F474468
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 675 | 263 | 1350 | 120 |
Family's Representative Sequence
| Representative Sequence | 3300050511|nmdc:mga08y16_1199923_c1|nmdc:mga08y16_1199923_c1_43_480 |
| Length | 145 |
| Sequence | VQRVLRNPFVKGEPTVTYNNQKEDNMKKSITILVCCALLAPLAFAQPESKGKKQAATTAEEITVTGTMLKMTSEEGSAANYQPFKTLVVREDRSNTPGTYVLNGRGHVVNKKGEIIQTAIKPGTRVQIFYANIGDSRVVDHVVVD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 4 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 5 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 6 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 9 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 17 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 21 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 57 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 65 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 66 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 68 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 69 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 70 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 71 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 72 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 73 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 74 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 75 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 76 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 82 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 83 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 84 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 85 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 87 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 88 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Metagenome | Rhizosphere |
| 101 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 114 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 116 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 177 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 178 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 179 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 180 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 181 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 182 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 183 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 184 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 185 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 186 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 187 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 188 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 189 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 190 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 191 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 192 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 193 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 194 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 195 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 196 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 197 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 198 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 241 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 242 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 243 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 244 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 245 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 246 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 247 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 248 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 249 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 250 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 251 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 252 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 253 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 254 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 255 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 256 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 257 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 258 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 259 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 260 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.7 |
| Metatranscriptomes | 0.3 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 6.22 |
| Rhizosphere | 93.63 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 48.3 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | nmdc:mga08y16_1199923_c1 | 3300050511 | Bacteria | 729 |
| 2 | SwRhRL2b_contig_2125715 | 2162886007 | Bacteria | 859 |
| 3 | SwRhRL2b_contig_3759661 | 2162886007 | Bacteria | 1378 |
| 4 | JGI25404J52841_10003778 | 3300003659 | Bacteria | 3021 |
| 5 | JGI25405J52794_10001820 | 3300003911 | Bacteria | 3578 |
| 6 | Ga0058862_12430631 | 3300004803 | Bacteria | 530 |
| 7 | Ga0065714_10161900 | 3300005288 | Bacteria | 1047 |
| 8 | Ga0065704_10008450 | 3300005289 | Unclassified | 2276 |
| 9 | Ga0065704_10014346 | 3300005289 | Bacteria | 2172 |
| 10 | Ga0065704_10100668 | 3300005289 | Bacteria | 2263 |
| 11 | Ga0065704_10102223 | 3300005289 | Bacteria | 2208 |
| 12 | Ga0065704_10258611 | 3300005289 | Bacteria | 971 |
| 13 | Ga0065704_10478304 | 3300005289 | Bacteria | 684 |
| 14 | Ga0065704_10617543 | 3300005289 | Unclassified | 598 |
| 15 | Ga0065704_10779933 | 3300005289 | Unclassified | 532 |
| 16 | Ga0065712_10003070 | 3300005290 | Bacteria | 10088 |
| 17 | Ga0065712_10003383 | 3300005290 | Bacteria | 5339 |
| 18 | Ga0065712_10115717 | 3300005290 | Bacteria | 1745 |
| 19 | Ga0065712_10463537 | 3300005290 | Bacteria | 676 |
| 20 | Ga0065715_10001406 | 3300005293 | Bacteria | 8036 |
| 21 | Ga0065715_10003848 | 3300005293 | Unclassified | 4604 |
| 22 | Ga0065715_10234416 | 3300005293 | Unclassified | 1222 |
| 23 | Ga0065715_10289624 | 3300005293 | Bacteria | 1064 |
| 24 | Ga0065715_10519488 | 3300005293 | Unclassified | 765 |
| 25 | Ga0065707_10019936 | 3300005295 | Bacteria | 2169 |
| 26 | Ga0065707_10030012 | 3300005295 | Bacteria | 908 |
| 27 | Ga0065707_10053798 | 3300005295 | Unclassified | 900 |
| 28 | Ga0065707_10103198 | 3300005295 | Bacteria | 2760 |
| 29 | Ga0065707_10187492 | 3300005295 | Bacteria | 1380 |
| 30 | Ga0065707_10430385 | 3300005295 | Bacteria | 821 |
| 31 | Ga0065707_10441439 | 3300005295 | Bacteria | 796 |
| 32 | Ga0070658_10086760 | 3300005327 | Unclassified | 2575 |
| 33 | Ga0070658_11476303 | 3300005327 | Unclassified | 590 |
| 34 | Ga0070676_10710309 | 3300005328 | Unclassified | 735 |
| 35 | Ga0070683_100055269 | 3300005329 | Bacteria | 3684 |
| 36 | Ga0070683_100098231 | 3300005329 | Unclassified | 2755 |
| 37 | Ga0070683_100122213 | 3300005329 | Bacteria | 2460 |
