F474468

General Info

Members Datasets Scaffolds Average Seq Length
675 263 1350 120

Family's Representative Sequence

Representative Sequence 3300050511|nmdc:mga08y16_1199923_c1|nmdc:mga08y16_1199923_c1_43_480
Length 145
Sequence VQRVLRNPFVKGEPTVTYNNQKEDNMKKSITILVCCALLAPLAFAQPESKGKKQAATTAEEITVTGTMLKMTSEEGSAANYQPFKTLVVREDRSNTPGTYVLNGRGHVVNKKGEIIQTAIKPGTRVQIFYANIGDSRVVDHVVVD

Samples

Sample ID Description Type Environment
1 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
5 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
37 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
38 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
39 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
40 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
41 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
42 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
43 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
44 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
45 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
46 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
51 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
52 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
53 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
54 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
55 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
56 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
57 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
58 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
59 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
60 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
63 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
66 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
74 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
75 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
76 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
77 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
78 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
79 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
83 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
87 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
101 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
102 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
103 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
111 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
112 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
113 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
114 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
115 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
118 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
177 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
178 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
179 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
180 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
181 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
182 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
183 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
184 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
185 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
186 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
187 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
188 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
189 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
190 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
191 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
192 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
193 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
194 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
195 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
196 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
197 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
198 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
199 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
200 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
201 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
202 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
203 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
204 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
205 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
206 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
207 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
208 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
209 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
210 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
211 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
212 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
213 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
214 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
215 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
216 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
217 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
218 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
219 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
220 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
221 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
222 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
223 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
224 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
225 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
226 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
227 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
228 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
229 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
230 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
231 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
232 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
233 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
234 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
235 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
236 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
237 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
238 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
239 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
240 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
241 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
242 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
243 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
244 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
245 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
246 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
247 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
248 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
249 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
250 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
251 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
252 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
