga0070672_100044211 3300005543 Bacteria 3439
105 Ga0070686_100252560 3300005544 Bacteria 1289
106 Ga0070695_100010272 3300005545 Bacteria 5586
107 Ga0070695_100037108 3300005545 Bacteria 3070
108 Ga0070695_100058104 3300005545 Bacteria 2500
109 Ga0070695_100062615 3300005545 Bacteria 2416
110 Ga0070696_100090775 3300005546 Unclassified 2174
111 Ga0070693_100058291 3300005547 Bacteria 2235
112 Ga0070665_100051303 3300005548 Bacteria 4137
113 Ga0070704_100020912 3300005549 Bacteria 4231
114 Ga0070704_100023980 3300005549 Bacteria 3996
115 Ga0070704_100035212 3300005549 Bacteria 3402
116 Ga0068855_100007201 3300005563 Bacteria 13500
117 Ga0068855_100018692 3300005563 Bacteria 8334
118 Ga0068855_100084357 3300005563 Unclassified 3678
119 Ga0068855_100104239 3300005563 Bacteria 3263
120 Ga0068855_100106894 3300005563 Unclassified 3215
121 Ga0068857_100002309 3300005577 Bacteria 15484
122 Ga0068857_100032494 3300005577 Unclassified 4614
123 Ga0068857_100073774 3300005577 Unclassified 3041
124 Ga0068857_100123543 3300005577 Unclassified 2332
125 Ga0068857_100171565 3300005577 Bacteria 1972
126 Ga0068854_100040635 3300005578 Bacteria 3282
127 Ga0068856_100005250 3300005614 Bacteria 12778
128 Ga0068856_100045508 3300005614 Bacteria 4322
129 Ga0068856_100045548 3300005614 Bacteria 4320
130 Ga0068856_100195505 3300005614 Bacteria 2036
131 Ga0068852_100168888 3300005616 Unclassified 2049
132 Ga0068859_100111066 3300005617 Bacteria 2803
133 Ga0068859_100120011 3300005617 Bacteria 2696
134 Ga0068859_100176526 3300005617 Unclassified 2218
135 Ga0068864_100009871 3300005618 Bacteria 7874
136 Ga0068866_10019484 3300005718 Bacteria 3090
137 Ga0068861_100061692 3300005719 Bacteria 2878
138 Ga0068861_100074161 3300005719 Bacteria 2645
139 Ga0068861_100213308 3300005719 Unclassified 1627
140 Ga0068861_100302648 3300005719 Bacteria 1386
141 Ga0068870_10024125 3300005840 Bacteria 3008
142 Ga0068870_10091808 3300005840 Bacteria 1699
143 Ga0068863_100000611 3300005841 Bacteria 36231
144 Ga0068863_100055954 3300005841 Bacteria 3735
145 Ga0068863_100079976 3300005841 Bacteria 3096
146 Ga0068863_100131863 3300005841 Unclassified 2386
147 Ga0068863_100192362 3300005841 Bacteria 1961
148 Ga0068858_100010226 3300005842 Bacteria 8903
149 Ga0068858_100042827 3300005842 Bacteria 4198
150 Ga0068858_100091813 3300005842 Bacteria 2826
151 Ga0068858_100113233 3300005842 Unclassified 2534
152 Ga0068858_100255558 3300005842 Bacteria 1665
153 Ga0068860_100023237 3300005843 Bacteria 5991
154 Ga0068860_100215054 3300005843 Bacteria 1865
155 Ga0068862_100025767 3300005844 Bacteria 4939
156 Ga0068862_100030616 3300005844 Bacteria 4536
157 Ga0068862_100036461 3300005844 Bacteria 4168
158 Ga0068862_100217968 3300005844 Bacteria 1727
159 Ga0068862_100330313 3300005844 Unclassified 1410
160 Ga0081539_10020533 3300005985 Bacteria 4458
161 Ga0075365_10022091 3300006038 Bacteria 3980
162 Ga0075365_10026048 3300006038 Bacteria 3707
163 Ga0075368_10032490 3300006042 Bacteria 2027
164 Ga0075363_100095373 3300006048 Bacteria 1641
165 Ga0075364_10047315 3300006051 Bacteria 2801
166 Ga0075362_10013034 3300006177 Bacteria 3317
167 Ga0075367_10001851 3300006178 Bacteria 9341
168 Ga0075367_10006766 3300006178 Bacteria 5820
169 Ga0075366_10005634 3300006195 Bacteria 6790
170 Ga0097621_100000819 3300006237 Bacteria 21976
171 Ga0097621_100029776 3300006237 Bacteria 4315
172 Ga0097621_100040533 3300006237 Bacteria 3745
173 Ga0097621_100166169 3300006237 Unclassified 1900
174 Ga0097621_100260832 3300006237 Bacteria 1520
175 Ga0075370_10003294 3300006353 Bacteria 7659
176 Ga0068871_100001182 3300006358 Bacteria 17487
177 Ga0068871_100002781 3300006358 Bacteria 11952
178 Ga0068871_100004676 3300006358 Bacteria 9573
179 Ga0068871_100008507 3300006358 Bacteria 7379
180 Ga0068871_100098613 3300006358 Bacteria 2445
181 Ga0075428_100033601 3300006844 Bacteria 5661
182 Ga0075428_100038675 3300006844 Bacteria 5250
183 Ga0075428_100043250 3300006844 Bacteria 4952
184 Ga0075428_100061508 3300006844 Bacteria 4112
185 Ga0075430_100000169 3300006846 Bacteria 43050
186 Ga0075430_100065335 3300006846 Bacteria 3056
187 Ga0075431_100026440 3300006847 Bacteria 5955
188 Ga0075431_100050275 3300006847 Bacteria 4298
189 Ga0075431_100166894 3300006847 Bacteria 2263
190 Ga0075433_10020031 3300006852 Bacteria 5587
191 Ga0075433_10024106 3300006852 Bacteria 5131
192 Ga0075433_10032740 3300006852 Bacteria 4454
193 Ga0075433_10108687 3300006852 Bacteria 2460
194 Ga0075433_10237442 3300006852 Bacteria 1618
195 Ga0075433_10246913 3300006852 Bacteria 1584
196 Ga0075433_10310665 3300006852 Unclassified 1395
197 Ga0075434_100006143 3300006871 Bacteria 10994
198 Ga0075434_100168658 3300006871 Unclassified 2209
199 Ga0075434_100184795 3300006871 Bacteria 2105
200 Ga0075429_100010631 3300006880 Bacteria 7963
201 Ga0075429_100120525 3300006880 Bacteria 2293
202 Ga0068865_100001355 3300006881 Bacteria 14252
203 Ga0075436_100027588 3300006914 Unclassified 3907
204 Ga0075436_100142177 3300006914 Bacteria 1687
205 Ga0075436_100209021 3300006914 Bacteria 1383
206 Ga0097620_100111075 3300006931 Bacteria 2803
207 Ga0097620_100120010 3300006931 Bacteria 2696
208 Ga0097620_100176533 3300006931 Unclassified 2218
209 Ga0075435_100025622 3300007076 Bacteria 4592
210 Ga0075435_100030400 3300007076 Bacteria 4246
211 Ga0075435_100221767 3300007076 Bacteria 1606
212 Ga0105240_10000780 3300009093 Bacteria 57653
213 Ga0105240_10005993 3300009093 Bacteria 17972
214 Ga0105240_10016784 3300009093 Bacteria 9901
215 Ga0105240_10025437 3300009093 Bacteria 7778
216 Ga0105240_10076526 3300009093 Bacteria 4125
217 Ga0105240_10119497 3300009093 Bacteria 3174
218 Ga0105240_10154667 3300009093 Bacteria 2729
219 Ga0105240_10368606 3300009093 Bacteria 1625
220 Ga0111539_10000009 3300009094 Bacteria 375223