| 38 | Ga0070683_100601624 | 3300005329 | Unclassified | 1052 |
| 39 | Ga0070690_100075043 | 3300005330 | Unclassified | 2204 |
| 40 | Ga0070690_100233267 | 3300005330 | Unclassified | 1295 |
| 41 | Ga0070670_101622342 | 3300005331 | Unclassified | 595 |
| 42 | Ga0068869_100096987 | 3300005334 | Bacteria | 2226 |
| 43 | Ga0070666_10233839 | 3300005335 | Bacteria | 1298 |
| 44 | Ga0070666_10330324 | 3300005335 | Unclassified | 1089 |
| 45 | Ga0070666_10718861 | 3300005335 | Unclassified | 733 |
| 46 | Ga0070680_100036859 | 3300005336 | Bacteria | 3951 |
| 47 | Ga0070680_100359782 | 3300005336 | Unclassified | 1238 |
| 48 | Ga0070682_100039565 | 3300005337 | Unclassified | 2898 |
| 49 | Ga0068868_100063289 | 3300005338 | Unclassified | 2935 |
| 50 | Ga0070660_100059340 | 3300005339 | Bacteria | 2967 |
| 51 | Ga0070660_100388464 | 3300005339 | Unclassified | 1153 |
| 52 | Ga0070660_100873647 | 3300005339 | Unclassified | 758 |
| 53 | Ga0070660_101198750 | 3300005339 | Unclassified | 644 |
| 54 | Ga0070689_100012659 | 3300005340 | Bacteria | 6084 |
| 55 | Ga0070689_100069402 | 3300005340 | Unclassified | 2749 |
| 56 | Ga0070689_100187621 | 3300005340 | Bacteria | 1682 |
| 57 | Ga0070689_100775461 | 3300005340 | Unclassified | 842 |
| 58 | Ga0070689_101476602 | 3300005340 | Unclassified | 615 |
| 59 | Ga0070691_10797306 | 3300005341 | Unclassified | 575 |
| 60 | Ga0070687_100056748 | 3300005343 | Bacteria | 2050 |
| 61 | Ga0070661_100293207 | 3300005344 | Bacteria | 1265 |
| 62 | Ga0070661_100367430 | 3300005344 | Bacteria | 1132 |
| 63 | Ga0070661_101222970 | 3300005344 | Unclassified | 629 |
| 64 | Ga0070692_10072887 | 3300005345 | Bacteria | 1833 |
| 65 | Ga0070668_100071754 | 3300005347 | Bacteria | 2698 |
| 66 | Ga0070668_100961907 | 3300005347 | Unclassified | 766 |
| 67 | Ga0070669_101173402 | 3300005353 | Unclassified | 663 |
| 68 | Ga0070669_101501255 | 3300005353 | Unclassified | 586 |
| 69 | Ga0070669_101731544 | 3300005353 | Unclassified | 545 |
| 70 | Ga0070675_100005376 | 3300005354 | Bacteria | 9786 |
| 71 | Ga0070675_100047008 | 3300005354 | Bacteria | 3535 |
| 72 | Ga0070675_100075087 | 3300005354 | Bacteria | 2809 |
| 73 | Ga0070675_100185269 | 3300005354 | Bacteria | 1801 |
| 74 | Ga0070675_101135083 | 3300005354 | Bacteria | 719 |
| 75 | Ga0070671_100104553 | 3300005355 | Unclassified | 2376 |
| 76 | Ga0070671_100638518 | 3300005355 | Bacteria | 921 |
| 77 | Ga0070674_100561987 | 3300005356 | Unclassified | 959 |
| 78 | Ga0070674_100577202 | 3300005356 | Unclassified | 947 |
| 79 | Ga0070673_100021673 | 3300005364 | Unclassified | 4665 |
| 80 | Ga0070688_100004900 | 3300005365 | Bacteria | 7003 |
| 81 | Ga0070688_100026230 | 3300005365 | Unclassified | 3460 |
| 82 | Ga0070688_100598580 | 3300005365 | Unclassified | 843 |
| 83 | Ga0070659_100008343 | 3300005366 | Bacteria | 7564 |
| 84 | Ga0070659_100083545 | 3300005366 | Bacteria | 2553 |
| 85 | Ga0070659_100792804 | 3300005366 | Unclassified | 824 |
| 86 | Ga0070659_100881723 | 3300005366 | Unclassified | 781 |
| 87 | Ga0070659_101657347 | 3300005366 | Unclassified | 572 |
| 88 | Ga0070667_100174354 | 3300005367 | Unclassified | 1900 |
| 89 | Ga0070667_100193287 | 3300005367 | Unclassified | 1803 |
| 90 | Ga0070667_100480218 | 3300005367 | Unclassified | 1138 |
| 91 | Ga0070703_10461137 | 3300005406 | Unclassified | 565 |
| 92 | Ga0070709_10009604 | 3300005434 | Bacteria | 5341 |
| 93 | Ga0070709_10544059 | 3300005434 | Bacteria | 888 |
| 94 | Ga0070709_10681036 | 3300005434 | Unclassified | 798 |
| 95 | Ga0070714_100015874 | 3300005435 | Bacteria | 6070 |
| 96 | Ga0070714_100295936 | 3300005435 | Bacteria | 1507 |
| 97 | Ga0070714_100319032 | 3300005435 | Unclassified | 1453 |
| 98 | Ga0070714_100645387 | 3300005435 | Unclassified | 1019 |
| 99 | Ga0070714_100892287 | 3300005435 | Unclassified | 863 |
| 100 | Ga0070713_100016136 | 3300005436 | Bacteria | 5611 |
| 101 | Ga0070713_100108925 | 3300005436 | Bacteria | 2412 |
| 102 | Ga0070713_100294546 | 3300005436 | Bacteria | 1492 |
| 103 | Ga0070713_100612806 | 3300005436 | Bacteria | 1035 |
| 104 | Ga0070713_100810362 | 3300005436 | Unclassified | 898 |
| 105 | Ga0070713_101803769 | 3300005436 | Unclassified | 594 |
| 106 | Ga0070710_10105132 | 3300005437 | Bacteria | 1687 |
| 107 | Ga0070710_10140203 | 3300005437 | Unclassified | 1482 |
| 108 | Ga0070710_10268987 | 3300005437 | Bacteria | 1101 |
| 109 | Ga0070710_10280118 | 3300005437 | Bacteria | 1082 |
| 110 | Ga0070701_10275177 | 3300005438 | Unclassified | 1026 |
| 111 | Ga0070701_10339790 | 3300005438 | Unclassified | 935 |
| 112 | Ga0070701_10469246 | 3300005438 | Bacteria | 811 |
| 113 | Ga0070711_100023042 | 3300005439 | Bacteria | 4044 |
| 114 | Ga0070711_100043079 | 3300005439 | Unclassified | 3055 |
| 115 | Ga0070711_100059459 | 3300005439 | Bacteria | 2653 |
| 116 | Ga0070711_100169987 | 3300005439 | Bacteria | 1661 |
| 117 | Ga0070711_100610956 | 3300005439 | Unclassified | 911 |
| 118 | Ga0070705_100056779 | 3300005440 | Bacteria | 2307 |
| 119 | Ga0070700_100154739 | 3300005441 | Unclassified | 1572 |
| 120 | Ga0070700_100208796 | 3300005441 | Bacteria | 1376 |
| 121 | Ga0070694_100038025 | 3300005444 | Bacteria | 3195 |
| 122 | Ga0070708_100190928 | 3300005445 | Unclassified | 1916 |
| 123 | Ga0070708_101353230 | 3300005445 | Unclassified | 665 |
| 124 | Ga0070663_100013287 | 3300005455 | Bacteria | 5244 |
| 125 | Ga0070663_100242297 | 3300005455 | Unclassified | 1424 |
| 126 | Ga0070663_101917693 | 3300005455 | Unclassified | 532 |
| 127 | Ga0070678_100286122 | 3300005456 | Bacteria | 1396 |
| 128 | Ga0070678_101774648 | 3300005456 | Unclassified | 581 |
| 129 | Ga0070662_100044456 | 3300005457 | Unclassified | 3181 |
| 130 | Ga0070662_100063247 | 3300005457 | Bacteria | 2706 |
| 131 | Ga0070662_100305503 | 3300005457 | Unclassified | 1293 |
| 132 | Ga0070662_100308070 | 3300005457 | Bacteria | 1288 |
| 133 | Ga0070681_10013048 | 3300005458 | Bacteria | 8250 |
| 134 | Ga0070685_10002918 | 3300005466 | Bacteria | 8738 |
| 135 | Ga0070685_10802485 | 3300005466 | Unclassified | 694 |
| 136 | Ga0070706_100327145 | 3300005467 | Bacteria | 1429 |
| 137 | Ga0070706_101377233 | 3300005467 | Unclassified | 646 |
| 138 | Ga0070707_100016201 | 3300005468 | Bacteria | 6995 |
| 139 | Ga0070707_100036110 | 3300005468 | Bacteria | 4715 |
| 140 | Ga0070707_100081112 | 3300005468 | Bacteria | 3132 |
| 141 | Ga0070707_100081247 | 3300005468 | Bacteria | 3129 |
| 142 | Ga0070707_100514650 | 3300005468 | Unclassified | 1159 |
| 143 | Ga0070707_101517775 | 3300005468 | Unclassified | 637 |
| 144 | Ga0070698_100158672 | 3300005471 | Bacteria | 2207 |
| 145 | Ga0070698_100214221 | 3300005471 | Bacteria | 1860 |
| 146 | Ga0070699_100434140 | 3300005518 | Bacteria | 1190 |
| 147 | Ga0070679_100093263 | 3300005530 | Bacteria | 2998 |
| 148 | Ga0070684_100001068 | 3300005535 | Bacteria | 19615 |