253 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
254 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
255 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
256 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
257 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
258 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
259 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
260 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
261 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
262 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
263 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.7
Metatranscriptomes 0.3
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.22
Rhizosphere 93.63
Stem 0
Stem Tuber 0
Unclassified 48.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga08y16_1199923_c1 3300050511 Bacteria 729
2 SwRhRL2b_contig_2125715 2162886007 Bacteria 859
3 SwRhRL2b_contig_3759661 2162886007 Bacteria 1378
4 JGI25404J52841_10003778 3300003659 Bacteria 3021
5 JGI25405J52794_10001820 3300003911 Bacteria 3578
6 Ga0058862_12430631 3300004803 Bacteria 530
7 Ga0065714_10161900 3300005288 Bacteria 1047
8 Ga0065704_10008450 3300005289 Unclassified 2276
9 Ga0065704_10014346 3300005289 Bacteria 2172
10 Ga0065704_10100668 3300005289 Bacteria 2263
11 Ga0065704_10102223 3300005289 Bacteria 2208
12 Ga0065704_10258611 3300005289 Bacteria 971
13 Ga0065704_10478304 3300005289 Bacteria 684
14 Ga0065704_10617543 3300005289 Unclassified 598
15 Ga0065704_10779933 3300005289 Unclassified 532
16 Ga0065712_10003070 3300005290 Bacteria 10088
17 Ga0065712_10003383 3300005290 Bacteria 5339
18 Ga0065712_10115717 3300005290 Bacteria 1745
19 Ga0065712_10463537 3300005290 Bacteria 676
20 Ga0065715_10001406 3300005293 Bacteria 8036
21 Ga0065715_10003848 3300005293 Unclassified 4604
22 Ga0065715_10234416 3300005293 Unclassified 1222
23 Ga0065715_10289624 3300005293 Bacteria 1064
24 Ga0065715_10519488 3300005293 Unclassified 765
25 Ga0065707_10019936 3300005295 Bacteria 2169
26 Ga0065707_10030012 3300005295 Bacteria 908
27 Ga0065707_10053798 3300005295 Unclassified 900
28 Ga0065707_10103198 3300005295 Bacteria 2760
29 Ga0065707_10187492 3300005295 Bacteria 1380
30 Ga0065707_10430385 3300005295 Bacteria 821
31 Ga0065707_10441439 3300005295 Bacteria 796
32 Ga0070658_10086760 3300005327 Unclassified 2575
33 Ga0070658_11476303 3300005327 Unclassified 590
34 Ga0070676_10710309 3300005328 Unclassified 735
35 Ga0070683_100055269 3300005329 Bacteria 3684
36 Ga0070683_100098231 3300005329 Unclassified 2755
37 Ga0070683_100122213 3300005329 Bacteria 2460
38 Ga0070683_100601624 3300005329 Unclassified 1052
39 Ga0070690_100075043 3300005330 Unclassified 2204
40 Ga0070690_100233267 3300005330 Unclassified 1295
41 Ga0070670_101622342 3300005331 Unclassified 595
42 Ga0068869_100096987 3300005334 Bacteria 2226
43 Ga0070666_10233839 3300005335 Bacteria 1298
44 Ga0070666_10330324 3300005335 Unclassified 1089
45 Ga0070666_10718861 3300005335 Unclassified 733
46 Ga0070680_100036859 3300005336 Bacteria 3951
47 Ga0070680_100359782 3300005336 Unclassified 1238
48 Ga0070682_100039565 3300005337 Unclassified 2898
49 Ga0068868_100063289 3300005338 Unclassified 2935
50 Ga0070660_100059340 3300005339 Bacteria 2967
51 Ga0070660_100388464 3300005339 Unclassified 1153
52 Ga0070660_100873647 3300005339 Unclassified 758
53 Ga0070660_101198750 3300005339 Unclassified 644
54 Ga0070689_100012659 3300005340 Bacteria 6084
55 Ga0070689_100069402 3300005340 Unclassified 2749
56 Ga0070689_100187621 3300005340 Bacteria 1682
57 Ga0070689_100775461 3300005340 Unclassified 842
58 Ga0070689_101476602 3300005340 Unclassified 615
59 Ga0070691_10797306 3300005341 Unclassified 575
60 Ga0070687_100056748 3300005343 Bacteria 2050
61 Ga0070661_100293207 3300005344 Bacteria 1265
62 Ga0070661_100367430 3300005344 Bacteria 1132
63 Ga0070661_101222970 3300005344 Unclassified 629
64 Ga0070692_10072887 3300005345 Bacteria 1833
65 Ga0070668_100071754 3300005347 Bacteria 2698
66 Ga0070668_100961907 3300005347 Unclassified 766
67 Ga0070669_101173402 3300005353 Unclassified 663
68 Ga0070669_101501255 3300005353 Unclassified 586
69 Ga0070669_101731544 3300005353 Unclassified 545
70 Ga0070675_100005376 3300005354 Bacteria 9786
71 Ga0070675_100047008 3300005354 Bacteria 3535
72 Ga0070675_100075087 3300005354 Bacteria 2809
73 Ga0070675_100185269 3300005354 Bacteria 1801
74 Ga0070675_101135083 3300005354 Bacteria 719
75 Ga0070671_100104553 3300005355 Unclassified 2376
76 Ga0070671_100638518 3300005355 Bacteria 921
77 Ga0070674_100561987 3300005356 Unclassified 959
78 Ga0070674_100577202 3300005356 Unclassified 947
79 Ga0070673_100021673 3300005364 Unclassified 4665
80 Ga0070688_100004900 3300005365 Bacteria 7003
81 Ga0070688_100026230 3300005365 Unclassified 3460
82 Ga0070688_100598580 3300005365 Unclassified 843
83 Ga0070659_100008343 3300005366 Bacteria 7564
84 Ga0070659_100083545 3300005366 Bacteria 2553
85 Ga0070659_100792804 3300005366 Unclassified 824
86 Ga0070659_100881723 3300005366 Unclassified 781
87 Ga0070659_101657347 3300005366 Unclassified 572
88 Ga0070667_100174354 3300005367 Unclassified 1900
89 Ga0070667_100193287 3300005367 Unclassified 1803
90 Ga0070667_100480218 3300005367 Unclassified 1138
91 Ga0070703_10461137 3300005406 Unclassified 565
92 Ga0070709_10009604 3300005434 Bacteria 5341
93 Ga0070709_10544059 3300005434 Bacteria 888
94 Ga0070709_10681036 3300005434 Unclassified 798
95 Ga0070714_100015874 3300005435 Bacteria 6070
96 Ga0070714_100295936 3300005435 Bacteria 1507
97 Ga0070714_100319032 3300005435 Unclassified 1453
98 Ga0070714_100645387 3300005435 Unclassified 1019
99 Ga0070714_100892287 3300005435 Unclassified 863
100 Ga0070713_100016136 3300005436 Bacteria 5611
101 Ga0070713_100108925 3300005436 Bacteria 2412
102 Ga0070713_100294546 3300005436 Bacteria 1492
103 Ga0070713_100612806 3300005436 Bacteria 1035
104 Ga0070713_100810362 3300005436 Unclassified 898
105 Ga0070713_101803769 3300005436 Unclassified 594
106 Ga0070710_10105132 3300005437 Bacteria 1687
107 Ga0070710_10140203 3300005437 Unclassified 1482
108 Ga0070710_10268987 3300005437 Bacteria 1101
109 Ga0070710_10280118 3300005437 Bacteria 1082
110 Ga0070701_10275177 3300005438 Unclassified 1026
111 Ga0070701_10339790 3300005438 Unclassified 935
112 Ga0070701_10469246 3300005438 Bacteria 811
113 Ga0070711_100023042 3300005439 Bacteria 4044
114 Ga0070711_100043079 3300005439 Unclassified 3055
115 Ga0070711_100059459 3300005439 Bacteria 2653
116 Ga0070711_100169987 3300005439 Bacteria 1661
117 Ga0070711_100610956 3300005439 Unclassified 911
118 Ga0070705_100056779 3300005440 Bacteria 2307
119 Ga0070700_100154739 3300005441 Unclassified 1572
120 Ga0070700_100208796 3300005441 Bacteria 1376
121 Ga0070694_100038025 3300005444 Bacteria 3195
122 Ga0070708_100190928 3300005445 Unclassified 1916
123 Ga0070708_101353230 3300005445 Unclassified 665
124 Ga0070663_100013287 3300005455 Bacteria 5244
125 Ga0070663_100242297 3300005455 Unclassified 1424
126 Ga0070663_101917693 3300005455 Unclassified 532
127 Ga0070678_100286122 3300005456 Bacteria 1396
128 Ga0070678_101774648 3300005456 Unclassified 581