221 Ga0111539_10019099 3300009094 Bacteria 8470
222 Ga0111539_10028914 3300009094 Bacteria 6759
223 Ga0111539_10083746 3300009094 Bacteria 3750
224 Ga0111539_10142266 3300009094 Unclassified 2808
225 Ga0111539_10181256 3300009094 Bacteria 2460
226 Ga0111539_10218339 3300009094 Bacteria 2221
227 Ga0111539_10294397 3300009094 Bacteria 1889
228 Ga0111539_10464148 3300009094 Bacteria 1474
229 Ga0105245_10000490 3300009098 Bacteria 36264
230 Ga0105245_10002138 3300009098 Bacteria 17894
231 Ga0105245_10005910 3300009098 Bacteria 10750
232 Ga0105245_10006106 3300009098 Bacteria 10593
233 Ga0105245_10097340 3300009098 Bacteria 2717
234 Ga0114129_10002498 3300009147 Bacteria 25515
235 Ga0114129_10004248 3300009147 Bacteria 20240
236 Ga0114129_10004253 3300009147 Bacteria 20236
237 Ga0114129_10006328 3300009147 Bacteria 16791
238 Ga0114129_10009595 3300009147 Bacteria 13806
239 Ga0114129_10013797 3300009147 Bacteria 11510
240 Ga0114129_10017450 3300009147 Bacteria 10220
241 Ga0114129_10087599 3300009147 Bacteria 4317
242 Ga0114129_10138033 3300009147 Bacteria 3344
243 Ga0114129_10151117 3300009147 Bacteria 3178
244 Ga0114129_10569547 3300009147 Unclassified 1471
245 Ga0105243_10013813 3300009148 Bacteria 6111
246 Ga0105243_10115933 3300009148 Unclassified 2250
247 Ga0105241_10012580 3300009174 Bacteria 6209
248 Ga0105241_10014043 3300009174 Bacteria 5870
249 Ga0105241_10234775 3300009174 Unclassified 1547
250 Ga0105241_10252000 3300009174 Bacteria 1497
251 Ga0105241_10272291 3300009174 Unclassified 1443
252 Ga0105242_10002359 3300009176 Bacteria 14894
253 Ga0105242_10003207 3300009176 Bacteria 12734
254 Ga0105242_10005048 3300009176 Bacteria 10192
255 Ga0105242_10066412 3300009176 Unclassified 2979
256 Ga0105242_10090672 3300009176 Unclassified 2572
257 Ga0105242_10094191 3300009176 Bacteria 2526
258 Ga0105242_10148079 3300009176 Unclassified 2044
259 Ga0105248_10001547 3300009177 Bacteria 25610
260 Ga0105248_10053337 3300009177 Bacteria 4537
261 Ga0105248_10068938 3300009177 Bacteria 3971
262 Ga0105248_10073407 3300009177 Unclassified 3845
263 Ga0105248_10092296 3300009177 Bacteria 3410
264 Ga0105248_10107151 3300009177 Unclassified 3151
265 Ga0105248_10157161 3300009177 Unclassified 2565
266 Ga0105248_10286892 3300009177 Bacteria 1853
267 Ga0105248_10359617 3300009177 Bacteria 1639
268 Ga0105248_10475292 3300009177 Bacteria 1409
269 Ga0105237_10001475 3300009545 Bacteria 31009
270 Ga0105237_10004975 3300009545 Bacteria 15153
271 Ga0105238_10000871 3300009551 Bacteria 31154
272 Ga0105238_10007140 3300009551 Bacteria 11176
273 Ga0105238_10033796 3300009551 Bacteria 5203
274 Ga0105238_10042237 3300009551 Bacteria 4618
275 Ga0105238_10127019 3300009551 Bacteria 2528
276 Ga0105249_10005317 3300009553 Bacteria 11111
277 Ga0105249_10259539 3300009553 Bacteria 1726
278 Ga0105249_10384982 3300009553 Bacteria 1429
279 Ga0105239_10023603 3300010375 Bacteria 6772
280 Ga0105239_10026501 3300010375 Bacteria 6379
281 Ga0105239_10036620 3300010375 Bacteria 5386
282 Ga0105239_10050464 3300010375 Unclassified 4563
283 Ga0105246_10002669 3300011119 Bacteria 10807
284 Ga0105246_10219584 3300011119 Bacteria 1489
285 Ga0157370_10001518 3300013104 Bacteria 28705
286 Ga0157370_10027478 3300013104 Bacteria 5610
287 Ga0157370_10034187 3300013104 Bacteria 4952
288 Ga0157369_10003426 3300013105 Bacteria 18820
289 Ga0157369_10017010 3300013105 Bacteria 8173
290 Ga0157369_10161242 3300013105 Unclassified 2367
291 Ga0157374_10011488 3300013296 Bacteria 7671
292 Ga0157374_10013088 3300013296 Bacteria 7235
293 Ga0157374_10023548 3300013296 Bacteria 5509
294 Ga0157374_10056732 3300013296 Unclassified 3657
295 Ga0157378_10011677 3300013297 Bacteria 7688
296 Ga0157378_10014594 3300013297 Bacteria 6878
297 Ga0157378_10128916 3300013297 Bacteria 2339
298 Ga0157378_10379751 3300013297 Bacteria 1387
299 Ga0163162_10046850 3300013306 Bacteria 4334
300 Ga0163162_10046869 3300013306 Bacteria 4333
301 Ga0163162_10118809 3300013306 Bacteria 2746
302 Ga0157372_10054683 3300013307 Unclassified 4455
303 Ga0157372_10072604 3300013307 Bacteria 3878
304 Ga0157375_10002839 3300013308 Bacteria 14999
305 Ga0157375_10041401 3300013308 Bacteria 4448
306 Ga0157375_10082198 3300013308 Bacteria 3262
307 Ga0157375_10084105 3300013308 Bacteria 3229
308 Ga0163163_10026455 3300014325 Bacteria 5546
309 Ga0163163_10038922 3300014325 Bacteria 4637
310 Ga0163163_10065391 3300014325 Bacteria 3610
311 Ga0163163_10115306 3300014325 Bacteria 2718
312 Ga0157380_10000861 3300014326 Bacteria 19047
313 Ga0157380_10009183 3300014326 Bacteria 7073
314 Ga0157380_10011651 3300014326 Bacteria 6356
315 Ga0157380_10046765 3300014326 Bacteria 3400
316 Ga0157380_10096258 3300014326 Bacteria 2454
317 Ga0157380_10097779 3300014326 Bacteria 2437
318 Ga0157379_10021873 3300014968 Bacteria 5666
319 Ga0157379_10139230 3300014968 Bacteria 2187
320 Ga0157376_10016705 3300014969 Bacteria 5580
321 Ga0157376_10019337 3300014969 Bacteria 5247
322 Ga0157376_10122760 3300014969 Unclassified 2305
323 Ga0157376_10163167 3300014969 Bacteria 2022
324 Ga0157376_10271325 3300014969 Bacteria 1594
325 Ga0163161_10080244 3300017792 Eukaryota 2401
326 Ga0213876_10000006 3300021384 Bacteria 700803
327 Ga0213876_10000195 3300021384 Bacteria 62910
328 Ga0213875_10005321 3300021388 Bacteria 6922
329 Ga0213875_10037437 3300021388 Unclassified 2286
330 Ga0207642_10014503 3300025899 Bacteria 2910
331 Ga0207699_10008807 3300025906 Bacteria 4996
332 Ga0207699_10048566 3300025906 Bacteria 2493
333 Ga0207699_10063096 3300025906 Bacteria 2237
334 Ga0207645_10144364 3300025907 Bacteria 1551
335 Ga0207643_10031879 3300025908 Bacteria 2940
336 Ga0207684_10245149 3300025910 Bacteria 1546
337 Ga0207654_10167872 3300025911 Bacteria 1423
338 Ga0207707_10016577 3300025912 Bacteria 6423