| 149 | Ga0070684_100030455 | 3300005535 | Unclassified | 4584 |
| 150 | Ga0070684_100119508 | 3300005535 | Unclassified | 2370 |
| 151 | Ga0070684_100167662 | 3300005535 | Unclassified | 1994 |
| 152 | Ga0070684_101114757 | 3300005535 | Bacteria | 742 |
| 153 | Ga0070684_101201848 | 3300005535 | Unclassified | 713 |
| 154 | Ga0070697_100087485 | 3300005536 | Unclassified | 2573 |
| 155 | Ga0070697_100209007 | 3300005536 | Bacteria | 1661 |
| 156 | Ga0070697_100214171 | 3300005536 | Bacteria | 1641 |
| 157 | Ga0070697_100231456 | 3300005536 | Bacteria | 1576 |
| 158 | Ga0070686_100016744 | 3300005544 | Bacteria | 4270 |
| 159 | Ga0070686_100064796 | 3300005544 | Unclassified | 2372 |
| 160 | Ga0070686_100532226 | 3300005544 | Unclassified | 917 |
| 161 | Ga0070696_100388431 | 3300005546 | Unclassified | 1089 |
| 162 | Ga0070696_100798236 | 3300005546 | Bacteria | 777 |
| 163 | Ga0070665_100063641 | 3300005548 | Bacteria | 3698 |
| 164 | Ga0070665_100106399 | 3300005548 | Unclassified | 2807 |
| 165 | Ga0070665_100154741 | 3300005548 | Unclassified | 2295 |
| 166 | Ga0070665_100456445 | 3300005548 | Bacteria | 1288 |
| 167 | Ga0070665_101156151 | 3300005548 | Unclassified | 785 |
| 168 | Ga0070704_100005773 | 3300005549 | Bacteria | 7240 |
| 169 | Ga0070704_100075299 | 3300005549 | Bacteria | 2465 |
| 170 | Ga0070704_100759647 | 3300005549 | Unclassified | 864 |
| 171 | Ga0070704_101756264 | 3300005549 | Unclassified | 574 |
| 172 | Ga0070664_100020371 | 3300005564 | Bacteria | 5461 |
| 173 | Ga0070664_100087808 | 3300005564 | Bacteria | 2689 |
| 174 | Ga0068857_101291921 | 3300005577 | Unclassified | 708 |
| 175 | Ga0068854_100161118 | 3300005578 | Unclassified | 1737 |
| 176 | Ga0070702_100031535 | 3300005615 | Bacteria | 2901 |
| 177 | Ga0070702_100332582 | 3300005615 | Bacteria | 1063 |
| 178 | Ga0070702_100420891 | 3300005615 | Bacteria | 961 |
| 179 | Ga0068859_100003179 | 3300005617 | Bacteria | 16711 |
| 180 | Ga0068864_100133619 | 3300005618 | Bacteria | 2232 |
| 181 | Ga0068864_100155285 | 3300005618 | Bacteria | 2077 |
| 182 | Ga0068864_101107380 | 3300005618 | Unclassified | 788 |
| 183 | Ga0068861_100112656 | 3300005719 | Bacteria | 2182 |
| 184 | Ga0068861_100113987 | 3300005719 | Bacteria | 2170 |
| 185 | Ga0068863_100006492 | 3300005841 | Bacteria | 11470 |
| 186 | Ga0068863_100022750 | 3300005841 | Bacteria | 5987 |
| 187 | Ga0068863_100561541 | 3300005841 | Bacteria | 1128 |
| 188 | Ga0068863_101147448 | 3300005841 | Unclassified | 782 |
| 189 | Ga0068863_102307217 | 3300005841 | Unclassified | 548 |
| 190 | Ga0068858_100018257 | 3300005842 | Bacteria | 6568 |
| 191 | Ga0068858_100078061 | 3300005842 | Bacteria | 3076 |
| 192 | Ga0068858_100967154 | 3300005842 | Unclassified | 834 |
| 193 | Ga0068858_102313822 | 3300005842 | Unclassified | 531 |
| 194 | Ga0068860_100014680 | 3300005843 | Bacteria | 7662 |
| 195 | Ga0068860_100142341 | 3300005843 | Bacteria | 2306 |
| 196 | Ga0081455_10000385 | 3300005937 | Bacteria | 58366 |
| 197 | Ga0081455_10003636 | 3300005937 | Bacteria | 17668 |
| 198 | Ga0081455_10014762 | 3300005937 | Bacteria | 7623 |
| 199 | Ga0081455_10040911 | 3300005937 | Bacteria | 4084 |
| 200 | Ga0081455_10066731 | 3300005937 | Bacteria | 3003 |
| 201 | Ga0081455_10090583 | 3300005937 | Unclassified | 2479 |
| 202 | Ga0081455_10171895 | 3300005937 | Bacteria | 1650 |
| 203 | Ga0081455_10804867 | 3300005937 | Bacteria | 590 |
| 204 | Ga0081540_1000016 | 3300005983 | Bacteria | 165370 |
| 205 | Ga0081540_1046218 | 3300005983 | Bacteria | 2200 |
| 206 | Ga0081540_1059247 | 3300005983 | Bacteria | 1839 |
| 207 | Ga0081540_1170080 | 3300005983 | Bacteria | 831 |
| 208 | Ga0081539_10041525 | 3300005985 | Bacteria | 2687 |
| 209 | Ga0081539_10050892 | 3300005985 | Unclassified | 2340 |
| 210 | Ga0081539_10079640 | 3300005985 | Bacteria | 1726 |
| 211 | Ga0070717_10049587 | 3300006028 | Unclassified | 3447 |
| 212 | Ga0070717_10084842 | 3300006028 | Bacteria | 2664 |
| 213 | Ga0070717_10136708 | 3300006028 | Unclassified | 2111 |
| 214 | Ga0070717_10226280 | 3300006028 | Bacteria | 1646 |
| 215 | Ga0070717_10474871 | 3300006028 | Bacteria | 1129 |
| 216 | Ga0070717_10522681 | 3300006028 | Bacteria | 1074 |
| 217 | Ga0070717_11490179 | 3300006028 | Bacteria | 614 |
| 218 | Ga0070715_10014639 | 3300006163 | Bacteria | 2908 |
| 219 | Ga0070715_10119448 | 3300006163 | Unclassified | 1255 |
| 220 | Ga0070715_10500304 | 3300006163 | Unclassified | 695 |
| 221 | Ga0070715_10518214 | 3300006163 | Bacteria | 685 |
| 222 | Ga0070715_10902657 | 3300006163 | Unclassified | 544 |
| 223 | Ga0070716_100044463 | 3300006173 | Unclassified | 2488 |
| 224 | Ga0070716_100081686 | 3300006173 | Bacteria | 1931 |
| 225 | Ga0070716_100101506 | 3300006173 | Unclassified | 1765 |
| 226 | Ga0070716_100130031 | 3300006173 | Unclassified | 1590 |
| 227 | Ga0070716_100331266 | 3300006173 | Unclassified | 1070 |
| 228 | Ga0070716_100536817 | 3300006173 | Unclassified | 869 |
| 229 | Ga0070716_100876634 | 3300006173 | Unclassified | 701 |
| 230 | Ga0070716_101437885 | 3300006173 | Unclassified | 562 |
| 231 | Ga0070712_100047620 | 3300006175 | Bacteria | 2968 |
| 232 | Ga0070712_100083849 | 3300006175 | Bacteria | 2315 |
| 233 | Ga0070712_100169549 | 3300006175 | Bacteria | 1692 |
| 234 | Ga0070712_100328529 | 3300006175 | Bacteria | 1245 |
| 235 | Ga0070712_100510601 | 3300006175 | Unclassified | 1009 |
| 236 | Ga0070712_100632845 | 3300006175 | Unclassified | 908 |
| 237 | Ga0070712_100700552 | 3300006175 | Bacteria | 863 |
| 238 | Ga0070712_100820279 | 3300006175 | Bacteria | 799 |
| 239 | Ga0097621_100498449 | 3300006237 | Unclassified | 1103 |
| 240 | Ga0097621_101059150 | 3300006237 | Unclassified | 760 |
| 241 | Ga0075428_100266735 | 3300006844 | Bacteria | 1843 |
| 242 | Ga0075433_10607679 | 3300006852 | Bacteria | 960 |
| 243 | Ga0075433_11363617 | 3300006852 | Bacteria | 614 |
| 244 | Ga0075434_100283952 | 3300006871 | Bacteria | 1675 |
| 245 | Ga0075434_100361817 | 3300006871 | Unclassified | 1472 |
| 246 | Ga0075434_100806923 | 3300006871 | Bacteria | 955 |
| 247 | Ga0075434_100872883 | 3300006871 | Unclassified | 915 |
| 248 | Ga0068865_100887795 | 3300006881 | Unclassified | 774 |
| 249 | Ga0097620_100003179 | 3300006931 | Bacteria | 16711 |
| 250 | Ga0075435_100509329 | 3300007076 | Unclassified | 1041 |
| 251 | Ga0075435_101261093 | 3300007076 | Unclassified | 647 |
| 252 | Ga0099795_10001863 | 3300007788 | Bacteria | 4772 |
| 253 | Ga0111539_10288426 | 3300009094 | Bacteria | 1910 |
| 254 | Ga0111539_10519572 | 3300009094 | Bacteria | 1387 |
| 255 | Ga0111539_11061875 | 3300009094 | Bacteria | 941 |
| 256 | Ga0111539_12405021 | 3300009094 | Unclassified | 611 |
| 257 | Ga0105245_10035379 | 3300009098 | Unclassified | 4432 |
| 258 | Ga0105245_10149650 | 3300009098 | Bacteria | 2206 |
| 259 | Ga0105245_13179611 | 3300009098 | Unclassified | 509 |
| 260 | Ga0105247_10058472 | 3300009101 | Bacteria | 2385 |