129 Ga0070662_100044456 3300005457 Unclassified 3181
130 Ga0070662_100063247 3300005457 Bacteria 2706
131 Ga0070662_100305503 3300005457 Unclassified 1293
132 Ga0070662_100308070 3300005457 Bacteria 1288
133 Ga0070681_10013048 3300005458 Bacteria 8250
134 Ga0070685_10002918 3300005466 Bacteria 8738
135 Ga0070685_10802485 3300005466 Unclassified 694
136 Ga0070706_100327145 3300005467 Bacteria 1429
137 Ga0070706_101377233 3300005467 Unclassified 646
138 Ga0070707_100016201 3300005468 Bacteria 6995
139 Ga0070707_100036110 3300005468 Bacteria 4715
140 Ga0070707_100081112 3300005468 Bacteria 3132
141 Ga0070707_100081247 3300005468 Bacteria 3129
142 Ga0070707_100514650 3300005468 Unclassified 1159
143 Ga0070707_101517775 3300005468 Unclassified 637
144 Ga0070698_100158672 3300005471 Bacteria 2207
145 Ga0070698_100214221 3300005471 Bacteria 1860
146 Ga0070699_100434140 3300005518 Bacteria 1190
147 Ga0070679_100093263 3300005530 Bacteria 2998
148 Ga0070684_100001068 3300005535 Bacteria 19615
149 Ga0070684_100030455 3300005535 Unclassified 4584
150 Ga0070684_100119508 3300005535 Unclassified 2370
151 Ga0070684_100167662 3300005535 Unclassified 1994
152 Ga0070684_101114757 3300005535 Bacteria 742
153 Ga0070684_101201848 3300005535 Unclassified 713
154 Ga0070697_100087485 3300005536 Unclassified 2573
155 Ga0070697_100209007 3300005536 Bacteria 1661
156 Ga0070697_100214171 3300005536 Bacteria 1641
157 Ga0070697_100231456 3300005536 Bacteria 1576
158 Ga0070686_100016744 3300005544 Bacteria 4270
159 Ga0070686_100064796 3300005544 Unclassified 2372
160 Ga0070686_100532226 3300005544 Unclassified 917
161 Ga0070696_100388431 3300005546 Unclassified 1089
162 Ga0070696_100798236 3300005546 Bacteria 777
163 Ga0070665_100063641 3300005548 Bacteria 3698
164 Ga0070665_100106399 3300005548 Unclassified 2807
165 Ga0070665_100154741 3300005548 Unclassified 2295
166 Ga0070665_100456445 3300005548 Bacteria 1288
167 Ga0070665_101156151 3300005548 Unclassified 785
168 Ga0070704_100005773 3300005549 Bacteria 7240
169 Ga0070704_100075299 3300005549 Bacteria 2465
170 Ga0070704_100759647 3300005549 Unclassified 864
171 Ga0070704_101756264 3300005549 Unclassified 574
172 Ga0070664_100020371 3300005564 Bacteria 5461
173 Ga0070664_100087808 3300005564 Bacteria 2689
174 Ga0068857_101291921 3300005577 Unclassified 708
175 Ga0068854_100161118 3300005578 Unclassified 1737
176 Ga0070702_100031535 3300005615 Bacteria 2901
177 Ga0070702_100332582 3300005615 Bacteria 1063
178 Ga0070702_100420891 3300005615 Bacteria 961
179 Ga0068859_100003179 3300005617 Bacteria 16711
180 Ga0068864_100133619 3300005618 Bacteria 2232
181 Ga0068864_100155285 3300005618 Bacteria 2077
182 Ga0068864_101107380 3300005618 Unclassified 788
183 Ga0068861_100112656 3300005719 Bacteria 2182
184 Ga0068861_100113987 3300005719 Bacteria 2170
185 Ga0068863_100006492 3300005841 Bacteria 11470
186 Ga0068863_100022750 3300005841 Bacteria 5987
187 Ga0068863_100561541 3300005841 Bacteria 1128
188 Ga0068863_101147448 3300005841 Unclassified 782
189 Ga0068863_102307217 3300005841 Unclassified 548
190 Ga0068858_100018257 3300005842 Bacteria 6568
191 Ga0068858_100078061 3300005842 Bacteria 3076
192 Ga0068858_100967154 3300005842 Unclassified 834
193 Ga0068858_102313822 3300005842 Unclassified 531
194 Ga0068860_100014680 3300005843 Bacteria 7662
195 Ga0068860_100142341 3300005843 Bacteria 2306
196 Ga0081455_10000385 3300005937 Bacteria 58366
197 Ga0081455_10003636 3300005937 Bacteria 17668
198 Ga0081455_10014762 3300005937 Bacteria 7623
199 Ga0081455_10040911 3300005937 Bacteria 4084
200 Ga0081455_10066731 3300005937 Bacteria 3003
201 Ga0081455_10090583 3300005937 Unclassified 2479
202 Ga0081455_10171895 3300005937 Bacteria 1650
203 Ga0081455_10804867 3300005937 Bacteria 590
204 Ga0081540_1000016 3300005983 Bacteria 165370
205 Ga0081540_1046218 3300005983 Bacteria 2200
206 Ga0081540_1059247 3300005983 Bacteria 1839
207 Ga0081540_1170080 3300005983 Bacteria 831
208 Ga0081539_10041525 3300005985 Bacteria 2687
209 Ga0081539_10050892 3300005985 Unclassified 2340
210 Ga0081539_10079640 3300005985 Bacteria 1726
211 Ga0070717_10049587 3300006028 Unclassified 3447
212 Ga0070717_10084842 3300006028 Bacteria 2664
213 Ga0070717_10136708 3300006028 Unclassified 2111
214 Ga0070717_10226280 3300006028 Bacteria 1646
215 Ga0070717_10474871 3300006028 Bacteria 1129
216 Ga0070717_10522681 3300006028 Bacteria 1074
217 Ga0070717_11490179 3300006028 Bacteria 614
218 Ga0070715_10014639 3300006163 Bacteria 2908
219 Ga0070715_10119448 3300006163 Unclassified 1255
220 Ga0070715_10500304 3300006163 Unclassified 695
221 Ga0070715_10518214 3300006163 Bacteria 685
222 Ga0070715_10902657 3300006163 Unclassified 544
223 Ga0070716_100044463 3300006173 Unclassified 2488
224 Ga0070716_100081686 3300006173 Bacteria 1931
225 Ga0070716_100101506 3300006173 Unclassified 1765
226 Ga0070716_100130031 3300006173 Unclassified 1590
227 Ga0070716_100331266 3300006173 Unclassified 1070
228 Ga0070716_100536817 3300006173 Unclassified 869
229 Ga0070716_100876634 3300006173 Unclassified 701
230 Ga0070716_101437885 3300006173 Unclassified 562
231 Ga0070712_100047620 3300006175 Bacteria 2968
232 Ga0070712_100083849 3300006175 Bacteria 2315
233 Ga0070712_100169549 3300006175 Bacteria 1692
234 Ga0070712_100328529 3300006175 Bacteria 1245
235 Ga0070712_100510601 3300006175 Unclassified 1009
236 Ga0070712_100632845 3300006175 Unclassified 908
237 Ga0070712_100700552 3300006175 Bacteria 863
238 Ga0070712_100820279 3300006175 Bacteria 799
239 Ga0097621_100498449 3300006237 Unclassified 1103
240 Ga0097621_101059150 3300006237 Unclassified 760
241 Ga0075428_100266735 3300006844 Bacteria 1843
242 Ga0075433_10607679 3300006852 Bacteria 960
243 Ga0075433_11363617 3300006852 Bacteria 614
244 Ga0075434_100283952 3300006871 Bacteria 1675
245 Ga0075434_100361817 3300006871 Unclassified 1472
246 Ga0075434_100806923 3300006871 Bacteria 955
247 Ga0075434_100872883 3300006871 Unclassified 915
248 Ga0068865_100887795 3300006881 Unclassified 774
249 Ga0097620_100003179 3300006931 Bacteria 16711
250 Ga0075435_100509329 3300007076 Unclassified 1041
251 Ga0075435_101261093 3300007076 Unclassified 647
252 Ga0099795_10001863 3300007788 Bacteria 4772
253 Ga0111539_10288426 3300009094 Bacteria 1910
254 Ga0111539_10519572 3300009094 Bacteria 1387
255 Ga0111539_11061875 3300009094 Bacteria 941
256 Ga0111539_12405021 3300009094 Unclassified 611
257 Ga0105245_10035379 3300009098 Unclassified 4432
258 Ga0105245_10149650 3300009098 Bacteria 2206
259 Ga0105245_13179611 3300009098 Unclassified 509
260 Ga0105247_10058472 3300009101 Bacteria 2385
261 Ga0105247_10220000 3300009101 Unclassified 1285
262 Ga0114129_10153841 3300009147 Bacteria 3147
263 Ga0114129_10298064 3300009147 Bacteria 2150
264 Ga0114129_10554124 3300009147 Bacteria 1495
265 Ga0114129_11069975 3300009147 Bacteria 1011
266 Ga0114129_11624880 3300009147 Bacteria 791
267 Ga0114129_13191266 3300009147 Unclassified 533
268 Ga0105243_10323276 3300009148 Unclassified 1407
269 Ga0105243_10459102 3300009148 Unclassified 1197
270 Ga0105243_10689114 3300009148 Bacteria 995
271 Ga0105241_10589972 3300009174 Unclassified 1002
272 Ga0105241_10853188 3300009174 Unclassified 842