339 Ga0207707_10020659 3300025912 Bacteria 5751
340 Ga0207695_10005333 3300025913 Bacteria 17111
341 Ga0207695_10007676 3300025913 Bacteria 13661
342 Ga0207695_10035137 3300025913 Bacteria 5440
343 Ga0207695_10075033 3300025913 Bacteria 3442
344 Ga0207695_10100626 3300025913 Bacteria 2886
345 Ga0207695_10134133 3300025913 Bacteria 2431
346 Ga0207671_10016195 3300025914 Bacteria 5805
347 Ga0207660_10034251 3300025917 Bacteria 3518
348 Ga0207660_10079148 3300025917 Unclassified 2410
349 Ga0207660_10100597 3300025917 Bacteria 2159
350 Ga0207662_10030407 3300025918 Bacteria 3134
351 Ga0207657_10036296 3300025919 Bacteria 4412
352 Ga0207657_10048504 3300025919 Bacteria 3707
353 Ga0207649_10175443 3300025920 Unclassified 1496
354 Ga0207652_10037679 3300025921 Bacteria 4092
355 Ga0207652_10039944 3300025921 Bacteria 3984
356 Ga0207652_10046010 3300025921 Bacteria 3722
357 Ga0207652_10173176 3300025921 Bacteria 1937
358 Ga0207652_10336885 3300025921 Bacteria 1362
359 Ga0207646_10060631 3300025922 Bacteria 3378
360 Ga0207646_10270338 3300025922 Bacteria 1536
361 Ga0207694_10005323 3300025924 Bacteria 9916
362 Ga0207694_10008394 3300025924 Bacteria 7799
363 Ga0207694_10076451 3300025924 Bacteria 2622
364 Ga0207650_10020540 3300025925 Bacteria 4658
365 Ga0207650_10088593 3300025925 Unclassified 2360
366 Ga0207650_10106493 3300025925 Unclassified 2165
367 Ga0207650_10204514 3300025925 Bacteria 1583
368 Ga0207659_10000241 3300025926 Bacteria 33277
369 Ga0207659_10101752 3300025926 Unclassified 2168
370 Ga0207687_10004441 3300025927 Bacteria 9357
371 Ga0207687_10010444 3300025927 Bacteria 6066
372 Ga0207687_10036996 3300025927 Bacteria 3328
373 Ga0207687_10075675 3300025927 Unclassified 2417
374 Ga0207700_10001812 3300025928 Bacteria 12135
375 Ga0207700_10009899 3300025928 Bacteria 5982
376 Ga0207700_10020379 3300025928 Bacteria 4502
377 Ga0207700_10032221 3300025928 Bacteria 3735
378 Ga0207664_10018561 3300025929 Bacteria 5124
379 Ga0207664_10157619 3300025929 Bacteria 1934
380 Ga0207664_10162922 3300025929 Bacteria 1903
381 Ga0207644_10015073 3300025931 Bacteria 5186
382 Ga0207706_10242480 3300025933 Bacteria 1576
383 Ga0207686_10003426 3300025934 Bacteria 8514
384 Ga0207686_10004114 3300025934 Bacteria 7807
385 Ga0207686_10070935 3300025934 Bacteria 2240
386 Ga0207686_10089327 3300025934 Unclassified 2031
387 Ga0207686_10192397 3300025934 Unclassified 1455
388 Ga0207709_10059784 3300025935 Unclassified 2373
389 Ga0207670_10067797 3300025936 Bacteria 2456
390 Ga0207670_10132782 3300025936 Bacteria 1826
391 Ga0207670_10192995 3300025936 Unclassified 1542
392 Ga0207669_10081027 3300025937 Bacteria 2078
393 Ga0207669_10082990 3300025937 Bacteria 2059
394 Ga0207704_10007671 3300025938 Bacteria 5111
395 Ga0207704_10008493 3300025938 Unclassified 4917
396 Ga0207704_10062249 3300025938 Unclassified 2319
397 Ga0207704_10103091 3300025938 Bacteria 1907
398 Ga0207691_10018786 3300025940 Bacteria 6547
399 Ga0207691_10043416 3300025940 Bacteria 4144
400 Ga0207691_10208504 3300025940 Bacteria 1698
401 Ga0207711_10011561 3300025941 Bacteria 7336
402 Ga0207711_10050212 3300025941 Bacteria 3570
403 Ga0207711_10107399 3300025941 Bacteria 2478
404 Ga0207689_10006205 3300025942 Bacteria 10588
405 Ga0207689_10011054 3300025942 Bacteria 7756
406 Ga0207689_10190490 3300025942 Bacteria 1692
407 Ga0207689_10308398 3300025942 Bacteria 1312
408 Ga0207661_10000014 3300025944 Bacteria 322246
409 Ga0207661_10003426 3300025944 Bacteria 11005
410 Ga0207661_10019094 3300025944 Bacteria 5103
411 Ga0207661_10052767 3300025944 Bacteria 3250
412 Ga0207661_10124851 3300025944 Bacteria 2197
413 Ga0207661_10127451 3300025944 Unclassified 2175
414 Ga0207679_10015130 3300025945 Bacteria 5089
415 Ga0207679_10059912 3300025945 Bacteria 2826
416 Ga0207679_10343308 3300025945 Unclassified 1299
417 Ga0207667_10001510 3300025949 Bacteria 29218
418 Ga0207667_10433018 3300025949 Bacteria 1338
419 Ga0207651_10002706 3300025960 Bacteria 8496
420 Ga0207651_10056636 3300025960 Unclassified 2699
421 Ga0207651_10128863 3300025960 Bacteria 1933
422 Ga0207712_10028899 3300025961 Bacteria 3713
423 Ga0207640_10048336 3300025981 Bacteria 2749
424 Ga0207658_10040308 3300025986 Bacteria 3375
425 Ga0207677_10039549 3300026023 Bacteria 3102
426 Ga0207677_10222886 3300026023 Bacteria 1513
427 Ga0207703_10034132 3300026035 Bacteria 4036
428 Ga0207703_10062604 3300026035 Unclassified 3048
429 Ga0207703_10067807 3300026035 Unclassified 2937
430 Ga0207703_10110421 3300026035 Bacteria 2346
431 Ga0207703_10239364 3300026035 Bacteria 1631
432 Ga0207703_10271007 3300026035 Unclassified 1538
433 Ga0207639_10042992 3300026041 Unclassified 3389
434 Ga0207639_10234062 3300026041 Unclassified 1594
435 Ga0207708_10047006 3300026075 Bacteria 3287
436 Ga0207708_10073616 3300026075 Bacteria 2618
437 Ga0207708_10084066 3300026075 Bacteria 2447
438 Ga0207708_10090595 3300026075 Unclassified 2357
439 Ga0207702_10042502 3300026078 Unclassified 3813
440 Ga0207702_10042672 3300026078 Bacteria 3806
441 Ga0207702_10073979 3300026078 Bacteria 2939
442 Ga0207641_10005845 3300026088 Bacteria 10439
443 Ga0207641_10020650 3300026088 Bacteria 5412
444 Ga0207641_10079313 3300026088 Unclassified 2846
445 Ga0207641_10129971 3300026088 Bacteria 2260
446 Ga0207648_10007142 3300026089 Bacteria 11013
447 Ga0207648_10009845 3300026089 Bacteria 9119
448 Ga0207648_10042943 3300026089 Bacteria 3970
449 Ga0207676_10010318 3300026095 Bacteria 6652
450 Ga0207676_10313675 3300026095 Bacteria 1437
451 Ga0207674_10000852 3300026116 Bacteria 39796
452 Ga0207674_10002753 3300026116 Bacteria 21943
453 Ga0207674_10040963 3300026116 Bacteria 4794
454 Ga0207674_10128245 3300026116 Unclassified 2501
455 Ga0207674_10170031 3300026116 Unclassified 2133
456 Ga0207674_10219835 3300026116 Bacteria 1848