| 261 | Ga0105247_10220000 | 3300009101 | Unclassified | 1285 |
| 262 | Ga0114129_10153841 | 3300009147 | Bacteria | 3147 |
| 263 | Ga0114129_10298064 | 3300009147 | Bacteria | 2150 |
| 264 | Ga0114129_10554124 | 3300009147 | Bacteria | 1495 |
| 265 | Ga0114129_11069975 | 3300009147 | Bacteria | 1011 |
| 266 | Ga0114129_11624880 | 3300009147 | Bacteria | 791 |
| 267 | Ga0114129_13191266 | 3300009147 | Unclassified | 533 |
| 268 | Ga0105243_10323276 | 3300009148 | Unclassified | 1407 |
| 269 | Ga0105243_10459102 | 3300009148 | Unclassified | 1197 |
| 270 | Ga0105243_10689114 | 3300009148 | Bacteria | 995 |
| 271 | Ga0105241_10589972 | 3300009174 | Unclassified | 1002 |
| 272 | Ga0105241_10853188 | 3300009174 | Unclassified | 842 |
| 273 | Ga0105241_11344990 | 3300009174 | Unclassified | 682 |
| 274 | Ga0105242_10049446 | 3300009176 | Unclassified | 3422 |
| 275 | Ga0105242_10118817 | 3300009176 | Bacteria | 2265 |
| 276 | Ga0105242_10227948 | 3300009176 | Unclassified | 1668 |
| 277 | Ga0105242_10427903 | 3300009176 | Unclassified | 1242 |
| 278 | Ga0105242_11595726 | 3300009176 | Unclassified | 686 |
| 279 | Ga0105248_10963202 | 3300009177 | Unclassified | 964 |
| 280 | Ga0105248_12577340 | 3300009177 | Unclassified | 580 |
| 281 | Ga0105237_10037709 | 3300009545 | Bacteria | 4884 |
| 282 | Ga0105237_10736587 | 3300009545 | Bacteria | 992 |
| 283 | Ga0105238_10735765 | 3300009551 | Bacteria | 1000 |
| 284 | Ga0105249_10009902 | 3300009553 | Bacteria | 8356 |
| 285 | Ga0105249_10152041 | 3300009553 | Bacteria | 2229 |
| 286 | Ga0105249_10523304 | 3300009553 | Unclassified | 1234 |
| 287 | Ga0105249_10579227 | 3300009553 | Unclassified | 1175 |
| 288 | Ga0105239_10278342 | 3300010375 | Bacteria | 1883 |
| 289 | Ga0105239_10396351 | 3300010375 | Bacteria | 1562 |
| 290 | Ga0105239_10602140 | 3300010375 | Bacteria | 1253 |
| 291 | Ga0105239_12694296 | 3300010375 | Archaea | 580 |
| 292 | Ga0105239_13544316 | 3300010375 | Unclassified | 507 |
| 293 | Ga0157316_1016730 | 3300012510 | Unclassified | 757 |
| 294 | Ga0157371_10305183 | 3300013102 | Unclassified | 1153 |
| 295 | Ga0157370_10110692 | 3300013104 | Bacteria | 2567 |
| 296 | Ga0157369_10061442 | 3300013105 | Unclassified | 4050 |
| 297 | Ga0157369_10182694 | 3300013105 | Unclassified | 2206 |
| 298 | Ga0157374_10034730 | 3300013296 | Unclassified | 4608 |
| 299 | Ga0157374_10037864 | 3300013296 | Unclassified | 4430 |
| 300 | Ga0157374_10116791 | 3300013296 | Bacteria | 2571 |
| 301 | Ga0157374_10147243 | 3300013296 | Bacteria | 2288 |
| 302 | Ga0157374_10315099 | 3300013296 | Bacteria | 1549 |
| 303 | Ga0157374_10651477 | 3300013296 | Unclassified | 1065 |
| 304 | Ga0157374_10814864 | 3300013296 | Unclassified | 950 |
| 305 | Ga0157374_10821540 | 3300013296 | Unclassified | 946 |
| 306 | Ga0157374_11218279 | 3300013296 | Unclassified | 774 |
| 307 | Ga0157378_10016502 | 3300013297 | Bacteria | 6468 |
| 308 | Ga0157378_10066568 | 3300013297 | Bacteria | 3227 |
| 309 | Ga0157378_10170170 | 3300013297 | Bacteria | 2043 |
| 310 | Ga0157378_10312950 | 3300013297 | Unclassified | 1523 |
| 311 | Ga0157378_10970563 | 3300013297 | Bacteria | 883 |
| 312 | Ga0157378_11694788 | 3300013297 | Bacteria | 679 |
| 313 | Ga0163162_10029195 | 3300013306 | Bacteria | 5457 |
| 314 | Ga0163162_10406113 | 3300013306 | Unclassified | 1495 |
| 315 | Ga0163162_10822327 | 3300013306 | Unclassified | 1045 |
| 316 | Ga0163162_11150276 | 3300013306 | Bacteria | 880 |
| 317 | Ga0163162_12280839 | 3300013306 | Unclassified | 622 |
| 318 | Ga0163162_13104410 | 3300013306 | Unclassified | 533 |
| 319 | Ga0157372_10020989 | 3300013307 | Bacteria | 7052 |
| 320 | Ga0157372_10521021 | 3300013307 | Bacteria | 1386 |
| 321 | Ga0157375_10001548 | 3300013308 | Bacteria | 19783 |
| 322 | Ga0157375_10025775 | 3300013308 | Bacteria | 5470 |
| 323 | Ga0157375_10040734 | 3300013308 | Unclassified | 4481 |
| 324 | Ga0157375_10143205 | 3300013308 | Bacteria | 2519 |
| 325 | Ga0157375_11936233 | 3300013308 | Unclassified | 700 |
| 326 | Ga0157375_12215706 | 3300013308 | Unclassified | 655 |
| 327 | Ga0157375_12648606 | 3300013308 | Bacteria | 599 |
| 328 | Ga0163163_10064253 | 3300014325 | Bacteria | 3641 |
| 329 | Ga0163163_10163317 | 3300014325 | Bacteria | 2273 |
| 330 | Ga0163163_10870492 | 3300014325 | Unclassified | 964 |
| 331 | Ga0163163_10926203 | 3300014325 | Unclassified | 935 |
| 332 | Ga0157377_10179786 | 3300014745 | Unclassified | 1329 |
| 333 | Ga0157377_10238996 | 3300014745 | Bacteria | 1172 |
| 334 | Ga0157377_10269492 | 3300014745 | Bacteria | 1111 |
| 335 | Ga0157377_10365048 | 3300014745 | Unclassified | 973 |
| 336 | Ga0157379_10012044 | 3300014968 | Bacteria | 7556 |
| 337 | Ga0157379_10028693 | 3300014968 | Unclassified | 4949 |
| 338 | Ga0157379_10535404 | 3300014968 | Unclassified | 1088 |
| 339 | Ga0157376_10050363 | 3300014969 | Bacteria | 3455 |
| 340 | Ga0157376_10061899 | 3300014969 | Bacteria | 3148 |
| 341 | Ga0157376_10074374 | 3300014969 | Unclassified | 2896 |
| 342 | Ga0157376_10093726 | 3300014969 | Unclassified | 2608 |
| 343 | Ga0157376_10130559 | 3300014969 | Unclassified | 2241 |
| 344 | Ga0157376_10456766 | 3300014969 | Unclassified | 1247 |
| 345 | Ga0157376_11262548 | 3300014969 | Bacteria | 768 |
| 346 | Ga0182006_1113588 | 3300015261 | Bacteria | 948 |
| 347 | Ga0163161_10860641 | 3300017792 | Unclassified | 765 |
| 348 | Ga0206356_10566114 | 3300020070 | Bacteria | 749 |
| 349 | Ga0207666_1029321 | 3300025271 | Unclassified | 838 |
| 350 | Ga0207666_1042853 | 3300025271 | Bacteria | 709 |
| 351 | Ga0207666_1054998 | 3300025271 | Unclassified | 634 |
| 352 | Ga0207673_1009361 | 3300025290 | Unclassified | 1251 |
| 353 | Ga0207697_10003532 | 3300025315 | Bacteria | 7711 |
| 354 | Ga0207697_10006740 | 3300025315 | Bacteria | 5169 |
| 355 | Ga0207697_10010555 | 3300025315 | Unclassified | 3945 |
| 356 | Ga0207697_10015764 | 3300025315 | Bacteria | 3118 |
| 357 | Ga0207697_10016996 | 3300025315 | Bacteria | 2992 |
| 358 | Ga0207697_10023747 | 3300025315 | Unclassified | 2511 |
| 359 | Ga0207697_10035138 | 3300025315 | Bacteria | 2051 |
| 360 | Ga0207697_10055078 | 3300025315 | Bacteria | 1648 |
| 361 | Ga0207697_10060082 | 3300025315 | Bacteria | 1580 |
| 362 | Ga0207697_10121324 | 3300025315 | Unclassified | 1125 |
| 363 | Ga0207697_10267885 | 3300025315 | Unclassified | 756 |
| 364 | Ga0207653_10336833 | 3300025885 | Unclassified | 588 |
| 365 | Ga0207653_10425421 | 3300025885 | Viruses | 521 |
| 366 | Ga0207692_10070261 | 3300025898 | Bacteria | 1842 |
| 367 | Ga0207692_10176901 | 3300025898 | Unclassified | 1241 |
| 368 | Ga0207692_10324762 | 3300025898 | Unclassified | 943 |
| 369 | Ga0207692_10363097 | 3300025898 | Bacteria | 895 |
| 370 | Ga0207692_10694162 | 3300025898 | Bacteria | 660 |
| 371 | Ga0207642_11049248 | 3300025899 | Unclassified | 526 |
| 372 | Ga0207710_10052701 | 3300025900 | Bacteria | 1829 |