273 Ga0105241_11344990 3300009174 Unclassified 682
274 Ga0105242_10049446 3300009176 Unclassified 3422
275 Ga0105242_10118817 3300009176 Bacteria 2265
276 Ga0105242_10227948 3300009176 Unclassified 1668
277 Ga0105242_10427903 3300009176 Unclassified 1242
278 Ga0105242_11595726 3300009176 Unclassified 686
279 Ga0105248_10963202 3300009177 Unclassified 964
280 Ga0105248_12577340 3300009177 Unclassified 580
281 Ga0105237_10037709 3300009545 Bacteria 4884
282 Ga0105237_10736587 3300009545 Bacteria 992
283 Ga0105238_10735765 3300009551 Bacteria 1000
284 Ga0105249_10009902 3300009553 Bacteria 8356
285 Ga0105249_10152041 3300009553 Bacteria 2229
286 Ga0105249_10523304 3300009553 Unclassified 1234
287 Ga0105249_10579227 3300009553 Unclassified 1175
288 Ga0105239_10278342 3300010375 Bacteria 1883
289 Ga0105239_10396351 3300010375 Bacteria 1562
290 Ga0105239_10602140 3300010375 Bacteria 1253
291 Ga0105239_12694296 3300010375 Archaea 580
292 Ga0105239_13544316 3300010375 Unclassified 507
293 Ga0157316_1016730 3300012510 Unclassified 757
294 Ga0157371_10305183 3300013102 Unclassified 1153
295 Ga0157370_10110692 3300013104 Bacteria 2567
296 Ga0157369_10061442 3300013105 Unclassified 4050
297 Ga0157369_10182694 3300013105 Unclassified 2206
298 Ga0157374_10034730 3300013296 Unclassified 4608
299 Ga0157374_10037864 3300013296 Unclassified 4430
300 Ga0157374_10116791 3300013296 Bacteria 2571
301 Ga0157374_10147243 3300013296 Bacteria 2288
302 Ga0157374_10315099 3300013296 Bacteria 1549
303 Ga0157374_10651477 3300013296 Unclassified 1065
304 Ga0157374_10814864 3300013296 Unclassified 950
305 Ga0157374_10821540 3300013296 Unclassified 946
306 Ga0157374_11218279 3300013296 Unclassified 774
307 Ga0157378_10016502 3300013297 Bacteria 6468
308 Ga0157378_10066568 3300013297 Bacteria 3227
309 Ga0157378_10170170 3300013297 Bacteria 2043
310 Ga0157378_10312950 3300013297 Unclassified 1523
311 Ga0157378_10970563 3300013297 Bacteria 883
312 Ga0157378_11694788 3300013297 Bacteria 679
313 Ga0163162_10029195 3300013306 Bacteria 5457
314 Ga0163162_10406113 3300013306 Unclassified 1495
315 Ga0163162_10822327 3300013306 Unclassified 1045
316 Ga0163162_11150276 3300013306 Bacteria 880
317 Ga0163162_12280839 3300013306 Unclassified 622
318 Ga0163162_13104410 3300013306 Unclassified 533
319 Ga0157372_10020989 3300013307 Bacteria 7052
320 Ga0157372_10521021 3300013307 Bacteria 1386
321 Ga0157375_10001548 3300013308 Bacteria 19783
322 Ga0157375_10025775 3300013308 Bacteria 5470
323 Ga0157375_10040734 3300013308 Unclassified 4481
324 Ga0157375_10143205 3300013308 Bacteria 2519
325 Ga0157375_11936233 3300013308 Unclassified 700
326 Ga0157375_12215706 3300013308 Unclassified 655
327 Ga0157375_12648606 3300013308 Bacteria 599
328 Ga0163163_10064253 3300014325 Bacteria 3641
329 Ga0163163_10163317 3300014325 Bacteria 2273
330 Ga0163163_10870492 3300014325 Unclassified 964
331 Ga0163163_10926203 3300014325 Unclassified 935
332 Ga0157377_10179786 3300014745 Unclassified 1329
333 Ga0157377_10238996 3300014745 Bacteria 1172
334 Ga0157377_10269492 3300014745 Bacteria 1111
335 Ga0157377_10365048 3300014745 Unclassified 973
336 Ga0157379_10012044 3300014968 Bacteria 7556
337 Ga0157379_10028693 3300014968 Unclassified 4949
338 Ga0157379_10535404 3300014968 Unclassified 1088
339 Ga0157376_10050363 3300014969 Bacteria 3455
340 Ga0157376_10061899 3300014969 Bacteria 3148
341 Ga0157376_10074374 3300014969 Unclassified 2896
342 Ga0157376_10093726 3300014969 Unclassified 2608
343 Ga0157376_10130559 3300014969 Unclassified 2241
344 Ga0157376_10456766 3300014969 Unclassified 1247
345 Ga0157376_11262548 3300014969 Bacteria 768
346 Ga0182006_1113588 3300015261 Bacteria 948
347 Ga0163161_10860641 3300017792 Unclassified 765
348 Ga0206356_10566114 3300020070 Bacteria 749
349 Ga0207666_1029321 3300025271 Unclassified 838
350 Ga0207666_1042853 3300025271 Bacteria 709
351 Ga0207666_1054998 3300025271 Unclassified 634
352 Ga0207673_1009361 3300025290 Unclassified 1251
353 Ga0207697_10003532 3300025315 Bacteria 7711
354 Ga0207697_10006740 3300025315 Bacteria 5169
355 Ga0207697_10010555 3300025315 Unclassified 3945
356 Ga0207697_10015764 3300025315 Bacteria 3118
357 Ga0207697_10016996 3300025315 Bacteria 2992
358 Ga0207697_10023747 3300025315 Unclassified 2511
359 Ga0207697_10035138 3300025315 Bacteria 2051
360 Ga0207697_10055078 3300025315 Bacteria 1648
361 Ga0207697_10060082 3300025315 Bacteria 1580
362 Ga0207697_10121324 3300025315 Unclassified 1125
363 Ga0207697_10267885 3300025315 Unclassified 756
364 Ga0207653_10336833 3300025885 Unclassified 588
365 Ga0207653_10425421 3300025885 Viruses 521
366 Ga0207692_10070261 3300025898 Bacteria 1842
367 Ga0207692_10176901 3300025898 Unclassified 1241
368 Ga0207692_10324762 3300025898 Unclassified 943
369 Ga0207692_10363097 3300025898 Bacteria 895
370 Ga0207692_10694162 3300025898 Bacteria 660
371 Ga0207642_11049248 3300025899 Unclassified 526
372 Ga0207710_10052701 3300025900 Bacteria 1829
373 Ga0207688_10176821 3300025901 Bacteria 1271
374 Ga0207688_10340326 3300025901 Unclassified 923
375 Ga0207688_10691161 3300025901 Bacteria 645
376 Ga0207680_10266721 3300025903 Unclassified 1186
377 Ga0207680_10544712 3300025903 Unclassified 828
378 Ga0207680_11029385 3300025903 Unclassified 589
379 Ga0207647_10004405 3300025904 Bacteria 10442
380 Ga0207685_10069859 3300025905 Bacteria 1420
381 Ga0207685_10432805 3300025905 Unclassified 681
382 Ga0207699_10382427 3300025906 Bacteria 999
383 Ga0207699_10427696 3300025906 Bacteria 947
384 Ga0207645_10498720 3300025907 Unclassified 824
385 Ga0207645_10742481 3300025907 Unclassified 667
386 Ga0207684_10028772 3300025910 Bacteria 4733
387 Ga0207684_10112191 3300025910 Bacteria 2334
388 Ga0207684_10297886 3300025910 Unclassified 1390
389 Ga0207707_10009207 3300025912 Bacteria 8571
390 Ga0207671_10100422 3300025914 Unclassified 2191
391 Ga0207693_10016156 3300025915 Bacteria 5970
392 Ga0207693_10020481 3300025915 Bacteria 5259
393 Ga0207693_10033176 3300025915 Bacteria 4074
394 Ga0207693_10078439 3300025915 Unclassified 2585
395 Ga0207693_10144822 3300025915 Bacteria 1868
396 Ga0207693_10144888 3300025915 Bacteria 1868
397 Ga0207693_10178691 3300025915 Bacteria 1670
398 Ga0207693_10220110 3300025915 Unclassified 1492
399 Ga0207693_10352091 3300025915 Unclassified 1152
400 Ga0207693_10541598 3300025915 Bacteria 908
401 Ga0207693_10853601 3300025915 Unclassified 700
402 Ga0207663_10068037 3300025916 Unclassified 2286
403 Ga0207663_10078900 3300025916 Bacteria 2148
404 Ga0207663_10311865 3300025916 Bacteria 1179
405 Ga0207663_10775126 3300025916 Unclassified 763
406 Ga0207663_10916627 3300025916 Unclassified 701
407 Ga0207660_10534621 3300025917 Unclassified 953
408 Ga0207662_10014895 3300025918 Bacteria 4368
409 Ga0207657_10136555 3300025919 Bacteria 2006
410 Ga0207657_10270543 3300025919 Unclassified 1351
411 Ga0207657_10536746 3300025919 Unclassified 915
412 Ga0207649_10293546 3300025920 Bacteria 1186
413 Ga0207649_10415991 3300025920 Unclassified 1009
414 Ga0207652_10105901 3300025921 Unclassified 2489
415 Ga0207646_10029498 3300025922 Unclassified 4984
416 Ga0207646_10081724 3300025922 Unclassified 2889
417 Ga0207646_10538668 3300025922 Unclassified 1050