457 Ga0207675_100031474 3300026118 Bacteria 4942
458 Ga0207675_100069657 3300026118 Bacteria 3288
459 Ga0207675_100086475 3300026118 Bacteria 2944
460 Ga0207675_100103939 3300026118 Bacteria 2677
461 Ga0207675_100182668 3300026118 Bacteria 2009
462 Ga0207683_10053472 3300026121 Bacteria 3541
463 Ga0207683_10060138 3300026121 Bacteria 3339
464 Ga0207683_10274186 3300026121 Unclassified 1541
465 Ga0207428_10000005 3300027907 Bacteria 520045
466 Ga0207428_10000993 3300027907 Bacteria 31452
467 Ga0207428_10021076 3300027907 Bacteria 5522
468 Ga0207428_10083352 3300027907 Bacteria 2494
469 Ga0207428_10122223 3300027907 Unclassified 1996
470 Ga0268266_10143222 3300028379 Bacteria 2146
471 Ga0268265_10003625 3300028380 Bacteria 11022
472 Ga0268265_10028201 3300028380 Bacteria 4018
473 Ga0268265_10050777 3300028380 Bacteria 3127
474 Ga0268265_10171916 3300028380 Bacteria 1853
475 Ga0268264_10185000 3300028381 Bacteria 1895
476 Ga0268264_10252284 3300028381 Bacteria 1639
477 Ga0268264_10419924 3300028381 Unclassified 1289
478 Ga0265338_10056747 3300028800 Unclassified 3469
479 Ga0265339_10041970 3300031249 Unclassified 2535
480 Ga0265316_10177246 3300031344 Bacteria 1588
481 Ga0307408_100078278 3300031548 Bacteria 2464
482 Ga0307408_100086997 3300031548 Bacteria 2350
483 Ga0265314_10001424 3300031711 Bacteria 26793
484 Ga0265314_10033816 3300031711 Unclassified 3742
485 Ga0265314_10065114 3300031711 Bacteria 2463
486 Ga0307413_10019297 3300031824 Bacteria 3599
487 Ga0307413_10157044 3300031824 Bacteria 1593
488 Ga0307410_10186258 3300031852 Bacteria 1575
489 Ga0307407_10070915 3300031903 Bacteria 2073
490 Ga0307416_100061193 3300032002 Bacteria 3071
491 Ga0307416_100094345 3300032002 Unclassified 2580
492 Ga0307415_100008893 3300032126 Bacteria 5595
493 Ga0373926_0066878 3300035083 Bacteria 1316
494 Ga0373934_0003786 3300035086 Bacteria 5570
495 Ga0373934_0052080 3300035086 Bacteria 1623
496 Ga0373923_0026345 3300035111 Bacteria 2313
497 Ga0373923_0037763 3300035111 Bacteria 1977
498 Ga0373953_0025517 3300035117 Bacteria 2258
499 Ga0373954_0007508 3300035118 Bacteria 4770
500 Ga0373954_0129859 3300035118 Bacteria 1226
501 Ga0373943_0002256 3300035170 Bacteria 8760
502 Ga0373946_0006145 3300035171 Bacteria 4350
503 Ga0373955_0030577 3300035172 Bacteria 2813
504 Ga0373955_0040872 3300035172 Bacteria 2483
505 Ga0373924_0053092 3300035410 Unclassified 1683
506 Ga0373935_0015256 3300035692 Bacteria 4642
507 Ga0373935_0028757 3300035692 Bacteria 3436
508 Ga0373935_0091382 3300035692 Bacteria 1994
509 Ga0373927_0009709 3300035695 Bacteria 6452
510 Ga0373947_0001112 3300035725 Bacteria 16499
511 Ga0373947_0004331 3300035725 Bacteria 8336
512 Ga0373947_0049717 3300035725 Unclassified 2519
513 Ga0373947_0107222 3300035725 Unclassified 1761
514 Ga0373947_0307662 3300035725 Bacteria 1058
515 Ga0373937_0009429 3300036401 Bacteria 8486
516 Ga0373937_0026352 3300036401 Bacteria 5253
517 Ga0373937_0064423 3300036401 Bacteria 3371
518 Ga0373937_0111336 3300036401 Bacteria 2547
519 Ga0373937_0139140 3300036401 Bacteria 2271
520 Ga0373937_0368888 3300036401 Bacteria 1361
521 Ga0373925_0003012 3300037068 Bacteria 13245
522 Ga0373925_0003265 3300037068 Bacteria 12621
523 Ga0373925_0012514 3300037068 Bacteria 6146
524 Ga0373925_0015157 3300037068 Bacteria 5572
525 Ga0373925_0180322 3300037068 Unclassified 1671
526 Ga0395905_0077073 3300037471 Bacteria 3124
527 Ga0436364_0295928 3300037853 Bacteria 12870
528 Ga0395901_0253321 3300038443 Bacteria 1834
529 Ga0436365_0131921 3300039437 Bacteria 4366
530 Ga0436365_0695157 3300039437 Bacteria 511493
531 Ga0436365_1600837 3300039437 Bacteria 192134
532 Ga0436361_1222180 3300039447 Bacteria 5917
533 Ga0439462_0016658 3300042015 Bacteria 1900
534 Ga0466963_0027938 3300044694 Bacteria 3617
535 Ga0466967_0109438 3300045976 Bacteria 2537
536 Ga0495592_0079229 3300046454 Bacteria 2378
537 Ga0495651_0019729 3300046462 Bacteria 5226
538 Ga0495651_0028679 3300046462 Bacteria 4338
539 Ga0495653_0086569 3300046463 Unclassified 2303
540 Ga0495580_0002123 3300046472 Bacteria 17388
541 Ga0495580_0023219 3300046472 Bacteria 4557
542 Ga0495580_0038840 3300046472 Bacteria 3407
543 Ga0495580_0089197 3300046472 Bacteria 2147
544 Ga0495580_0166567 3300046472 Unclassified 1524
545 Ga0495639_0013076 3300046475 Bacteria 3582
546 Ga0495664_0008230 3300046477 Bacteria 5809
547 Ga0495664_0105023 3300046477 Bacteria 1703
548 Ga0495594_0069656 3300046499 Bacteria 1954
549 Ga0495594_0110077 3300046499 Bacteria 1553
550 Ga0495608_0040810 3300046511 Bacteria 3108
551 Ga0495628_0027603 3300046516 Bacteria 4617
552 Ga0495628_0047701 3300046516 Bacteria 3397
553 Ga0495628_0172454 3300046516 Bacteria 1640
554 Ga0495630_0015988 3300046517 Bacteria 5483
555 Ga0495652_0138590 3300046529 Unclassified 1916
556 Ga0495665_0010067 3300046531 Bacteria 5122
557 Ga0495586_0070883 3300046535 Bacteria 1904
558 Ga0495586_0185453 3300046535 Bacteria 1178
559 Ga0495587_0068366 3300046536 Bacteria 2069
560 Ga0495587_0135280 3300046536 Unclassified 1408
561 Ga0495645_0016818 3300046543 Bacteria 5235
562 Ga0495645_0100552 3300046543 Bacteria 2056
563 Ga0495667_0013211 3300046559 Bacteria 5592
564 Ga0495667_0014055 3300046559 Bacteria 5404
565 Ga0495667_0134153 3300046559 Bacteria 1596
566 Ga0495635_0104809 3300046663 Unclassified 1933
567 Ga0495635_0150809 3300046663 Bacteria 1583
568 Ga0495657_0155826 3300046675 Unclassified 1415
569 Ga0495599_0007265 3300046678 Bacteria 6709
570 Ga0495623_0140142 3300046679 Unclassified 1439
571 Ga0495646_0055000 3300046680 Bacteria 2392
572 Ga0495647_0023559 3300046681 Unclassified 2233
573 Ga0495658_0069376 3300046683 Bacteria 2043
574 Ga0495669_0005933 3300046684 Bacteria 5092
575 Ga0495613_0000156 3300046689 Bacteria 66824