| 373 | Ga0207688_10176821 | 3300025901 | Bacteria | 1271 |
| 374 | Ga0207688_10340326 | 3300025901 | Unclassified | 923 |
| 375 | Ga0207688_10691161 | 3300025901 | Bacteria | 645 |
| 376 | Ga0207680_10266721 | 3300025903 | Unclassified | 1186 |
| 377 | Ga0207680_10544712 | 3300025903 | Unclassified | 828 |
| 378 | Ga0207680_11029385 | 3300025903 | Unclassified | 589 |
| 379 | Ga0207647_10004405 | 3300025904 | Bacteria | 10442 |
| 380 | Ga0207685_10069859 | 3300025905 | Bacteria | 1420 |
| 381 | Ga0207685_10432805 | 3300025905 | Unclassified | 681 |
| 382 | Ga0207699_10382427 | 3300025906 | Bacteria | 999 |
| 383 | Ga0207699_10427696 | 3300025906 | Bacteria | 947 |
| 384 | Ga0207645_10498720 | 3300025907 | Unclassified | 824 |
| 385 | Ga0207645_10742481 | 3300025907 | Unclassified | 667 |
| 386 | Ga0207684_10028772 | 3300025910 | Bacteria | 4733 |
| 387 | Ga0207684_10112191 | 3300025910 | Bacteria | 2334 |
| 388 | Ga0207684_10297886 | 3300025910 | Unclassified | 1390 |
| 389 | Ga0207707_10009207 | 3300025912 | Bacteria | 8571 |
| 390 | Ga0207671_10100422 | 3300025914 | Unclassified | 2191 |
| 391 | Ga0207693_10016156 | 3300025915 | Bacteria | 5970 |
| 392 | Ga0207693_10020481 | 3300025915 | Bacteria | 5259 |
| 393 | Ga0207693_10033176 | 3300025915 | Bacteria | 4074 |
| 394 | Ga0207693_10078439 | 3300025915 | Unclassified | 2585 |
| 395 | Ga0207693_10144822 | 3300025915 | Bacteria | 1868 |
| 396 | Ga0207693_10144888 | 3300025915 | Bacteria | 1868 |
| 397 | Ga0207693_10178691 | 3300025915 | Bacteria | 1670 |
| 398 | Ga0207693_10220110 | 3300025915 | Unclassified | 1492 |
| 399 | Ga0207693_10352091 | 3300025915 | Unclassified | 1152 |
| 400 | Ga0207693_10541598 | 3300025915 | Bacteria | 908 |
| 401 | Ga0207693_10853601 | 3300025915 | Unclassified | 700 |
| 402 | Ga0207663_10068037 | 3300025916 | Unclassified | 2286 |
| 403 | Ga0207663_10078900 | 3300025916 | Bacteria | 2148 |
| 404 | Ga0207663_10311865 | 3300025916 | Bacteria | 1179 |
| 405 | Ga0207663_10775126 | 3300025916 | Unclassified | 763 |
| 406 | Ga0207663_10916627 | 3300025916 | Unclassified | 701 |
| 407 | Ga0207660_10534621 | 3300025917 | Unclassified | 953 |
| 408 | Ga0207662_10014895 | 3300025918 | Bacteria | 4368 |
| 409 | Ga0207657_10136555 | 3300025919 | Bacteria | 2006 |
| 410 | Ga0207657_10270543 | 3300025919 | Unclassified | 1351 |
| 411 | Ga0207657_10536746 | 3300025919 | Unclassified | 915 |
| 412 | Ga0207649_10293546 | 3300025920 | Bacteria | 1186 |
| 413 | Ga0207649_10415991 | 3300025920 | Unclassified | 1009 |
| 414 | Ga0207652_10105901 | 3300025921 | Unclassified | 2489 |
| 415 | Ga0207646_10029498 | 3300025922 | Unclassified | 4984 |
| 416 | Ga0207646_10081724 | 3300025922 | Unclassified | 2889 |
| 417 | Ga0207646_10538668 | 3300025922 | Unclassified | 1050 |
| 418 | Ga0207646_11463863 | 3300025922 | Unclassified | 592 |
| 419 | Ga0207646_11511929 | 3300025922 | Bacteria | 581 |
| 420 | Ga0207681_11091492 | 3300025923 | Unclassified | 670 |
| 421 | Ga0207650_10246672 | 3300025925 | Bacteria | 1445 |
| 422 | Ga0207650_10305138 | 3300025925 | Bacteria | 1301 |
| 423 | Ga0207659_10005881 | 3300025926 | Bacteria | 7487 |
| 424 | Ga0207659_10020462 | 3300025926 | Bacteria | 4376 |
| 425 | Ga0207659_10135733 | 3300025926 | Unclassified | 1904 |
| 426 | Ga0207659_10203035 | 3300025926 | Bacteria | 1584 |
| 427 | Ga0207687_10444339 | 3300025927 | Bacteria | 1074 |
| 428 | Ga0207687_10602735 | 3300025927 | Unclassified | 926 |
| 429 | Ga0207700_10010804 | 3300025928 | Bacteria | 5789 |
| 430 | Ga0207700_10171127 | 3300025928 | Bacteria | 1812 |
| 431 | Ga0207700_10348734 | 3300025928 | Bacteria | 1289 |
| 432 | Ga0207700_10433536 | 3300025928 | Unclassified | 1156 |
| 433 | Ga0207664_10291984 | 3300025929 | Unclassified | 1433 |
| 434 | Ga0207664_10447436 | 3300025929 | Bacteria | 1153 |
| 435 | Ga0207664_10596558 | 3300025929 | Unclassified | 992 |
| 436 | Ga0207664_11009933 | 3300025929 | Unclassified | 745 |
| 437 | Ga0207644_10524469 | 3300025931 | Unclassified | 979 |
| 438 | Ga0207644_10676056 | 3300025931 | Bacteria | 860 |
| 439 | Ga0207690_10004400 | 3300025932 | Bacteria | 8317 |
| 440 | Ga0207690_10397652 | 3300025932 | Unclassified | 1098 |
| 441 | Ga0207690_10401851 | 3300025932 | Unclassified | 1093 |
| 442 | Ga0207690_10918337 | 3300025932 | Bacteria | 726 |
| 443 | Ga0207706_10016988 | 3300025933 | Bacteria | 6565 |
| 444 | Ga0207706_10064529 | 3300025933 | Bacteria | 3224 |
| 445 | Ga0207706_10100812 | 3300025933 | Unclassified | 2540 |
| 446 | Ga0207706_10137473 | 3300025933 | Bacteria | 2149 |
| 447 | Ga0207686_11747477 | 3300025934 | Unclassified | 514 |
| 448 | Ga0207709_10567462 | 3300025935 | Unclassified | 895 |
| 449 | Ga0207709_10887358 | 3300025935 | Unclassified | 724 |
| 450 | Ga0207709_11200280 | 3300025935 | Unclassified | 625 |
| 451 | Ga0207670_10104783 | 3300025936 | Bacteria | 2026 |
| 452 | Ga0207670_10120781 | 3300025936 | Unclassified | 1904 |
| 453 | Ga0207670_10362356 | 3300025936 | Bacteria | 1151 |
| 454 | Ga0207670_10732351 | 3300025936 | Archaea | 820 |
| 455 | Ga0207670_11538963 | 3300025936 | Unclassified | 565 |
| 456 | Ga0207669_10893430 | 3300025937 | Unclassified | 742 |
| 457 | Ga0207669_11595449 | 3300025937 | Unclassified | 557 |
| 458 | Ga0207704_10161570 | 3300025938 | Unclassified | 1595 |
| 459 | Ga0207704_10333853 | 3300025938 | Unclassified | 1174 |
| 460 | Ga0207665_10015418 | 3300025939 | Bacteria | 5017 |
| 461 | Ga0207665_10041014 | 3300025939 | Unclassified | 3090 |
| 462 | Ga0207665_10093165 | 3300025939 | Bacteria | 2091 |
| 463 | Ga0207665_10116751 | 3300025939 | Bacteria | 1881 |
| 464 | Ga0207665_10399468 | 3300025939 | Unclassified | 1046 |
| 465 | Ga0207689_10450584 | 3300025942 | Unclassified | 1076 |
| 466 | Ga0207689_11595692 | 3300025942 | Unclassified | 543 |
| 467 | Ga0207661_10106868 | 3300025944 | Unclassified | 2359 |
| 468 | Ga0207661_11271379 | 3300025944 | Unclassified | 676 |
| 469 | Ga0207661_11705300 | 3300025944 | Unclassified | 575 |
| 470 | Ga0207679_10064848 | 3300025945 | Unclassified | 2731 |
| 471 | Ga0207679_10224654 | 3300025945 | Unclassified | 1581 |
| 472 | Ga0207667_11328807 | 3300025949 | Bacteria | 694 |
| 473 | Ga0207651_10022770 | 3300025960 | Bacteria | 3839 |
| 474 | Ga0207712_10020363 | 3300025961 | Bacteria | 4344 |
| 475 | Ga0207712_10651284 | 3300025961 | Unclassified | 915 |
| 476 | Ga0207712_11320730 | 3300025961 | Unclassified | 645 |
| 477 | Ga0207668_10049861 | 3300025972 | Bacteria | 2881 |
| 478 | Ga0207668_11080830 | 3300025972 | Unclassified | 719 |
| 479 | Ga0207640_10518897 | 3300025981 | Unclassified | 995 |
| 480 | Ga0207640_10962403 | 3300025981 | Unclassified | 749 |
| 481 | Ga0207658_10141124 | 3300025986 | Unclassified | 1950 |
| 482 | Ga0207677_10071270 | 3300026023 | Unclassified | 2452 |
| 483 | Ga0207677_12286347 | 3300026023 | Unclassified | 503 |