418 Ga0207646_11463863 3300025922 Unclassified 592
419 Ga0207646_11511929 3300025922 Bacteria 581
420 Ga0207681_11091492 3300025923 Unclassified 670
421 Ga0207650_10246672 3300025925 Bacteria 1445
422 Ga0207650_10305138 3300025925 Bacteria 1301
423 Ga0207659_10005881 3300025926 Bacteria 7487
424 Ga0207659_10020462 3300025926 Bacteria 4376
425 Ga0207659_10135733 3300025926 Unclassified 1904
426 Ga0207659_10203035 3300025926 Bacteria 1584
427 Ga0207687_10444339 3300025927 Bacteria 1074
428 Ga0207687_10602735 3300025927 Unclassified 926
429 Ga0207700_10010804 3300025928 Bacteria 5789
430 Ga0207700_10171127 3300025928 Bacteria 1812
431 Ga0207700_10348734 3300025928 Bacteria 1289
432 Ga0207700_10433536 3300025928 Unclassified 1156
433 Ga0207664_10291984 3300025929 Unclassified 1433
434 Ga0207664_10447436 3300025929 Bacteria 1153
435 Ga0207664_10596558 3300025929 Unclassified 992
436 Ga0207664_11009933 3300025929 Unclassified 745
437 Ga0207644_10524469 3300025931 Unclassified 979
438 Ga0207644_10676056 3300025931 Bacteria 860
439 Ga0207690_10004400 3300025932 Bacteria 8317
440 Ga0207690_10397652 3300025932 Unclassified 1098
441 Ga0207690_10401851 3300025932 Unclassified 1093
442 Ga0207690_10918337 3300025932 Bacteria 726
443 Ga0207706_10016988 3300025933 Bacteria 6565
444 Ga0207706_10064529 3300025933 Bacteria 3224
445 Ga0207706_10100812 3300025933 Unclassified 2540
446 Ga0207706_10137473 3300025933 Bacteria 2149
447 Ga0207686_11747477 3300025934 Unclassified 514
448 Ga0207709_10567462 3300025935 Unclassified 895
449 Ga0207709_10887358 3300025935 Unclassified 724
450 Ga0207709_11200280 3300025935 Unclassified 625
451 Ga0207670_10104783 3300025936 Bacteria 2026
452 Ga0207670_10120781 3300025936 Unclassified 1904
453 Ga0207670_10362356 3300025936 Bacteria 1151
454 Ga0207670_10732351 3300025936 Archaea 820
455 Ga0207670_11538963 3300025936 Unclassified 565
456 Ga0207669_10893430 3300025937 Unclassified 742
457 Ga0207669_11595449 3300025937 Unclassified 557
458 Ga0207704_10161570 3300025938 Unclassified 1595
459 Ga0207704_10333853 3300025938 Unclassified 1174
460 Ga0207665_10015418 3300025939 Bacteria 5017
461 Ga0207665_10041014 3300025939 Unclassified 3090
462 Ga0207665_10093165 3300025939 Bacteria 2091
463 Ga0207665_10116751 3300025939 Bacteria 1881
464 Ga0207665_10399468 3300025939 Unclassified 1046
465 Ga0207689_10450584 3300025942 Unclassified 1076
466 Ga0207689_11595692 3300025942 Unclassified 543
467 Ga0207661_10106868 3300025944 Unclassified 2359
468 Ga0207661_11271379 3300025944 Unclassified 676
469 Ga0207661_11705300 3300025944 Unclassified 575
470 Ga0207679_10064848 3300025945 Unclassified 2731
471 Ga0207679_10224654 3300025945 Unclassified 1581
472 Ga0207667_11328807 3300025949 Bacteria 694
473 Ga0207651_10022770 3300025960 Bacteria 3839
474 Ga0207712_10020363 3300025961 Bacteria 4344
475 Ga0207712_10651284 3300025961 Unclassified 915
476 Ga0207712_11320730 3300025961 Unclassified 645
477 Ga0207668_10049861 3300025972 Bacteria 2881
478 Ga0207668_11080830 3300025972 Unclassified 719
479 Ga0207640_10518897 3300025981 Unclassified 995
480 Ga0207640_10962403 3300025981 Unclassified 749
481 Ga0207658_10141124 3300025986 Unclassified 1950
482 Ga0207677_10071270 3300026023 Unclassified 2452
483 Ga0207677_12286347 3300026023 Unclassified 503
484 Ga0207703_10013636 3300026035 Bacteria 6335
485 Ga0207703_10088418 3300026035 Bacteria 2600
486 Ga0207703_10776489 3300026035 Unclassified 914
487 Ga0207678_10004776 3300026067 Bacteria 12161
488 Ga0207678_10573280 3300026067 Unclassified 988
489 Ga0207708_10018830 3300026075 Bacteria 5200
490 Ga0207708_10459956 3300026075 Unclassified 1061
491 Ga0207641_10012208 3300026088 Bacteria 7050
492 Ga0207641_10949616 3300026088 Unclassified 855
493 Ga0207641_11514424 3300026088 Bacteria 672
494 Ga0207676_10218833 3300026095 Bacteria 1694
495 Ga0207676_10991716 3300026095 Unclassified 827
496 Ga0207676_11037319 3300026095 Unclassified 809
497 Ga0207676_11830387 3300026095 Unclassified 606
498 Ga0207675_100155199 3300026118 Bacteria 2181
499 Ga0207675_100804506 3300026118 Unclassified 953
500 Ga0207683_10175732 3300026121 Unclassified 1941
501 Ga0207683_10197105 3300026121 Unclassified 1830
502 Ga0207683_11722571 3300026121 Unclassified 576
503 Ga0209179_1050374 3300027512 Unclassified 892
504 Ga0209974_10107290 3300027876 Bacteria 980
505 Ga0209974_10461053 3300027876 Bacteria 505
506 Ga0268266_10028113 3300028379 Bacteria 4781
507 Ga0268266_10399958 3300028379 Unclassified 1298
508 Ga0268264_10030610 3300028381 Bacteria 4411
509 Ga0268264_11494962 3300028381 Unclassified 686
510 Ga0373928_0127275 3300035084 Bacteria 688
511 Ga0373934_0327272 3300035086 Unclassified 637
512 Ga0373944_0192212 3300035089 Unclassified 736
513 Ga0373936_0403802 3300035113 Unclassified 628
514 Ga0373939_0247853 3300035114 Bacteria 692
515 Ga0373945_0109044 3300035116 Unclassified 1091
516 Ga0373956_0025043 3300035119 Bacteria 2577
517 Ga0373956_0416931 3300035119 Unclassified 641
518 Ga0373956_0440740 3300035119 Unclassified 622
519 Ga0373957_0073023 3300035120 Unclassified 1345
520 Ga0373943_0071366 3300035170 Unclassified 1760
521 Ga0373943_0165411 3300035170 Unclassified 1207
522 Ga0373943_0530174 3300035170 Bacteria 690
523 Ga0373946_0297937 3300035171 Bacteria 797
524 Ga0373946_0608817 3300035171 Unclassified 567
525 Ga0373955_0877162 3300035172 Bacteria 552
526 Ga0373924_0174673 3300035410 Unclassified 945
527 Ga0373935_0079938 3300035692 Bacteria 2123
528 Ga0373935_0500422 3300035692 Unclassified 882
529 Ga0373935_1232592 3300035692 Bacteria 558
530 Ga0373935_1387534 3300035692 Unclassified 525
531 Ga0373927_0481790 3300035695 Bacteria 820
532 Ga0373933_0040369 3300035724 Bacteria 2750
533 Ga0373933_0421529 3300035724 Unclassified 872
534 Ga0373933_1046609 3300035724 Unclassified 538
535 Ga0373947_0017333 3300035725 Bacteria 4143
536 Ga0373937_0387297 3300036401 Unclassified 1326
537 Ga0373937_0793797 3300036401 Bacteria 894
538 Ga0373937_0840844 3300036401 Unclassified 866
539 Ga0373937_0851185 3300036401 Bacteria 860
540 Ga0373925_0439825 3300037068 Unclassified 1067
541 Ga0373925_1239468 3300037068 Bacteria 613
542 Ga0395901_0415695 3300038443 Bacteria 1380
543 Ga0451853_0278490 3300041512 Bacteria 925
544 Ga0439458_0102530 3300042157 Bacteria 744
545 Ga0439464_0078339 3300042439 Unclassified 984
546 Ga0439464_0107422 3300042439 Bacteria 852
547 Ga0495592_0074693 3300046454 Bacteria 2462
548 Ga0495592_0594555 3300046454 Unclassified 675
549 Ga0495603_0220779 3300046455 Bacteria 1094
550 Ga0495603_0454335 3300046455 Unclassified 734
551 Ga0495629_0579437 3300046459 Unclassified 752
552 Ga0495641_0035818 3300046461 Unclassified 2336
553 Ga0495580_0854236 3300046472 Unclassified 587
554 Ga0495582_0095602 3300046473 Viruses 1660
555 Ga0495582_0181888 3300046473 Bacteria 1198
556 Ga0495639_0054143 3300046475 Bacteria 1829
557 Ga0495639_0565160 3300046475 Unclassified 583
558 Ga0495664_0044459 3300046477 Bacteria 2632
559 Ga0495664_0116419 3300046477 Bacteria 1616
560 Ga0495664_0224945 3300046477 Bacteria 1136
561 Ga0495585_0168262 3300046492 Unclassified 1134
562 Ga0495608_0845903 3300046511 Unclassified 538