576 Ga0495624_0073581 3300046690 Unclassified 2124
577 Ga0495600_0025951 3300046809 Bacteria 3779
578 Ga0495600_0066579 3300046809 Unclassified 2355
579 Ga0495581_0289136 3300047315 Unclassified 958
580 Ga0495604_0011951 3300047317 Bacteria 6902
581 Ga0495604_0111033 3300047317 Bacteria 1999
582 Ga0495604_0181341 3300047317 Bacteria 1473
583 Ga0495604_0190129 3300047317 Unclassified 1431
584 Ga0495674_0002318 3300047319 Bacteria 18689
585 Ga0495674_0053361 3300047319 Bacteria 3554
586 Ga0495680_0035367 3300047322 Bacteria 4024
587 Ga0495680_0254426 3300047322 Unclassified 1244
588 Ga0495675_0113716 3300047444 Bacteria 1688
589 Ga0495684_0000087 3300047471 Bacteria 64920
590 Ga0495684_0009937 3300047471 Bacteria 7348
591 Ga0495684_0009963 3300047471 Bacteria 7341
592 Ga0495602_0148196 3300048088 Unclassified 1848
593 Ga0496100_0002368 3300048903 Bacteria 9534
594 Ga0496101_0003141 3300048904 Bacteria 10222
595 Ga0496102_0035810 3300048905 Bacteria 4470
596 Ga0496102_0428787 3300048905 Bacteria 1242
597 Ga0496104_0046481 3300048907 Bacteria 4089
598 Ga0496104_0143380 3300048907 Bacteria 2295
599 Ga0496105_0127164 3300048908 Bacteria 2101
600 Ga0496106_0199352 3300048909 Unclassified 1593
601 Ga0496109_0135147 3300048912 Unclassified 2304
602 Ga0496109_0335329 3300048912 Bacteria 1428
603 Ga0496109_0384891 3300048912 Bacteria 1325
604 Ga0496110_0068950 3300048913 Bacteria 3131
605 Ga0496112_0072140 3300048915 Unclassified 3413
606 Ga0496112_0109552 3300048915 Unclassified 2732
607 Ga0496114_0000407 3300048917 Bacteria 31857
608 Ga0496114_0081927 3300048917 Bacteria 2727
609 Ga0496114_0199998 3300048917 Unclassified 1750
610 Ga0496115_0176542 3300048918 Unclassified 1766
611 Ga0501034_0042456 3300049571 Bacteria 4603
612 Ga0501041_0106387 3300049577 Bacteria 1739
613 Ga0501048_0016465 3300049582 Bacteria 5450
614 Ga0501071_0035774 3300049587 Bacteria 3539
615 Ga0501071_0189030 3300049587 Unclassified 1544
616 Ga0501073_0006076 3300049589 Bacteria 9007
617 Ga0501075_0098403 3300049591 Bacteria 2221
618 Ga0501249_007461 3300049679 Bacteria 2260
619 Ga0501083_0021466 3300049744 Bacteria 4488
620 Ga0501045_0163722 3300049824 Unclassified 1656
621 Ga0501045_0181238 3300049824 Bacteria 1569
622 Ga0501045_0275759 3300049824 Bacteria 1252
623 nmdc:mga03683_2203_c1 3300050489 Bacteria 6015
624 nmdc:mga03n38_73349_c1 3300050490 Bacteria 1589
625 nmdc:mga00v17_12018_c1 3300050491 Bacteria 4765
626 nmdc:mga0yw44_14435_c1 3300050492 Bacteria 4195
627 nmdc:mga0yw44_42128_c1 3300050492 Bacteria 2721
628 nmdc:mga07m45_20162_c1 3300050496 Bacteria 3620
629 nmdc:mga05p37_10354_c1 3300050507 Bacteria 11070
630 nmdc:mga05p37_107688_c1 3300050507 Bacteria 3429
631 nmdc:mga05p37_122334_c1 3300050507 Bacteria 3196
632 nmdc:mga05p37_1979_c3 3300050507 Bacteria 10699
633 nmdc:mga05p37_230529_c1 3300050507 Unclassified 2232
634 nmdc:mga05p37_4149_c1 3300050507 Bacteria 16915
635 nmdc:mga05p37_5285_c1 3300050507 Bacteria 15156
636 nmdc:mga05p37_8317_c1 3300050507 Bacteria 12270
637 nmdc:mga09592_1926_c1 3300050508 Bacteria 16690
638 nmdc:mga0qj67_36882_c1 3300050509 Bacteria 3827
639 nmdc:mga06r32_182784_c1 3300050510 Bacteria 2083
640 nmdc:mga06r32_20477_c1 3300050510 Bacteria 6091
641 nmdc:mga06r32_432905_c1 3300050510 Bacteria 1296
642 nmdc:mga06r32_64706_c1 3300050510 Bacteria 3526
643 nmdc:mga08y16_13843_c1 3300050511 Bacteria 8491
644 nmdc:mga08y16_139591_c1 3300050511 Unclassified 2519
645 nmdc:mga08y16_20565_c1 3300050511 Bacteria 6967
646 nmdc:mga08y16_21270_c1 3300050511 Bacteria 6850
647 nmdc:mga08y16_278907_c1 3300050511 Bacteria 1724
648 nmdc:mga08y16_280815_c1 3300050511 Bacteria 1718
649 nmdc:mga08y16_81793_c1 3300050511 Bacteria 3367
650 nmdc:mga08y16_9_c1 3300050511 Bacteria 566088
651 nmdc:mga0n895_11103_c1 3300050512 Bacteria 8015
652 nmdc:mga0n895_277050_c1 3300050512 Bacteria 1701
653 nmdc:mga0n895_34459_c1 3300050512 Bacteria 4874
654 nmdc:mga0n895_414569_c1 3300050512 Bacteria 1362
655 nmdc:mga0n895_489404_c1 3300050512 Unclassified 1240
656 nmdc:mga0rr50_267585_c1 3300050513 Unclassified 1423
657 nmdc:mga0rr50_32535_c1 3300050513 Bacteria 3717
658 nmdc:mga0rr50_77510_c1 3300050513 Bacteria 2554
659 nmdc:mga08x19_14594_c1 3300050514 Bacteria 4766
660 nmdc:mga08x19_197593_c1 3300050514 Bacteria 1378
661 nmdc:mga08x19_5125_c1 3300050514 Bacteria 7749
662 nmdc:mga0a205_100350_c1 3300050515 Bacteria 1833
663 nmdc:mga0a205_122764_c1 3300050515 Bacteria 2497
664 nmdc:mga0a205_12374_c1 3300050515 Bacteria 5177
665 nmdc:mga0a205_259936_c1 3300050515 Bacteria 1614
666 nmdc:mga0a205_37216_c1 3300050515 Bacteria 4679
667 nmdc:mga0a205_40374_c1 3300050515 Bacteria 4492
668 Ga0495601_0007399 3300053077 Bacteria 6435
669 Ga0495601_0104837 3300053077 Unclassified 1828
670 Ga0495601_0138837 3300053077 Bacteria 1585
671 Ga0495619_0001379 3300053085 Bacteria 15972
672 Ga0495619_0029443 3300053085 Unclassified 3547
673 Ga0495619_0100530 3300053085 Unclassified 1968
674 Ga0530510_0050326 3300061734 Bacteria 3010
675 2896111142 2896109856 Bacteria 7140722
676 2910250664 2910245624 Bacteria 6935613
677 Ga0070715_10058338
678 JGI24751J29686_10011708
679 JGI25406J46586_10006766
680 rootH1_10347148
681 Ga0065712_10082940
682 Ga0065712_10119174
683 Ga0065715_10089905
684 Ga0065715_10092529
685 Ga0065715_10118577
686 Ga0065715_10205673
687 Ga0065707_10004084
688 Ga0065707_10004157
689 Ga0070658_10082870
690 Ga0070676_10010407
691 Ga0070676_10138166
692 Ga0070683_100000003
693 Ga0070683_100005545
694 Ga0070683_100005681
695 Ga0070683_100008700
696 Ga0070683_100030053
697 Ga0070683_100078549
698 Ga0070683_100116108
699 Ga0070683_100123777
700 Ga0070683_100178469
701 Ga0070683_100227206
702 Ga0070690_100025217
703 Ga0070690_100129423
704 Ga0070670_100017071
705 Ga0070670_100231365
706 Ga0068869_100019780
707 Ga0068869_100087067