| 484 | Ga0207703_10013636 | 3300026035 | Bacteria | 6335 |
| 485 | Ga0207703_10088418 | 3300026035 | Bacteria | 2600 |
| 486 | Ga0207703_10776489 | 3300026035 | Unclassified | 914 |
| 487 | Ga0207678_10004776 | 3300026067 | Bacteria | 12161 |
| 488 | Ga0207678_10573280 | 3300026067 | Unclassified | 988 |
| 489 | Ga0207708_10018830 | 3300026075 | Bacteria | 5200 |
| 490 | Ga0207708_10459956 | 3300026075 | Unclassified | 1061 |
| 491 | Ga0207641_10012208 | 3300026088 | Bacteria | 7050 |
| 492 | Ga0207641_10949616 | 3300026088 | Unclassified | 855 |
| 493 | Ga0207641_11514424 | 3300026088 | Bacteria | 672 |
| 494 | Ga0207676_10218833 | 3300026095 | Bacteria | 1694 |
| 495 | Ga0207676_10991716 | 3300026095 | Unclassified | 827 |
| 496 | Ga0207676_11037319 | 3300026095 | Unclassified | 809 |
| 497 | Ga0207676_11830387 | 3300026095 | Unclassified | 606 |
| 498 | Ga0207675_100155199 | 3300026118 | Bacteria | 2181 |
| 499 | Ga0207675_100804506 | 3300026118 | Unclassified | 953 |
| 500 | Ga0207683_10175732 | 3300026121 | Unclassified | 1941 |
| 501 | Ga0207683_10197105 | 3300026121 | Unclassified | 1830 |
| 502 | Ga0207683_11722571 | 3300026121 | Unclassified | 576 |
| 503 | Ga0209179_1050374 | 3300027512 | Unclassified | 892 |
| 504 | Ga0209974_10107290 | 3300027876 | Bacteria | 980 |
| 505 | Ga0209974_10461053 | 3300027876 | Bacteria | 505 |
| 506 | Ga0268266_10028113 | 3300028379 | Bacteria | 4781 |
| 507 | Ga0268266_10399958 | 3300028379 | Unclassified | 1298 |
| 508 | Ga0268264_10030610 | 3300028381 | Bacteria | 4411 |
| 509 | Ga0268264_11494962 | 3300028381 | Unclassified | 686 |
| 510 | Ga0373928_0127275 | 3300035084 | Bacteria | 688 |
| 511 | Ga0373934_0327272 | 3300035086 | Unclassified | 637 |
| 512 | Ga0373944_0192212 | 3300035089 | Unclassified | 736 |
| 513 | Ga0373936_0403802 | 3300035113 | Unclassified | 628 |
| 514 | Ga0373939_0247853 | 3300035114 | Bacteria | 692 |
| 515 | Ga0373945_0109044 | 3300035116 | Unclassified | 1091 |
| 516 | Ga0373956_0025043 | 3300035119 | Bacteria | 2577 |
| 517 | Ga0373956_0416931 | 3300035119 | Unclassified | 641 |
| 518 | Ga0373956_0440740 | 3300035119 | Unclassified | 622 |
| 519 | Ga0373957_0073023 | 3300035120 | Unclassified | 1345 |
| 520 | Ga0373943_0071366 | 3300035170 | Unclassified | 1760 |
| 521 | Ga0373943_0165411 | 3300035170 | Unclassified | 1207 |
| 522 | Ga0373943_0530174 | 3300035170 | Bacteria | 690 |
| 523 | Ga0373946_0297937 | 3300035171 | Bacteria | 797 |
| 524 | Ga0373946_0608817 | 3300035171 | Unclassified | 567 |
| 525 | Ga0373955_0877162 | 3300035172 | Bacteria | 552 |
| 526 | Ga0373924_0174673 | 3300035410 | Unclassified | 945 |
| 527 | Ga0373935_0079938 | 3300035692 | Bacteria | 2123 |
| 528 | Ga0373935_0500422 | 3300035692 | Unclassified | 882 |
| 529 | Ga0373935_1232592 | 3300035692 | Bacteria | 558 |
| 530 | Ga0373935_1387534 | 3300035692 | Unclassified | 525 |
| 531 | Ga0373927_0481790 | 3300035695 | Bacteria | 820 |
| 532 | Ga0373933_0040369 | 3300035724 | Bacteria | 2750 |
| 533 | Ga0373933_0421529 | 3300035724 | Unclassified | 872 |
| 534 | Ga0373933_1046609 | 3300035724 | Unclassified | 538 |
| 535 | Ga0373947_0017333 | 3300035725 | Bacteria | 4143 |
| 536 | Ga0373937_0387297 | 3300036401 | Unclassified | 1326 |
| 537 | Ga0373937_0793797 | 3300036401 | Bacteria | 894 |
| 538 | Ga0373937_0840844 | 3300036401 | Unclassified | 866 |
| 539 | Ga0373937_0851185 | 3300036401 | Bacteria | 860 |
| 540 | Ga0373925_0439825 | 3300037068 | Unclassified | 1067 |
| 541 | Ga0373925_1239468 | 3300037068 | Bacteria | 613 |
| 542 | Ga0395901_0415695 | 3300038443 | Bacteria | 1380 |
| 543 | Ga0451853_0278490 | 3300041512 | Bacteria | 925 |
| 544 | Ga0439458_0102530 | 3300042157 | Bacteria | 744 |
| 545 | Ga0439464_0078339 | 3300042439 | Unclassified | 984 |
| 546 | Ga0439464_0107422 | 3300042439 | Bacteria | 852 |
| 547 | Ga0495592_0074693 | 3300046454 | Bacteria | 2462 |
| 548 | Ga0495592_0594555 | 3300046454 | Unclassified | 675 |
| 549 | Ga0495603_0220779 | 3300046455 | Bacteria | 1094 |
| 550 | Ga0495603_0454335 | 3300046455 | Unclassified | 734 |
| 551 | Ga0495629_0579437 | 3300046459 | Unclassified | 752 |
| 552 | Ga0495641_0035818 | 3300046461 | Unclassified | 2336 |
| 553 | Ga0495580_0854236 | 3300046472 | Unclassified | 587 |
| 554 | Ga0495582_0095602 | 3300046473 | Viruses | 1660 |
| 555 | Ga0495582_0181888 | 3300046473 | Bacteria | 1198 |
| 556 | Ga0495639_0054143 | 3300046475 | Bacteria | 1829 |
| 557 | Ga0495639_0565160 | 3300046475 | Unclassified | 583 |
| 558 | Ga0495664_0044459 | 3300046477 | Bacteria | 2632 |
| 559 | Ga0495664_0116419 | 3300046477 | Bacteria | 1616 |
| 560 | Ga0495664_0224945 | 3300046477 | Bacteria | 1136 |
| 561 | Ga0495585_0168262 | 3300046492 | Unclassified | 1134 |
| 562 | Ga0495608_0845903 | 3300046511 | Unclassified | 538 |
| 563 | Ga0495618_0109961 | 3300046514 | Unclassified | 1765 |
| 564 | Ga0495628_0033015 | 3300046516 | Unclassified | 4174 |
| 565 | Ga0495630_0006745 | 3300046517 | Bacteria | 8183 |
| 566 | Ga0495630_0181032 | 3300046517 | Bacteria | 1607 |
| 567 | Ga0495630_0624602 | 3300046517 | Unclassified | 825 |
| 568 | Ga0495644_0372330 | 3300046523 | Unclassified | 564 |
| 569 | Ga0495666_0245379 | 3300046526 | Bacteria | 817 |
| 570 | Ga0495652_0085453 | 3300046529 | Bacteria | 2592 |
| 571 | Ga0495652_0288864 | 3300046529 | Unclassified | 1197 |
| 572 | Ga0495665_0437385 | 3300046531 | Unclassified | 662 |
| 573 | Ga0495640_0449850 | 3300046533 | Unclassified | 787 |
| 574 | Ga0495586_0068883 | 3300046535 | Bacteria | 1931 |
| 575 | Ga0495587_0057733 | 3300046536 | Bacteria | 2281 |
| 576 | Ga0495587_0093719 | 3300046536 | Bacteria | 1734 |
| 577 | Ga0495587_0103157 | 3300046536 | Unclassified | 1642 |
| 578 | Ga0495667_0066277 | 3300046559 | Bacteria | 2361 |
| 579 | Ga0495667_0831796 | 3300046559 | Unclassified | 568 |
| 580 | Ga0495667_0911587 | 3300046559 | Bacteria | 539 |
| 581 | Ga0495634_0033262 | 3300046642 | Bacteria | 3543 |
| 582 | Ga0495657_0496932 | 3300046675 | Bacteria | 712 |
| 583 | Ga0495657_0714066 | 3300046675 | Bacteria | 576 |
| 584 | Ga0495599_0023095 | 3300046678 | Bacteria | 3886 |
| 585 | Ga0495599_0025704 | 3300046678 | Bacteria | 3687 |
| 586 | Ga0495623_0033348 | 3300046679 | Bacteria | 3304 |
| 587 | Ga0495646_0014061 | 3300046680 | Bacteria | 5089 |
| 588 | Ga0495646_0137486 | 3300046680 | Bacteria | 1369 |
| 589 | Ga0495647_0358195 | 3300046681 | Unclassified | 665 |
| 590 | Ga0495658_0102679 | 3300046683 | Bacteria | 1709 |
| 591 | Ga0495669_0581869 | 3300046684 | Unclassified | 545 |
| 592 | Ga0495613_0155306 | 3300046689 | Bacteria | 1631 |
| 593 | Ga0495624_0493547 | 3300046690 | Unclassified | 733 |
| 594 | Ga0495600_0568963 | 3300046809 | Unclassified | 691 |
| 595 | Ga0495581_0174594 | 3300047315 | Unclassified | 1257 |
| 596 | Ga0495581_0734868 | 3300047315 | Unclassified | 568 |
| 597 | Ga0495604_0254971 | 3300047317 | Bacteria | 1194 |