563 Ga0495618_0109961 3300046514 Unclassified 1765
564 Ga0495628_0033015 3300046516 Unclassified 4174
565 Ga0495630_0006745 3300046517 Bacteria 8183
566 Ga0495630_0181032 3300046517 Bacteria 1607
567 Ga0495630_0624602 3300046517 Unclassified 825
568 Ga0495644_0372330 3300046523 Unclassified 564
569 Ga0495666_0245379 3300046526 Bacteria 817
570 Ga0495652_0085453 3300046529 Bacteria 2592
571 Ga0495652_0288864 3300046529 Unclassified 1197
572 Ga0495665_0437385 3300046531 Unclassified 662
573 Ga0495640_0449850 3300046533 Unclassified 787
574 Ga0495586_0068883 3300046535 Bacteria 1931
575 Ga0495587_0057733 3300046536 Bacteria 2281
576 Ga0495587_0093719 3300046536 Bacteria 1734
577 Ga0495587_0103157 3300046536 Unclassified 1642
578 Ga0495667_0066277 3300046559 Bacteria 2361
579 Ga0495667_0831796 3300046559 Unclassified 568
580 Ga0495667_0911587 3300046559 Bacteria 539
581 Ga0495634_0033262 3300046642 Bacteria 3543
582 Ga0495657_0496932 3300046675 Bacteria 712
583 Ga0495657_0714066 3300046675 Bacteria 576
584 Ga0495599_0023095 3300046678 Bacteria 3886
585 Ga0495599_0025704 3300046678 Bacteria 3687
586 Ga0495623_0033348 3300046679 Bacteria 3304
587 Ga0495646_0014061 3300046680 Bacteria 5089
588 Ga0495646_0137486 3300046680 Bacteria 1369
589 Ga0495647_0358195 3300046681 Unclassified 665
590 Ga0495658_0102679 3300046683 Bacteria 1709
591 Ga0495669_0581869 3300046684 Unclassified 545
592 Ga0495613_0155306 3300046689 Bacteria 1631
593 Ga0495624_0493547 3300046690 Unclassified 733
594 Ga0495600_0568963 3300046809 Unclassified 691
595 Ga0495581_0174594 3300047315 Unclassified 1257
596 Ga0495581_0734868 3300047315 Unclassified 568
597 Ga0495604_0254971 3300047317 Bacteria 1194
598 Ga0495604_0545157 3300047317 Unclassified 748
599 Ga0495604_0665195 3300047317 Unclassified 663
600 Ga0495604_0814068 3300047317 Unclassified 588
601 Ga0495674_0224411 3300047319 Bacteria 1552
602 Ga0495674_0320297 3300047319 Bacteria 1263
603 Ga0495676_0583747 3300047321 Unclassified 729
604 Ga0495680_0167055 3300047322 Bacteria 1595
605 Ga0495675_0127864 3300047444 Bacteria 1580
606 Ga0495684_0023115 3300047471 Bacteria 4781
607 Ga0495684_1086170 3300047471 Unclassified 503
608 Ga0495593_0514643 3300047673 Unclassified 600
609 Ga0495602_0047897 3300048088 Bacteria 3846
610 Ga0495602_0335621 3300048088 Unclassified 1095
611 Ga0495602_0404759 3300048088 Bacteria 972
612 Ga0495614_0176608 3300048089 Unclassified 960
613 Ga0496100_0199727 3300048903 Bacteria 1457
614 Ga0496100_0205201 3300048903 Bacteria 1439
615 Ga0496100_0575234 3300048903 Unclassified 873
616 Ga0496101_0060938 3300048904 Unclassified 2739
617 Ga0496101_1025353 3300048904 Unclassified 649
618 Ga0496102_0031097 3300048905 Bacteria 4785
619 Ga0496102_0255355 3300048905 Unclassified 1653
620 Ga0496102_0643045 3300048905 Bacteria 984
621 Ga0496102_0756227 3300048905 Unclassified 895
622 Ga0496102_1055202 3300048905 Unclassified 733
623 Ga0496103_0330913 3300048906 Bacteria 980
624 Ga0496104_0032542 3300048907 Bacteria 4854
625 Ga0496104_0305361 3300048907 Unclassified 1504
626 Ga0496104_0319377 3300048907 Bacteria 1466
627 Ga0496104_0468423 3300048907 Unclassified 1171
628 Ga0496105_0352942 3300048908 Unclassified 1174
629 Ga0496105_0511145 3300048908 Unclassified 942
630 Ga0496106_0030256 3300048909 Bacteria 4038
631 Ga0496107_0088694 3300048910 Unclassified 2258
632 Ga0496107_0493739 3300048910 Unclassified 908
633 Ga0496107_0494531 3300048910 Bacteria 907
634 Ga0496107_0575116 3300048910 Bacteria 834
635 Ga0496108_0254649 3300048911 Unclassified 1527
636 Ga0496108_0817322 3300048911 Bacteria 803
637 Ga0496108_0978858 3300048911 Unclassified 723
638 Ga0496109_0023921 3300048912 Bacteria 5425
639 Ga0496109_0168958 3300048912 Bacteria 2051
640 Ga0496110_0033252 3300048913 Bacteria 4459
641 Ga0496111_0076616 3300048914 Bacteria 2438
642 Ga0496112_0112225 3300048915 Unclassified 2696
643 Ga0496112_0156317 3300048915 Bacteria 2247
644 Ga0496112_0530678 3300048915 Bacteria 1111
645 Ga0496112_0937251 3300048915 Unclassified 787
646 Ga0496112_1128207 3300048915 Unclassified 702
647 Ga0496113_0013986 3300048916 Bacteria 5460
648 Ga0496113_0544797 3300048916 Unclassified 931
649 Ga0496114_0016154 3300048917 Bacteria 6008
650 Ga0496114_0108854 3300048917 Bacteria 2372
651 Ga0496114_0975899 3300048917 Unclassified 730
652 Ga0496115_0005638 3300048918 Bacteria 9109
653 Ga0496115_0019542 3300048918 Bacteria 5214
654 Ga0496115_0139995 3300048918 Bacteria 1996
655 nmdc:mga05p37_1224377_c1 3300050507 Bacteria 773
656 nmdc:mga05p37_1526559_c1 3300050507 Unclassified 663
657 nmdc:mga05p37_1940392_c1 3300050507 Bacteria 560
658 nmdc:mga05p37_734041_c1 3300050507 Bacteria 1091
659 nmdc:mga05p37_746635_c1 3300050507 Bacteria 1079
660 nmdc:mga08y16_1351193_c1 3300050511 Unclassified 677
661 nmdc:mga0n895_125593_c1 3300050512 Bacteria 2589
662 nmdc:mga0n895_728674_c1 3300050512 Bacteria 986
663 nmdc:mga0n895_742303_c1 3300050512 Bacteria 975
664 nmdc:mga0n895_860344_c1 3300050512 Unclassified 894
665 nmdc:mga0rr50_1785391_c1 3300050513 Unclassified 518
666 nmdc:mga0a205_694348_c1 3300050515 Bacteria 867
667 nmdc:mga0a205_721605_c1 3300050515 Unclassified 846
668 Ga0495601_0030537 3300053077 Bacteria 3346
669 Ga0495601_0093523 3300053077 Bacteria 1936
670 Ga0495612_0022640 3300053078 Unclassified 2518
671 Ga0495612_0518772 3300053078 Unclassified 547
672 Ga0495595_0291104 3300053084 Unclassified 821
673 Ga0495595_0310429 3300053084 Bacteria 794
674 Ga0495619_0384801 3300053085 Unclassified 969
675 Ga0495619_0646066 3300053085 Unclassified 722
676 nmdc:mga08y16_1199923_c1
677 SwRhRL2b_contig_2125715
678 SwRhRL2b_contig_3759661
679 JGI25404J52841_10003778
680 JGI25405J52794_10001820
681 Ga0058862_12430631
682 Ga0065714_10161900
683 Ga0065704_10008450
684 Ga0065704_10014346
685 Ga0065704_10100668
686 Ga0065704_10102223
687 Ga0065704_10258611
688 Ga0065704_10478304
689 Ga0065704_10617543
690 Ga0065704_10779933
691 Ga0065712_10003070
692 Ga0065712_10003383
693 Ga0065712_10115717
694 Ga0065712_10463537
695 Ga0065715_10001406
696 Ga0065715_10003848
697 Ga0065715_10234416
698 Ga0065715_10289624
699 Ga0065715_10519488
700 Ga0065707_10019936
701 Ga0065707_10030012
702 Ga0065707_10053798
703 Ga0065707_10103198
704 Ga0065707_10187492
705 Ga0065707_10430385
706 Ga0065707_10441439
707 Ga0070658_10086760
708 Ga0070658_11476303
709 Ga0070676_10710309
710 Ga0070683_100055269
711 Ga0070683_100098231
712 Ga0070683_100122213
713 Ga0070683_100601624
714 Ga0070690_100075043
715 Ga0070690_100233267
716 Ga0070670_101622342
717 Ga0068869_100096987
718 Ga0070666_10233839
719 Ga0070666_10330324
720 Ga0070666_10718861
721 Ga0070680_100036859
722 Ga0070680_100359782
723 Ga0070682_100039565
724 Ga0068868_100063289
725 Ga0070660_100059340
726 Ga0070660_100388464
727 Ga0070660_100873647
728 Ga0070660_101198750
729 Ga0070689_100012659
730 Ga0070689_100069402
731 Ga0070689_100187621
732 Ga0070689_100775461
733 Ga0070689_101476602
734 Ga0070691_10797306
735 Ga0070687_100056748
736 Ga0070661_100293207
737 Ga0070661_100367430
738 Ga0070661_101222970
739 Ga0070692_10072887
740 Ga0070668_100071754
741 Ga0070668_100961907
742 Ga0070669_101173402
743 Ga0070669_101501255
744 Ga0070669_101731544