708 Ga0070666_10144138
709 Ga0070680_100059238
710 Ga0068868_100064235
711 Ga0068868_100081652
712 Ga0068868_100155737
713 Ga0070660_100018240
714 Ga0070660_100026222
715 Ga0070660_100330796
716 Ga0070689_100107508
717 Ga0070687_100033540
718 Ga0070661_100067756
719 Ga0070661_100283733
720 Ga0070692_10075586
721 Ga0070669_100010911
722 Ga0070669_100060769
723 Ga0070669_100066343
724 Ga0070675_100007001
725 Ga0070675_100042355
726 Ga0070675_100097144
727 Ga0070671_100042393
728 Ga0070674_100016804
729 Ga0070674_100115096
730 Ga0070674_100117583
731 Ga0070673_100006024
732 Ga0070673_100007431
733 Ga0070673_100221825
734 Ga0070688_100012764
735 Ga0070659_100050801
736 Ga0070659_100181218
737 Ga0070667_100002989
738 Ga0070709_10009341
739 Ga0070714_100001312
740 Ga0070714_100046544
741 Ga0070713_100001763
742 Ga0070713_100014614
743 Ga0070713_100116657
744 Ga0070701_10021215
745 Ga0070701_10046329
746 Ga0070711_100017621
747 Ga0070711_100146555
748 Ga0070700_100014231
749 Ga0070694_100033768
750 Ga0070708_100021281
751 Ga0070708_100035939
752 Ga0070663_100180808
753 Ga0070678_100075741
754 Ga0070678_100190224
755 Ga0070681_10001224
756 Ga0070681_10022544
757 Ga0070681_10050055
758 Ga0070681_10050812
759 Ga0070681_10058860
760 Ga0068867_100120775
761 Ga0070706_100185425
762 Ga0070707_100004048
763 Ga0070707_100290995
764 Ga0070698_100032447
765 Ga0070698_100080977
766 Ga0070698_100165557
767 Ga0070699_100007866
768 Ga0070699_100104459
769 Ga0070679_100054914
770 Ga0070679_100185539
771 Ga0070679_100386128
772 Ga0070684_100000014
773 Ga0070684_100044167
774 Ga0070684_100054563
775 Ga0070684_100083841
776 Ga0070697_100231844
777 Ga0068853_100111955
778 Ga0068853_100228715
779 Ga0070672_100008628
780 Ga0070672_100044211
781 Ga0070686_100252560
782 Ga0070695_100010272
783 Ga0070695_100037108
784 Ga0070695_100058104
785 Ga0070695_100062615
786 Ga0070696_100090775
787 Ga0070693_100058291
788 Ga0070665_100051303
789 Ga0070704_100020912
790 Ga0070704_100023980
791 Ga0070704_100035212
792 Ga0068855_100007201
793 Ga0068855_100018692
794 Ga0068855_100084357
795 Ga0068855_100104239
796 Ga0068855_100106894
797 Ga0068857_100002309
798 Ga0068857_100032494
799 Ga0068857_100073774
800 Ga0068857_100123543
801 Ga0068857_100171565
802 Ga0068854_100040635
803 Ga0068856_100005250
804 Ga0068856_100045508
805 Ga0068856_100045548
806 Ga0068856_100195505
807 Ga0068852_100168888
808 Ga0068859_100111066
809 Ga0068859_100120011
810 Ga0068859_100176526
811 Ga0068864_100009871
812 Ga0068866_10019484
813 Ga0068861_100061692
814 Ga0068861_100074161
815 Ga0068861_100213308
816 Ga0068861_100302648
817 Ga0068870_10024125
818 Ga0068870_10091808
819 Ga0068863_100000611
820 Ga0068863_100055954
821 Ga0068863_100079976
822 Ga0068863_100131863
823 Ga0068863_100192362
824 Ga0068858_100010226
825 Ga0068858_100042827
826 Ga0068858_100091813
827 Ga0068858_100113233
828 Ga0068858_100255558
829 Ga0068860_100023237
830 Ga0068860_100215054
831 Ga0068862_100025767
832 Ga0068862_100030616
833 Ga0068862_100036461
834 Ga0068862_100217968
835 Ga0068862_100330313
836 Ga0081539_10020533
837 Ga0075365_10022091
838 Ga0075365_10026048
839 Ga0075368_10032490
840 Ga0075363_100095373
841 Ga0075364_10047315
842 Ga0075362_10013034
843 Ga0075367_10001851
844 Ga0075367_10006766
845 Ga0075366_10005634
846 Ga0097621_100000819
847 Ga0097621_100029776
848 Ga0097621_100040533
849 Ga0097621_100166169
850 Ga0097621_100260832
851 Ga0075370_10003294
852 Ga0068871_100001182
853 Ga0068871_100002781
854 Ga0068871_100004676
855 Ga0068871_100008507
856 Ga0068871_100098613
857 Ga0075428_100033601
858 Ga0075428_100038675
859 Ga0075428_100043250
860 Ga0075428_100061508
861 Ga0075430_100000169
862 Ga0075430_100065335
863 Ga0075431_100026440
864 Ga0075431_100050275
865 Ga0075431_100166894
866 Ga0075433_10020031
867 Ga0075433_10024106
868 Ga0075433_10032740
869 Ga0075433_10108687
870 Ga0075433_10237442
871 Ga0075433_10246913
872 Ga0075433_10310665
873 Ga0075434_100006143
874 Ga0075434_100168658
875 Ga0075434_100184795
876 Ga0075429_100010631
877 Ga0075429_100120525
878 Ga0068865_100001355
879 Ga0075436_100027588
880 Ga0075436_100142177
881 Ga0075436_100209021
882 Ga0097620_100111075
883 Ga0097620_100120010
884 Ga0097620_100176533
885 Ga0075435_100025622
886 Ga0075435_100030400
887 Ga0075435_100221767
888 Ga0105240_10000780
889 Ga0105240_10005993
890 Ga0105240_10016784
891 Ga0105240_10025437
892 Ga0105240_10076526
893 Ga0105240_10119497
894 Ga0105240_10154667
895 Ga0105240_10368606
896 Ga0111539_10000009
897 Ga0111539_10019099
898 Ga0111539_10028914
899 Ga0111539_10083746
900 Ga0111539_10142266
901 Ga0111539_10181256
902 Ga0111539_10218339
903 Ga0111539_10294397
904 Ga0111539_10464148
905 Ga0105245_10000490
906 Ga0105245_10002138
907 Ga0105245_10005910
908 Ga0105245_10006106
909 Ga0105245_10097340
910 Ga0114129_10002498
911 Ga0114129_10004248
912 Ga0114129_10004253
913 Ga0114129_10006328
914 Ga0114129_10009595
915 Ga0114129_10013797
916 Ga0114129_10017450
917 Ga0114129_10087599
918 Ga0114129_10138033
919 Ga0114129_10151117
920 Ga0114129_10569547
921 Ga0105243_10013813
922 Ga0105243_10115933
923 Ga0105241_10012580
924 Ga0105241_10014043
925 Ga0105241_10234775
926 Ga0105241_10252000
927 Ga0105241_10272291
928 Ga0105242_10002359
929 Ga0105242_10003207
930 Ga0105242_10005048
931 Ga0105242_10066412
932 Ga0105242_10090672
933 Ga0105242_10094191
934 Ga0105242_10148079
935 Ga0105248_10001547
936 Ga0105248_10053337
937 Ga0105248_10068938
938 Ga0105248_10073407
939 Ga0105248_10092296
940 Ga0105248_10107151
941 Ga0105248_10157161
942 Ga0105248_10286892
943 Ga0105248_10359617
944 Ga0105248_10475292
945 Ga0105237_10001475
946 Ga0105237_10004975
947 Ga0105238_10000871
948 Ga0105238_10007140
949 Ga0105238_10033796
950 Ga0105238_10042237
951 Ga0105238_10127019