| 598 | Ga0495604_0545157 | 3300047317 | Unclassified | 748 |
| 599 | Ga0495604_0665195 | 3300047317 | Unclassified | 663 |
| 600 | Ga0495604_0814068 | 3300047317 | Unclassified | 588 |
| 601 | Ga0495674_0224411 | 3300047319 | Bacteria | 1552 |
| 602 | Ga0495674_0320297 | 3300047319 | Bacteria | 1263 |
| 603 | Ga0495676_0583747 | 3300047321 | Unclassified | 729 |
| 604 | Ga0495680_0167055 | 3300047322 | Bacteria | 1595 |
| 605 | Ga0495675_0127864 | 3300047444 | Bacteria | 1580 |
| 606 | Ga0495684_0023115 | 3300047471 | Bacteria | 4781 |
| 607 | Ga0495684_1086170 | 3300047471 | Unclassified | 503 |
| 608 | Ga0495593_0514643 | 3300047673 | Unclassified | 600 |
| 609 | Ga0495602_0047897 | 3300048088 | Bacteria | 3846 |
| 610 | Ga0495602_0335621 | 3300048088 | Unclassified | 1095 |
| 611 | Ga0495602_0404759 | 3300048088 | Bacteria | 972 |
| 612 | Ga0495614_0176608 | 3300048089 | Unclassified | 960 |
| 613 | Ga0496100_0199727 | 3300048903 | Bacteria | 1457 |
| 614 | Ga0496100_0205201 | 3300048903 | Bacteria | 1439 |
| 615 | Ga0496100_0575234 | 3300048903 | Unclassified | 873 |
| 616 | Ga0496101_0060938 | 3300048904 | Unclassified | 2739 |
| 617 | Ga0496101_1025353 | 3300048904 | Unclassified | 649 |
| 618 | Ga0496102_0031097 | 3300048905 | Bacteria | 4785 |
| 619 | Ga0496102_0255355 | 3300048905 | Unclassified | 1653 |
| 620 | Ga0496102_0643045 | 3300048905 | Bacteria | 984 |
| 621 | Ga0496102_0756227 | 3300048905 | Unclassified | 895 |
| 622 | Ga0496102_1055202 | 3300048905 | Unclassified | 733 |
| 623 | Ga0496103_0330913 | 3300048906 | Bacteria | 980 |
| 624 | Ga0496104_0032542 | 3300048907 | Bacteria | 4854 |
| 625 | Ga0496104_0305361 | 3300048907 | Unclassified | 1504 |
| 626 | Ga0496104_0319377 | 3300048907 | Bacteria | 1466 |
| 627 | Ga0496104_0468423 | 3300048907 | Unclassified | 1171 |
| 628 | Ga0496105_0352942 | 3300048908 | Unclassified | 1174 |
| 629 | Ga0496105_0511145 | 3300048908 | Unclassified | 942 |
| 630 | Ga0496106_0030256 | 3300048909 | Bacteria | 4038 |
| 631 | Ga0496107_0088694 | 3300048910 | Unclassified | 2258 |
| 632 | Ga0496107_0493739 | 3300048910 | Unclassified | 908 |
| 633 | Ga0496107_0494531 | 3300048910 | Bacteria | 907 |
| 634 | Ga0496107_0575116 | 3300048910 | Bacteria | 834 |
| 635 | Ga0496108_0254649 | 3300048911 | Unclassified | 1527 |
| 636 | Ga0496108_0817322 | 3300048911 | Bacteria | 803 |
| 637 | Ga0496108_0978858 | 3300048911 | Unclassified | 723 |
| 638 | Ga0496109_0023921 | 3300048912 | Bacteria | 5425 |
| 639 | Ga0496109_0168958 | 3300048912 | Bacteria | 2051 |
| 640 | Ga0496110_0033252 | 3300048913 | Bacteria | 4459 |
| 641 | Ga0496111_0076616 | 3300048914 | Bacteria | 2438 |
| 642 | Ga0496112_0112225 | 3300048915 | Unclassified | 2696 |
| 643 | Ga0496112_0156317 | 3300048915 | Bacteria | 2247 |
| 644 | Ga0496112_0530678 | 3300048915 | Bacteria | 1111 |
| 645 | Ga0496112_0937251 | 3300048915 | Unclassified | 787 |
| 646 | Ga0496112_1128207 | 3300048915 | Unclassified | 702 |
| 647 | Ga0496113_0013986 | 3300048916 | Bacteria | 5460 |
| 648 | Ga0496113_0544797 | 3300048916 | Unclassified | 931 |
| 649 | Ga0496114_0016154 | 3300048917 | Bacteria | 6008 |
| 650 | Ga0496114_0108854 | 3300048917 | Bacteria | 2372 |
| 651 | Ga0496114_0975899 | 3300048917 | Unclassified | 730 |
| 652 | Ga0496115_0005638 | 3300048918 | Bacteria | 9109 |
| 653 | Ga0496115_0019542 | 3300048918 | Bacteria | 5214 |
| 654 | Ga0496115_0139995 | 3300048918 | Bacteria | 1996 |
| 655 | nmdc:mga05p37_1224377_c1 | 3300050507 | Bacteria | 773 |
| 656 | nmdc:mga05p37_1526559_c1 | 3300050507 | Unclassified | 663 |
| 657 | nmdc:mga05p37_1940392_c1 | 3300050507 | Bacteria | 560 |
| 658 | nmdc:mga05p37_734041_c1 | 3300050507 | Bacteria | 1091 |
| 659 | nmdc:mga05p37_746635_c1 | 3300050507 | Bacteria | 1079 |
| 660 | nmdc:mga08y16_1351193_c1 | 3300050511 | Unclassified | 677 |
| 661 | nmdc:mga0n895_125593_c1 | 3300050512 | Bacteria | 2589 |
| 662 | nmdc:mga0n895_728674_c1 | 3300050512 | Bacteria | 986 |
| 663 | nmdc:mga0n895_742303_c1 | 3300050512 | Bacteria | 975 |
| 664 | nmdc:mga0n895_860344_c1 | 3300050512 | Unclassified | 894 |
| 665 | nmdc:mga0rr50_1785391_c1 | 3300050513 | Unclassified | 518 |
| 666 | nmdc:mga0a205_694348_c1 | 3300050515 | Bacteria | 867 |
| 667 | nmdc:mga0a205_721605_c1 | 3300050515 | Unclassified | 846 |
| 668 | Ga0495601_0030537 | 3300053077 | Bacteria | 3346 |
| 669 | Ga0495601_0093523 | 3300053077 | Bacteria | 1936 |
| 670 | Ga0495612_0022640 | 3300053078 | Unclassified | 2518 |
| 671 | Ga0495612_0518772 | 3300053078 | Unclassified | 547 |
| 672 | Ga0495595_0291104 | 3300053084 | Unclassified | 821 |
| 673 | Ga0495595_0310429 | 3300053084 | Bacteria | 794 |
| 674 | Ga0495619_0384801 | 3300053085 | Unclassified | 969 |
| 675 | Ga0495619_0646066 | 3300053085 | Unclassified | 722 |
| 676 | nmdc:mga08y16_1199923_c1 | |||
| 677 | SwRhRL2b_contig_2125715 | |||
| 678 | SwRhRL2b_contig_3759661 | |||
| 679 | JGI25404J52841_10003778 | |||
| 680 | JGI25405J52794_10001820 | |||
| 681 | Ga0058862_12430631 | |||
| 682 | Ga0065714_10161900 | |||
| 683 | Ga0065704_10008450 | |||
| 684 | Ga0065704_10014346 | |||
| 685 | Ga0065704_10100668 | |||
| 686 | Ga0065704_10102223 | |||
| 687 | Ga0065704_10258611 | |||
| 688 | Ga0065704_10478304 | |||
| 689 | Ga0065704_10617543 | |||
| 690 | Ga0065704_10779933 | |||
| 691 | Ga0065712_10003070 | |||
| 692 | Ga0065712_10003383 | |||
| 693 | Ga0065712_10115717 | |||
| 694 | Ga0065712_10463537 | |||
| 695 | Ga0065715_10001406 | |||
| 696 | Ga0065715_10003848 | |||
| 697 | Ga0065715_10234416 | |||
| 698 | Ga0065715_10289624 | |||
| 699 | Ga0065715_10519488 | |||
| 700 | Ga0065707_10019936 | |||
| 701 | Ga0065707_10030012 | |||
| 702 | Ga0065707_10053798 | |||
| 703 | Ga0065707_10103198 | |||
| 704 | Ga0065707_10187492 | |||
| 705 | Ga0065707_10430385 | |||
| 706 | Ga0065707_10441439 | |||
| 707 | Ga0070658_10086760 | |||
| 708 | Ga0070658_11476303 | |||
| 709 | Ga0070676_10710309 | |||
| 710 | Ga0070683_100055269 | |||
| 711 | Ga0070683_100098231 | |||
| 712 | Ga0070683_100122213 | |||
| 713 | Ga0070683_100601624 | |||
| 714 | Ga0070690_100075043 | |||
| 715 | Ga0070690_100233267 | |||
| 716 | Ga0070670_101622342 | |||
| 717 | Ga0068869_100096987 | |||
| 718 | Ga0070666_10233839 | |||
| 719 | Ga0070666_10330324 | |||
| 720 | Ga0070666_10718861 | |||
| 721 | Ga0070680_100036859 | |||
| 722 | Ga0070680_100359782 | |||
| 723 | Ga0070682_100039565 | |||
| 724 | Ga0068868_100063289 | |||
| 725 | Ga0070660_100059340 | |||
| 726 | Ga0070660_100388464 | |||
| 727 | Ga0070660_100873647 | |||
| 728 | Ga0070660_101198750 | |||
| 729 | Ga0070689_100012659 | |||
| 730 | Ga0070689_100069402 | |||
| 731 | Ga0070689_100187621 | |||
| 732 | Ga0070689_100775461 | |||
| 733 | Ga0070689_101476602 | |||
| 734 | Ga0070691_10797306 | |||
| 735 | Ga0070687_100056748 | |||
| 736 | Ga0070661_100293207 | |||
| 737 | Ga0070661_100367430 | |||
| 738 | Ga0070661_101222970 | |||