745 Ga0070675_100005376
746 Ga0070675_100047008
747 Ga0070675_100075087
748 Ga0070675_100185269
749 Ga0070675_101135083
750 Ga0070671_100104553
751 Ga0070671_100638518
752 Ga0070674_100561987
753 Ga0070674_100577202
754 Ga0070673_100021673
755 Ga0070688_100004900
756 Ga0070688_100026230
757 Ga0070688_100598580
758 Ga0070659_100008343
759 Ga0070659_100083545
760 Ga0070659_100792804
761 Ga0070659_100881723
762 Ga0070659_101657347
763 Ga0070667_100174354
764 Ga0070667_100193287
765 Ga0070667_100480218
766 Ga0070703_10461137
767 Ga0070709_10009604
768 Ga0070709_10544059
769 Ga0070709_10681036
770 Ga0070714_100015874
771 Ga0070714_100295936
772 Ga0070714_100319032
773 Ga0070714_100645387
774 Ga0070714_100892287
775 Ga0070713_100016136
776 Ga0070713_100108925
777 Ga0070713_100294546
778 Ga0070713_100612806
779 Ga0070713_100810362
780 Ga0070713_101803769
781 Ga0070710_10105132
782 Ga0070710_10140203
783 Ga0070710_10268987
784 Ga0070710_10280118
785 Ga0070701_10275177
786 Ga0070701_10339790
787 Ga0070701_10469246
788 Ga0070711_100023042
789 Ga0070711_100043079
790 Ga0070711_100059459
791 Ga0070711_100169987
792 Ga0070711_100610956
793 Ga0070705_100056779
794 Ga0070700_100154739
795 Ga0070700_100208796
796 Ga0070694_100038025
797 Ga0070708_100190928
798 Ga0070708_101353230
799 Ga0070663_100013287
800 Ga0070663_100242297
801 Ga0070663_101917693
802 Ga0070678_100286122
803 Ga0070678_101774648
804 Ga0070662_100044456
805 Ga0070662_100063247
806 Ga0070662_100305503
807 Ga0070662_100308070
808 Ga0070681_10013048
809 Ga0070685_10002918
810 Ga0070685_10802485
811 Ga0070706_100327145
812 Ga0070706_101377233
813 Ga0070707_100016201
814 Ga0070707_100036110
815 Ga0070707_100081112
816 Ga0070707_100081247
817 Ga0070707_100514650
818 Ga0070707_101517775
819 Ga0070698_100158672
820 Ga0070698_100214221
821 Ga0070699_100434140
822 Ga0070679_100093263
823 Ga0070684_100001068
824 Ga0070684_100030455
825 Ga0070684_100119508
826 Ga0070684_100167662
827 Ga0070684_101114757
828 Ga0070684_101201848
829 Ga0070697_100087485
830 Ga0070697_100209007
831 Ga0070697_100214171
832 Ga0070697_100231456
833 Ga0070686_100016744
834 Ga0070686_100064796
835 Ga0070686_100532226
836 Ga0070696_100388431
837 Ga0070696_100798236
838 Ga0070665_100063641
839 Ga0070665_100106399
840 Ga0070665_100154741
841 Ga0070665_100456445
842 Ga0070665_101156151
843 Ga0070704_100005773
844 Ga0070704_100075299
845 Ga0070704_100759647
846 Ga0070704_101756264
847 Ga0070664_100020371
848 Ga0070664_100087808
849 Ga0068857_101291921
850 Ga0068854_100161118
851 Ga0070702_100031535
852 Ga0070702_100332582
853 Ga0070702_100420891
854 Ga0068859_100003179
855 Ga0068864_100133619
856 Ga0068864_100155285
857 Ga0068864_101107380
858 Ga0068861_100112656
859 Ga0068861_100113987
860 Ga0068863_100006492
861 Ga0068863_100022750
862 Ga0068863_100561541
863 Ga0068863_101147448
864 Ga0068863_102307217
865 Ga0068858_100018257
866 Ga0068858_100078061
867 Ga0068858_100967154
868 Ga0068858_102313822
869 Ga0068860_100014680
870 Ga0068860_100142341
871 Ga0081455_10000385
872 Ga0081455_10003636
873 Ga0081455_10014762
874 Ga0081455_10040911
875 Ga0081455_10066731
876 Ga0081455_10090583
877 Ga0081455_10171895
878 Ga0081455_10804867
879 Ga0081540_1000016
880 Ga0081540_1046218
881 Ga0081540_1059247
882 Ga0081540_1170080
883 Ga0081539_10041525
884 Ga0081539_10050892
885 Ga0081539_10079640
886 Ga0070717_10049587
887 Ga0070717_10084842
888 Ga0070717_10136708
889 Ga0070717_10226280
890 Ga0070717_10474871
891 Ga0070717_10522681
892 Ga0070717_11490179
893 Ga0070715_10014639
894 Ga0070715_10119448
895 Ga0070715_10500304
896 Ga0070715_10518214
897 Ga0070715_10902657
898 Ga0070716_100044463
899 Ga0070716_100081686
900 Ga0070716_100101506
901 Ga0070716_100130031
902 Ga0070716_100331266
903 Ga0070716_100536817
904 Ga0070716_100876634
905 Ga0070716_101437885
906 Ga0070712_100047620
907 Ga0070712_100083849
908 Ga0070712_100169549
909 Ga0070712_100328529
910 Ga0070712_100510601
911 Ga0070712_100632845
912 Ga0070712_100700552
913 Ga0070712_100820279
914 Ga0097621_100498449
915 Ga0097621_101059150
916 Ga0075428_100266735
917 Ga0075433_10607679
918 Ga0075433_11363617
919 Ga0075434_100283952
920 Ga0075434_100361817
921 Ga0075434_100806923
922 Ga0075434_100872883
923 Ga0068865_100887795
924 Ga0097620_100003179
925 Ga0075435_100509329
926 Ga0075435_101261093
927 Ga0099795_10001863
928 Ga0111539_10288426
929 Ga0111539_10519572
930 Ga0111539_11061875
931 Ga0111539_12405021
932 Ga0105245_10035379
933 Ga0105245_10149650
934 Ga0105245_13179611
935 Ga0105247_10058472
936 Ga0105247_10220000
937 Ga0114129_10153841
938 Ga0114129_10298064
939 Ga0114129_10554124
940 Ga0114129_11069975
941 Ga0114129_11624880
942 Ga0114129_13191266
943 Ga0105243_10323276
944 Ga0105243_10459102
945 Ga0105243_10689114
946 Ga0105241_10589972
947 Ga0105241_10853188
948 Ga0105241_11344990
949 Ga0105242_10049446
950 Ga0105242_10118817
951 Ga0105242_10227948
952 Ga0105242_10427903
953 Ga0105242_11595726
954 Ga0105248_10963202
955 Ga0105248_12577340
956 Ga0105237_10037709
957 Ga0105237_10736587
958 Ga0105238_10735765
959 Ga0105249_10009902
960 Ga0105249_10152041
961 Ga0105249_10523304
962 Ga0105249_10579227
963 Ga0105239_10278342
964 Ga0105239_10396351
965 Ga0105239_10602140
966 Ga0105239_12694296
967 Ga0105239_13544316
968 Ga0157316_1016730
969 Ga0157371_10305183
970 Ga0157370_10110692
971 Ga0157369_10061442
972 Ga0157369_10182694
973 Ga0157374_10034730
974 Ga0157374_10037864
975 Ga0157374_10116791
976 Ga0157374_10147243
977 Ga0157374_10315099
978 Ga0157374_10651477
979 Ga0157374_10814864
980 Ga0157374_10821540
981 Ga0157374_11218279
982 Ga0157378_10016502
983 Ga0157378_10066568
984 Ga0157378_10170170
985 Ga0157378_10312950
986 Ga0157378_10970563
987 Ga0157378_11694788
988 Ga0163162_10029195
989 Ga0163162_10406113
990 Ga0163162_10822327
991 Ga0163162_11150276
992 Ga0163162_12280839
993 Ga0163162_13104410
994 Ga0157372_10020989
995 Ga0157372_10521021
996 Ga0157375_10001548
997 Ga0157375_10025775
998 Ga0157375_10040734
999 Ga0157375_10143205
1000 Ga0157375_11936233
1001 Ga0157375_12215706
1002 Ga0157375_12648606
1003 Ga0163163_10064253
1004 Ga0163163_10163317
1005 Ga0163163_10870492
1006 Ga0163163_10926203
1007 Ga0157377_10179786
1008 Ga0157377_10238996
1009 Ga0157377_10269492
1010 Ga0157377_10365048
1011 Ga0157379_10012044
1012 Ga0157379_10028693
1013 Ga0157379_10535404
1014 Ga0157376_10050363
1015 Ga0157376_10061899
1016 Ga0157376_10074374
1017 Ga0157376_10093726
1018 Ga0157376_10130559
1019 Ga0157376_10456766
1020 Ga0157376_11262548
1021 Ga0182006_1113588
1022 Ga0163161_10860641
1023 Ga0206356_10566114
1024 Ga0207666_1029321
1025 Ga0207666_1042853
1026 Ga0207666_1054998
1027 Ga0207673_1009361
1028 Ga0207697_10003532
1029 Ga0207697_10006740
1030 Ga0207697_10010555
1031 Ga0207697_10015764
1032 Ga0207697_10016996
1033 Ga0207697_10023747
1034 Ga0207697_10035138
1035 Ga0207697_10055078
1036 Ga0207697_10060082
1037 Ga0207697_10121324
1038 Ga0207697_10267885
1039 Ga0207653_10336833
1040 Ga0207653_10425421
1041 Ga0207692_10070261
1042 Ga0207692_10176901
1043 Ga0207692_10324762
1044 Ga0207692_10363097
1045 Ga0207692_10694162
1046 Ga0207642_11049248
1047 Ga0207710_10052701
1048 Ga0207688_10176821
1049 Ga0207688_10340326