952 Ga0105249_10005317
953 Ga0105249_10259539
954 Ga0105249_10384982
955 Ga0105239_10023603
956 Ga0105239_10026501
957 Ga0105239_10036620
958 Ga0105239_10050464
959 Ga0105246_10002669
960 Ga0105246_10219584
961 Ga0157370_10001518
962 Ga0157370_10027478
963 Ga0157370_10034187
964 Ga0157369_10003426
965 Ga0157369_10017010
966 Ga0157369_10161242
967 Ga0157374_10011488
968 Ga0157374_10013088
969 Ga0157374_10023548
970 Ga0157374_10056732
971 Ga0157378_10011677
972 Ga0157378_10014594
973 Ga0157378_10128916
974 Ga0157378_10379751
975 Ga0163162_10046850
976 Ga0163162_10046869
977 Ga0163162_10118809
978 Ga0157372_10054683
979 Ga0157372_10072604
980 Ga0157375_10002839
981 Ga0157375_10041401
982 Ga0157375_10082198
983 Ga0157375_10084105
984 Ga0163163_10026455
985 Ga0163163_10038922
986 Ga0163163_10065391
987 Ga0163163_10115306
988 Ga0157380_10000861
989 Ga0157380_10009183
990 Ga0157380_10011651
991 Ga0157380_10046765
992 Ga0157380_10096258
993 Ga0157380_10097779
994 Ga0157379_10021873
995 Ga0157379_10139230
996 Ga0157376_10016705
997 Ga0157376_10019337
998 Ga0157376_10122760
999 Ga0157376_10163167
1000 Ga0157376_10271325
1001 Ga0163161_10080244
1002 Ga0213876_10000006
1003 Ga0213876_10000195
1004 Ga0213875_10005321
1005 Ga0213875_10037437
1006 Ga0207642_10014503
1007 Ga0207699_10008807
1008 Ga0207699_10048566
1009 Ga0207699_10063096
1010 Ga0207645_10144364
1011 Ga0207643_10031879
1012 Ga0207684_10245149
1013 Ga0207654_10167872
1014 Ga0207707_10016577
1015 Ga0207707_10020659
1016 Ga0207695_10005333
1017 Ga0207695_10007676
1018 Ga0207695_10035137
1019 Ga0207695_10075033
1020 Ga0207695_10100626
1021 Ga0207695_10134133
1022 Ga0207671_10016195
1023 Ga0207660_10034251
1024 Ga0207660_10079148
1025 Ga0207660_10100597
1026 Ga0207662_10030407
1027 Ga0207657_10036296
1028 Ga0207657_10048504
1029 Ga0207649_10175443
1030 Ga0207652_10037679
1031 Ga0207652_10039944
1032 Ga0207652_10046010
1033 Ga0207652_10173176
1034 Ga0207652_10336885
1035 Ga0207646_10060631
1036 Ga0207646_10270338
1037 Ga0207694_10005323
1038 Ga0207694_10008394
1039 Ga0207694_10076451
1040 Ga0207650_10020540
1041 Ga0207650_10088593
1042 Ga0207650_10106493
1043 Ga0207650_10204514
1044 Ga0207659_10000241
1045 Ga0207659_10101752
1046 Ga0207687_10004441
1047 Ga0207687_10010444
1048 Ga0207687_10036996
1049 Ga0207687_10075675
1050 Ga0207700_10001812
1051 Ga0207700_10009899
1052 Ga0207700_10020379
1053 Ga0207700_10032221
1054 Ga0207664_10018561
1055 Ga0207664_10157619
1056 Ga0207664_10162922
1057 Ga0207644_10015073
1058 Ga0207706_10242480
1059 Ga0207686_10003426
1060 Ga0207686_10004114
1061 Ga0207686_10070935
1062 Ga0207686_10089327
1063 Ga0207686_10192397
1064 Ga0207709_10059784
1065 Ga0207670_10067797
1066 Ga0207670_10132782
1067 Ga0207670_10192995
1068 Ga0207669_10081027
1069 Ga0207669_10082990
1070 Ga0207704_10007671
1071 Ga0207704_10008493
1072 Ga0207704_10062249
1073 Ga0207704_10103091
1074 Ga0207691_10018786
1075 Ga0207691_10043416
1076 Ga0207691_10208504
1077 Ga0207711_10011561
1078 Ga0207711_10050212
1079 Ga0207711_10107399
1080 Ga0207689_10006205
1081 Ga0207689_10011054
1082 Ga0207689_10190490
1083 Ga0207689_10308398
1084 Ga0207661_10000014
1085 Ga0207661_10003426
1086 Ga0207661_10019094
1087 Ga0207661_10052767
1088 Ga0207661_10124851
1089 Ga0207661_10127451
1090 Ga0207679_10015130
1091 Ga0207679_10059912
1092 Ga0207679_10343308
1093 Ga0207667_10001510
1094 Ga0207667_10433018
1095 Ga0207651_10002706
1096 Ga0207651_10056636
1097 Ga0207651_10128863
1098 Ga0207712_10028899
1099 Ga0207640_10048336
1100 Ga0207658_10040308
1101 Ga0207677_10039549
1102 Ga0207677_10222886
1103 Ga0207703_10034132
1104 Ga0207703_10062604
1105 Ga0207703_10067807
1106 Ga0207703_10110421
1107 Ga0207703_10239364
1108 Ga0207703_10271007
1109 Ga0207639_10042992
1110 Ga0207639_10234062
1111 Ga0207708_10047006
1112 Ga0207708_10073616
1113 Ga0207708_10084066
1114 Ga0207708_10090595
1115 Ga0207702_10042502
1116 Ga0207702_10042672
1117 Ga0207702_10073979
1118 Ga0207641_10005845
1119 Ga0207641_10020650
1120 Ga0207641_10079313
1121 Ga0207641_10129971
1122 Ga0207648_10007142
1123 Ga0207648_10009845
1124 Ga0207648_10042943
1125 Ga0207676_10010318
1126 Ga0207676_10313675
1127 Ga0207674_10000852
1128 Ga0207674_10002753
1129 Ga0207674_10040963
1130 Ga0207674_10128245
1131 Ga0207674_10170031
1132 Ga0207674_10219835
1133 Ga0207675_100031474
1134 Ga0207675_100069657
1135 Ga0207675_100086475
1136 Ga0207675_100103939
1137 Ga0207675_100182668
1138 Ga0207683_10053472
1139 Ga0207683_10060138
1140 Ga0207683_10274186
1141 Ga0207428_10000005
1142 Ga0207428_10000993
1143 Ga0207428_10021076
1144 Ga0207428_10083352
1145 Ga0207428_10122223
1146 Ga0268266_10143222
1147 Ga0268265_10003625
1148 Ga0268265_10028201
1149 Ga0268265_10050777
1150 Ga0268265_10171916
1151 Ga0268264_10185000
1152 Ga0268264_10252284
1153 Ga0268264_10419924
1154 Ga0265338_10056747
1155 Ga0265339_10041970
1156 Ga0265316_10177246
1157 Ga0307408_100078278
1158 Ga0307408_100086997
1159 Ga0265314_10001424
1160 Ga0265314_10033816
1161 Ga0265314_10065114
1162 Ga0307413_10019297
1163 Ga0307413_10157044
1164 Ga0307410_10186258
1165 Ga0307407_10070915
1166 Ga0307416_100061193
1167 Ga0307416_100094345
1168 Ga0307415_100008893
1169 Ga0373926_0066878
1170 Ga0373934_0003786
1171 Ga0373934_0052080
1172 Ga0373923_0026345
1173 Ga0373923_0037763
1174 Ga0373953_0025517
1175 Ga0373954_0007508
1176 Ga0373954_0129859
1177 Ga0373943_0002256
1178 Ga0373946_0006145
1179 Ga0373955_0030577
1180 Ga0373955_0040872
1181 Ga0373924_0053092
1182 Ga0373935_0015256
1183 Ga0373935_0028757
1184 Ga0373935_0091382
1185 Ga0373927_0009709
1186 Ga0373947_0001112
1187 Ga0373947_0004331
1188 Ga0373947_0049717
1189 Ga0373947_0107222
1190 Ga0373947_0307662
1191 Ga0373937_0009429
1192 Ga0373937_0026352
1193 Ga0373937_0064423
1194 Ga0373937_0111336
1195 Ga0373937_0139140
1196 Ga0373937_0368888
1197 Ga0373925_0003012
1198 Ga0373925_0003265
1199 Ga0373925_0012514
1200 Ga0373925_0015157
1201 Ga0373925_0180322
1202 Ga0395905_0077073
1203 Ga0436364_0295928
1204 Ga0395901_0253321
1205 Ga0436365_0131921
1206 Ga0436365_0695157
1207 Ga0436365_1600837
1208 Ga0436361_1222180
1209 Ga0439462_0016658
1210 Ga0466963_0027938
1211 Ga0466967_0109438
1212 Ga0495592_0079229
1213 Ga0495651_0019729
1214 Ga0495651_0028679
1215 Ga0495653_0086569
1216 Ga0495580_0002123
1217 Ga0495580_0023219
1218 Ga0495580_0038840
1219 Ga0495580_0089197
1220 Ga0495580_0166567
1221 Ga0495639_0013076
1222 Ga0495664_0008230
1223 Ga0495664_0105023
1224 Ga0495594_0069656
1225 Ga0495594_0110077
1226 Ga0495608_0040810
1227 Ga0495628_0027603
1228 Ga0495628_0047701
1229 Ga0495628_0172454
1230 Ga0495630_0015988
1231 Ga0495652_0138590
1232 Ga0495665_0010067
1233 Ga0495586_0070883
1234 Ga0495586_0185453
1235 Ga0495587_0068366
1236 Ga0495587_0135280
1237 Ga0495645_0016818
1238 Ga0495645_0100552
1239 Ga0495667_0013211
1240 Ga0495667_0014055
1241 Ga0495667_0134153
1242 Ga0495635_0104809
1243 Ga0495635_0150809
1244 Ga0495657_0155826
1245 Ga0495599_0007265
1246 Ga0495623_0140142
1247 Ga0495646_0055000
1248 Ga0495647_0023559
1249 Ga0495658_0069376
1250 Ga0495669_0005933
1251 Ga0495613_0000156
1252 Ga0495624_0073581
1253 Ga0495600_0025951
1254 Ga0495600_0066579
1255 Ga0495581_0289136
1256 Ga0495604_0011951
1257 Ga0495604_0111033
1258 Ga0495604_0181341
1259 Ga0495604_0190129
1260 Ga0495674_0002318
1261 Ga0495674_0053361
1262 Ga0495680_0035367
1263 Ga0495680_0254426
1264 Ga0495675_0113716
1265 Ga0495684_0000087
1266 Ga0495684_0009937
1267 Ga0495684_0009963
1268 Ga0495602_0148196
1269 Ga0496100_0002368
1270 Ga0496101_0003141
1271 Ga0496102_0035810
1272 Ga0496102_0428787
1273 Ga0496104_0046481
1274 Ga0496104_0143380
1275 Ga0496105_0127164
1276 Ga0496106_0199352
1277 Ga0496109_0135147
1278 Ga0496109_0335329
1279 Ga0496109_0384891
1280 Ga0496110_0068950
1281 Ga0496112_0072140
1282 Ga0496112_0109552
1283 Ga0496114_0000407
1284 Ga0496114_0081927
1285 Ga0496114_0199998
1286 Ga0496115_0176542
1287 Ga0501034_0042456
1288 Ga0501041_0106387
1289 Ga0501048_0016465
1290 Ga0501071_0035774
1291 Ga0501071_0189030
1292 Ga0501073_0006076
1293 Ga0501075_0098403
1294 Ga0501249_007461
1295 Ga0501083_0021466
1296 Ga0501045_0163722
1297 Ga0501045_0181238
1298 Ga0501045_0275759
1299 nmdc:mga03683_2203_c1
1300 nmdc:mga03n38_73349_c1
1301 nmdc:mga00v17_12018_c1
1302 nmdc:mga0yw44_14435_c1
1303 nmdc:mga0yw44_42128_c1
1304 nmdc:mga07m45_20162_c1
1305 nmdc:mga05p37_10354_c1
1306 nmdc:mga05p37_107688_c1
1307 nmdc:mga05p37_122334_c1
1308 nmdc:mga05p37_1979_c3
1309 nmdc:mga05p37_230529_c1
1310 nmdc:mga05p37_4149_c1
1311 nmdc:mga05p37_5285_c1
1312 nmdc:mga05p37_8317_c1
1313 nmdc:mga09592_1926_c1
1314 nmdc:mga0qj67_36882_c1
1315 nmdc:mga06r32_182784_c1
1316 nmdc:mga06r32_20477_c1
1317 nmdc:mga06r32_432905_c1
1318 nmdc:mga06r32_64706_c1
1319 nmdc:mga08y16_13843_c1
1320 nmdc:mga08y16_139591_c1
1321 nmdc:mga08y16_20565_c1
1322 nmdc:mga08y16_21270_c1
1323 nmdc:mga08y16_278907_c1
1324 nmdc:mga08y16_280815_c1
1325 nmdc:mga08y16_81793_c1
1326 nmdc:mga08y16_9_c1
1327 nmdc:mga0n895_11103_c1
1328 nmdc:mga0n895_277050_c1
1329 nmdc:mga0n895_34459_c1
1330 nmdc:mga0n895_414569_c1
1331 nmdc:mga0n895_489404_c1
1332 nmdc:mga0rr50_267585_c1
1333 nmdc:mga0rr50_32535_c1
1334 nmdc:mga0rr50_77510_c1
1335 nmdc:mga08x19_14594_c1
1336 nmdc:mga08x19_197593_c1
1337 nmdc:mga08x19_5125_c1
1338 nmdc:mga0a205_100350_c1
1339 nmdc:mga0a205_122764_c1
1340 nmdc:mga0a205_12374_c1
1341 nmdc:mga0a205_259936_c1
1342 nmdc:mga0a205_37216_c1
1343 nmdc:mga0a205_40374_c1
1344 Ga0495601_0007399
1345 Ga0495601_0104837
1346 Ga0495601_0138837
1347 Ga0495619_0001379
1348 Ga0495619_0029443
1349 Ga0495619_0100530
1350 Ga0530510_0050326
1351 2896111142
1352 2910250664

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF21751

DACNV

Probable sensor domain DACNV

89

179

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
8esg-assembly1.cif.gz_A-2 bile salt hydrolase b from lactobacillus gasseri with covalent inhibitor bound 0.7611 346 374
7svh-assembly1.cif.gz_E-2 bile salt hydrolase b from lactobacillus gasseri 0.7455 346 374
8fao-assembly1.cif.gz_E bile salt hydrolase b from lactobacillus gasseri with covalent inhibitor bound 0.7429 346 374
6uh4-assembly2.cif.gz_D-5 b. theta bile salt hydrolase with covalent inhibitor 0.6819 347 376
4yxm-assembly1.cif.gz_A structure of thermotoga maritima disa d75n mutant with reaction product c-di-amp 0.6817 179 372
ID Description Score Start End Superfamily
af_Q58408_150_306_3.40.1700.10 Alpha Beta;3-Layer(aba) Sandwich;YojJ-like (1;DNA integrity scanning protein, DisA, N-terminal domain 0.7208 198 362 3.40.1700.10
af_Q5A2K5_69_300_2.60.120.200 Mainly Beta;Sandwich;Jelly Rolls; 0.7081 131 166 2.60.120.200
af_P9WNW5_7_141_3.40.1700.10 Alpha Beta;3-Layer(aba) Sandwich;YojJ-like (1;DNA integrity scanning protein, DisA, N-terminal domain 0.6948 177 372 3.40.1700.10
2fb5C02 Alpha Beta;3-Layer(aba) Sandwich;YojJ-like (1;DNA integrity scanning protein, DisA, N-terminal domain 0.6919 197 372 3.40.1700.10
af_P9WNW5_7_141_3.40.1700.10 Alpha Beta;3-Layer(aba) Sandwich;YojJ-like (1;DNA integrity scanning protein, DisA, N-terminal domain 0.6864 177 372 3.40.1700.10
ID Description Score Start End GO Terms
AF-A0A4Q3SIF1-F1-model_v4 deleted 0.9696 208 380
AF-A0A838RX87-F1-model_v4 Uncharacterized protein 0.9589 233 380
AF-A0A4Q3SIF1-F1-model_v4 deleted 0.9587 208 380
AF-A0A7V9AHI2-F1-model_v4 Probable sensor domain-containing protein 0.9575 68 380
AF-A0A3N5P461-F1-model_v4 peptidoglycan glycosyltransferase (EC 2.4.99.28) 0.9543 1 380 GO:0004180
GO:0005886
GO:0006508
GO:0008360
GO:0008955
GO:0009252
GO:0030288
GO:0071555

Map