1050 Ga0207688_10691161
1051 Ga0207680_10266721
1052 Ga0207680_10544712
1053 Ga0207680_11029385
1054 Ga0207647_10004405
1055 Ga0207685_10069859
1056 Ga0207685_10432805
1057 Ga0207699_10382427
1058 Ga0207699_10427696
1059 Ga0207645_10498720
1060 Ga0207645_10742481
1061 Ga0207684_10028772
1062 Ga0207684_10112191
1063 Ga0207684_10297886
1064 Ga0207707_10009207
1065 Ga0207671_10100422
1066 Ga0207693_10016156
1067 Ga0207693_10020481
1068 Ga0207693_10033176
1069 Ga0207693_10078439
1070 Ga0207693_10144822
1071 Ga0207693_10144888
1072 Ga0207693_10178691
1073 Ga0207693_10220110
1074 Ga0207693_10352091
1075 Ga0207693_10541598
1076 Ga0207693_10853601
1077 Ga0207663_10068037
1078 Ga0207663_10078900
1079 Ga0207663_10311865
1080 Ga0207663_10775126
1081 Ga0207663_10916627
1082 Ga0207660_10534621
1083 Ga0207662_10014895
1084 Ga0207657_10136555
1085 Ga0207657_10270543
1086 Ga0207657_10536746
1087 Ga0207649_10293546
1088 Ga0207649_10415991
1089 Ga0207652_10105901
1090 Ga0207646_10029498
1091 Ga0207646_10081724
1092 Ga0207646_10538668
1093 Ga0207646_11463863
1094 Ga0207646_11511929
1095 Ga0207681_11091492
1096 Ga0207650_10246672
1097 Ga0207650_10305138
1098 Ga0207659_10005881
1099 Ga0207659_10020462
1100 Ga0207659_10135733
1101 Ga0207659_10203035
1102 Ga0207687_10444339
1103 Ga0207687_10602735
1104 Ga0207700_10010804
1105 Ga0207700_10171127
1106 Ga0207700_10348734
1107 Ga0207700_10433536
1108 Ga0207664_10291984
1109 Ga0207664_10447436
1110 Ga0207664_10596558
1111 Ga0207664_11009933
1112 Ga0207644_10524469
1113 Ga0207644_10676056
1114 Ga0207690_10004400
1115 Ga0207690_10397652
1116 Ga0207690_10401851
1117 Ga0207690_10918337
1118 Ga0207706_10016988
1119 Ga0207706_10064529
1120 Ga0207706_10100812
1121 Ga0207706_10137473
1122 Ga0207686_11747477
1123 Ga0207709_10567462
1124 Ga0207709_10887358
1125 Ga0207709_11200280
1126 Ga0207670_10104783
1127 Ga0207670_10120781
1128 Ga0207670_10362356
1129 Ga0207670_10732351
1130 Ga0207670_11538963
1131 Ga0207669_10893430
1132 Ga0207669_11595449
1133 Ga0207704_10161570
1134 Ga0207704_10333853
1135 Ga0207665_10015418
1136 Ga0207665_10041014
1137 Ga0207665_10093165
1138 Ga0207665_10116751
1139 Ga0207665_10399468
1140 Ga0207689_10450584
1141 Ga0207689_11595692
1142 Ga0207661_10106868
1143 Ga0207661_11271379
1144 Ga0207661_11705300
1145 Ga0207679_10064848
1146 Ga0207679_10224654
1147 Ga0207667_11328807
1148 Ga0207651_10022770
1149 Ga0207712_10020363
1150 Ga0207712_10651284
1151 Ga0207712_11320730
1152 Ga0207668_10049861
1153 Ga0207668_11080830
1154 Ga0207640_10518897
1155 Ga0207640_10962403
1156 Ga0207658_10141124
1157 Ga0207677_10071270
1158 Ga0207677_12286347
1159 Ga0207703_10013636
1160 Ga0207703_10088418
1161 Ga0207703_10776489
1162 Ga0207678_10004776
1163 Ga0207678_10573280
1164 Ga0207708_10018830
1165 Ga0207708_10459956
1166 Ga0207641_10012208
1167 Ga0207641_10949616
1168 Ga0207641_11514424
1169 Ga0207676_10218833
1170 Ga0207676_10991716
1171 Ga0207676_11037319
1172 Ga0207676_11830387
1173 Ga0207675_100155199
1174 Ga0207675_100804506
1175 Ga0207683_10175732
1176 Ga0207683_10197105
1177 Ga0207683_11722571
1178 Ga0209179_1050374
1179 Ga0209974_10107290
1180 Ga0209974_10461053
1181 Ga0268266_10028113
1182 Ga0268266_10399958
1183 Ga0268264_10030610
1184 Ga0268264_11494962
1185 Ga0373928_0127275
1186 Ga0373934_0327272
1187 Ga0373944_0192212
1188 Ga0373936_0403802
1189 Ga0373939_0247853
1190 Ga0373945_0109044
1191 Ga0373956_0025043
1192 Ga0373956_0416931
1193 Ga0373956_0440740
1194 Ga0373957_0073023
1195 Ga0373943_0071366
1196 Ga0373943_0165411
1197 Ga0373943_0530174
1198 Ga0373946_0297937
1199 Ga0373946_0608817
1200 Ga0373955_0877162
1201 Ga0373924_0174673
1202 Ga0373935_0079938
1203 Ga0373935_0500422
1204 Ga0373935_1232592
1205 Ga0373935_1387534
1206 Ga0373927_0481790
1207 Ga0373933_0040369
1208 Ga0373933_0421529
1209 Ga0373933_1046609
1210 Ga0373947_0017333
1211 Ga0373937_0387297
1212 Ga0373937_0793797
1213 Ga0373937_0840844
1214 Ga0373937_0851185
1215 Ga0373925_0439825
1216 Ga0373925_1239468
1217 Ga0395901_0415695
1218 Ga0451853_0278490
1219 Ga0439458_0102530
1220 Ga0439464_0078339
1221 Ga0439464_0107422
1222 Ga0495592_0074693
1223 Ga0495592_0594555
1224 Ga0495603_0220779
1225 Ga0495603_0454335
1226 Ga0495629_0579437
1227 Ga0495641_0035818
1228 Ga0495580_0854236
1229 Ga0495582_0095602
1230 Ga0495582_0181888
1231 Ga0495639_0054143
1232 Ga0495639_0565160
1233 Ga0495664_0044459
1234 Ga0495664_0116419
1235 Ga0495664_0224945
1236 Ga0495585_0168262
1237 Ga0495608_0845903
1238 Ga0495618_0109961
1239 Ga0495628_0033015
1240 Ga0495630_0006745
1241 Ga0495630_0181032
1242 Ga0495630_0624602
1243 Ga0495644_0372330
1244 Ga0495666_0245379
1245 Ga0495652_0085453
1246 Ga0495652_0288864
1247 Ga0495665_0437385
1248 Ga0495640_0449850
1249 Ga0495586_0068883
1250 Ga0495587_0057733
1251 Ga0495587_0093719
1252 Ga0495587_0103157
1253 Ga0495667_0066277
1254 Ga0495667_0831796
1255 Ga0495667_0911587
1256 Ga0495634_0033262
1257 Ga0495657_0496932
1258 Ga0495657_0714066
1259 Ga0495599_0023095
1260 Ga0495599_0025704
1261 Ga0495623_0033348
1262 Ga0495646_0014061
1263 Ga0495646_0137486
1264 Ga0495647_0358195
1265 Ga0495658_0102679
1266 Ga0495669_0581869
1267 Ga0495613_0155306
1268 Ga0495624_0493547
1269 Ga0495600_0568963
1270 Ga0495581_0174594
1271 Ga0495581_0734868
1272 Ga0495604_0254971
1273 Ga0495604_0545157
1274 Ga0495604_0665195
1275 Ga0495604_0814068
1276 Ga0495674_0224411
1277 Ga0495674_0320297
1278 Ga0495676_0583747
1279 Ga0495680_0167055
1280 Ga0495675_0127864
1281 Ga0495684_0023115
1282 Ga0495684_1086170
1283 Ga0495593_0514643
1284 Ga0495602_0047897
1285 Ga0495602_0335621
1286 Ga0495602_0404759
1287 Ga0495614_0176608
1288 Ga0496100_0199727
1289 Ga0496100_0205201
1290 Ga0496100_0575234
1291 Ga0496101_0060938
1292 Ga0496101_1025353
1293 Ga0496102_0031097
1294 Ga0496102_0255355
1295 Ga0496102_0643045
1296 Ga0496102_0756227
1297 Ga0496102_1055202
1298 Ga0496103_0330913
1299 Ga0496104_0032542
1300 Ga0496104_0305361
1301 Ga0496104_0319377
1302 Ga0496104_0468423
1303 Ga0496105_0352942
1304 Ga0496105_0511145
1305 Ga0496106_0030256
1306 Ga0496107_0088694
1307 Ga0496107_0493739
1308 Ga0496107_0494531
1309 Ga0496107_0575116
1310 Ga0496108_0254649
1311 Ga0496108_0817322
1312 Ga0496108_0978858
1313 Ga0496109_0023921
1314 Ga0496109_0168958
1315 Ga0496110_0033252
1316 Ga0496111_0076616
1317 Ga0496112_0112225
1318 Ga0496112_0156317
1319 Ga0496112_0530678
1320 Ga0496112_0937251
1321 Ga0496112_1128207
1322 Ga0496113_0013986
1323 Ga0496113_0544797
1324 Ga0496114_0016154
1325 Ga0496114_0108854
1326 Ga0496114_0975899
1327 Ga0496115_0005638
1328 Ga0496115_0019542
1329 Ga0496115_0139995
1330 nmdc:mga05p37_1224377_c1
1331 nmdc:mga05p37_1526559_c1
1332 nmdc:mga05p37_1940392_c1
1333 nmdc:mga05p37_734041_c1
1334 nmdc:mga05p37_746635_c1
1335 nmdc:mga08y16_1351193_c1
1336 nmdc:mga0n895_125593_c1
1337 nmdc:mga0n895_728674_c1
1338 nmdc:mga0n895_742303_c1
1339 nmdc:mga0n895_860344_c1
1340 nmdc:mga0rr50_1785391_c1
1341 nmdc:mga0a205_694348_c1
1342 nmdc:mga0a205_721605_c1
1343 Ga0495601_0030537
1344 Ga0495601_0093523
1345 Ga0495612_0022640
1346 Ga0495612_0518772
1347 Ga0495595_0291104
1348 Ga0495595_0310429
1349 Ga0495619_0384801
1350 Ga0495619_0646066

MSA Aligner

Family Sequences

Map