| 739 | Ga0070692_10072887 | |||
| 740 | Ga0070668_100071754 | |||
| 741 | Ga0070668_100961907 | |||
| 742 | Ga0070669_101173402 | |||
| 743 | Ga0070669_101501255 | |||
| 744 | Ga0070669_101731544 | |||
| 745 | Ga0070675_100005376 | |||
| 746 | Ga0070675_100047008 | |||
| 747 | Ga0070675_100075087 | |||
| 748 | Ga0070675_100185269 | |||
| 749 | Ga0070675_101135083 | |||
| 750 | Ga0070671_100104553 | |||
| 751 | Ga0070671_100638518 | |||
| 752 | Ga0070674_100561987 | |||
| 753 | Ga0070674_100577202 | |||
| 754 | Ga0070673_100021673 | |||
| 755 | Ga0070688_100004900 | |||
| 756 | Ga0070688_100026230 | |||
| 757 | Ga0070688_100598580 | |||
| 758 | Ga0070659_100008343 | |||
| 759 | Ga0070659_100083545 | |||
| 760 | Ga0070659_100792804 | |||
| 761 | Ga0070659_100881723 | |||
| 762 | Ga0070659_101657347 | |||
| 763 | Ga0070667_100174354 | |||
| 764 | Ga0070667_100193287 | |||
| 765 | Ga0070667_100480218 | |||
| 766 | Ga0070703_10461137 | |||
| 767 | Ga0070709_10009604 | |||
| 768 | Ga0070709_10544059 | |||
| 769 | Ga0070709_10681036 | |||
| 770 | Ga0070714_100015874 | |||
| 771 | Ga0070714_100295936 | |||
| 772 | Ga0070714_100319032 | |||
| 773 | Ga0070714_100645387 | |||
| 774 | Ga0070714_100892287 | |||
| 775 | Ga0070713_100016136 | |||
| 776 | Ga0070713_100108925 | |||
| 777 | Ga0070713_100294546 | |||
| 778 | Ga0070713_100612806 | |||
| 779 | Ga0070713_100810362 | |||
| 780 | Ga0070713_101803769 | |||
| 781 | Ga0070710_10105132 | |||
| 782 | Ga0070710_10140203 | |||
| 783 | Ga0070710_10268987 | |||
| 784 | Ga0070710_10280118 | |||
| 785 | Ga0070701_10275177 | |||
| 786 | Ga0070701_10339790 | |||
| 787 | Ga0070701_10469246 | |||
| 788 | Ga0070711_100023042 | |||
| 789 | Ga0070711_100043079 | |||
| 790 | Ga0070711_100059459 | |||
| 791 | Ga0070711_100169987 | |||
| 792 | Ga0070711_100610956 | |||
| 793 | Ga0070705_100056779 | |||
| 794 | Ga0070700_100154739 | |||
| 795 | Ga0070700_100208796 | |||
| 796 | Ga0070694_100038025 | |||
| 797 | Ga0070708_100190928 | |||
| 798 | Ga0070708_101353230 | |||
| 799 | Ga0070663_100013287 | |||
| 800 | Ga0070663_100242297 | |||
| 801 | Ga0070663_101917693 | |||
| 802 | Ga0070678_100286122 | |||
| 803 | Ga0070678_101774648 | |||
| 804 | Ga0070662_100044456 | |||
| 805 | Ga0070662_100063247 | |||
| 806 | Ga0070662_100305503 | |||
| 807 | Ga0070662_100308070 | |||
| 808 | Ga0070681_10013048 | |||
| 809 | Ga0070685_10002918 | |||
| 810 | Ga0070685_10802485 | |||
| 811 | Ga0070706_100327145 | |||
| 812 | Ga0070706_101377233 | |||
| 813 | Ga0070707_100016201 | |||
| 814 | Ga0070707_100036110 | |||
| 815 | Ga0070707_100081112 | |||
| 816 | Ga0070707_100081247 | |||
| 817 | Ga0070707_100514650 | |||
| 818 | Ga0070707_101517775 | |||
| 819 | Ga0070698_100158672 | |||
| 820 | Ga0070698_100214221 | |||
| 821 | Ga0070699_100434140 | |||
| 822 | Ga0070679_100093263 | |||
| 823 | Ga0070684_100001068 | |||
| 824 | Ga0070684_100030455 | |||
| 825 | Ga0070684_100119508 | |||
| 826 | Ga0070684_100167662 | |||
| 827 | Ga0070684_101114757 | |||
| 828 | Ga0070684_101201848 | |||
| 829 | Ga0070697_100087485 | |||
| 830 | Ga0070697_100209007 | |||
| 831 | Ga0070697_100214171 | |||
| 832 | Ga0070697_100231456 | |||
| 833 | Ga0070686_100016744 | |||
| 834 | Ga0070686_100064796 | |||
| 835 | Ga0070686_100532226 | |||
| 836 | Ga0070696_100388431 | |||
| 837 | Ga0070696_100798236 | |||
| 838 | Ga0070665_100063641 | |||
| 839 | Ga0070665_100106399 | |||
| 840 | Ga0070665_100154741 | |||
| 841 | Ga0070665_100456445 | |||
| 842 | Ga0070665_101156151 | |||
| 843 | Ga0070704_100005773 | |||
| 844 | Ga0070704_100075299 | |||
| 845 | Ga0070704_100759647 | |||
| 846 | Ga0070704_101756264 | |||
| 847 | Ga0070664_100020371 | |||
| 848 | Ga0070664_100087808 | |||
| 849 | Ga0068857_101291921 | |||
| 850 | Ga0068854_100161118 | |||
| 851 | Ga0070702_100031535 | |||
| 852 | Ga0070702_100332582 | |||
| 853 | Ga0070702_100420891 | |||
| 854 | Ga0068859_100003179 | |||
| 855 | Ga0068864_100133619 | |||
| 856 | Ga0068864_100155285 | |||
| 857 | Ga0068864_101107380 | |||
| 858 | Ga0068861_100112656 | |||
| 859 | Ga0068861_100113987 | |||
| 860 | Ga0068863_100006492 | |||
| 861 | Ga0068863_100022750 | |||
| 862 | Ga0068863_100561541 | |||
| 863 | Ga0068863_101147448 | |||
| 864 | Ga0068863_102307217 | |||
| 865 | Ga0068858_100018257 | |||
| 866 | Ga0068858_100078061 | |||
| 867 | Ga0068858_100967154 | |||
| 868 | Ga0068858_102313822 | |||
| 869 | Ga0068860_100014680 | |||
| 870 | Ga0068860_100142341 | |||
| 871 | Ga0081455_10000385 | |||
| 872 | Ga0081455_10003636 | |||
| 873 | Ga0081455_10014762 | |||
| 874 | Ga0081455_10040911 | |||
| 875 | Ga0081455_10066731 | |||
| 876 | Ga0081455_10090583 | |||
| 877 | Ga0081455_10171895 | |||
| 878 | Ga0081455_10804867 | |||
| 879 | Ga0081540_1000016 | |||
| 880 | Ga0081540_1046218 | |||
| 881 | Ga0081540_1059247 | |||
| 882 | Ga0081540_1170080 | |||
| 883 | Ga0081539_10041525 | |||
| 884 | Ga0081539_10050892 | |||
| 885 | Ga0081539_10079640 | |||
| 886 | Ga0070717_10049587 | |||
| 887 | Ga0070717_10084842 | |||
| 888 | Ga0070717_10136708 | |||
| 889 | Ga0070717_10226280 | |||
| 890 | Ga0070717_10474871 | |||
| 891 | Ga0070717_10522681 | |||
| 892 | Ga0070717_11490179 | |||
| 893 | Ga0070715_10014639 | |||
| 894 | Ga0070715_10119448 | |||
| 895 | Ga0070715_10500304 | |||
| 896 | Ga0070715_10518214 | |||
| 897 | Ga0070715_10902657 | |||
| 898 | Ga0070716_100044463 | |||
| 899 | Ga0070716_100081686 | |||
| 900 | Ga0070716_100101506 | |||
| 901 | Ga0070716_100130031 | |||
| 902 | Ga0070716_100331266 | |||
| 903 | Ga0070716_100536817 | |||
| 904 | Ga0070716_100876634 | |||
| 905 | Ga0070716_101437885 | |||
| 906 | Ga0070712_100047620 | |||
| 907 | Ga0070712_100083849 | |||
| 908 | Ga0070712_100169549 | |||
| 909 | Ga0070712_100328529 | |||
| 910 | Ga0070712_100510601 | |||
| 911 | Ga0070712_100632845 | |||
| 912 | Ga0070712_100700552 | |||
| 913 | Ga0070712_100820279 | |||
| 914 | Ga0097621_100498449 | |||
| 915 | Ga0097621_101059150 | |||
| 916 | Ga0075428_100266735 | |||
| 917 | Ga0075433_10607679 | |||
| 918 | Ga0075433_11363617 | |||
| 919 | Ga0075434_100283952 | |||
| 920 | Ga0075434_100361817 | |||
| 921 | Ga0075434_100806923 | |||
| 922 | Ga0075434_100872883 | |||
| 923 | Ga0068865_100887795 | |||
| 924 | Ga0097620_100003179 | |||
| 925 | Ga0075435_100509329 | |||
| 926 | Ga0075435_101261093 | |||
| 927 | Ga0099795_10001863 | |||
| 928 | Ga0111539_10288426 | |||
| 929 | Ga0111539_10519572 | |||
| 930 | Ga0111539_11061875 | |||
| 931 | Ga0111539_12405021 | |||
| 932 | Ga0105245_10035379 | |||
| 933 | Ga0105245_10149650 | |||
| 934 | Ga0105245_13179611 | |||
| 935 | Ga0105247_10058472 | |||
| 936 | Ga0105247_10220000 | |||
| 937 | Ga0114129_10153841 | |||
| 938 | Ga0114129_10298064 | |||
| 939 | Ga0114129_10554124 | |||
| 940 | Ga0114129_11069975 | |||
| 941 | Ga0114129_11624880 | |||
| 942 | Ga0114129_13191266 | |||
| 943 | Ga0105243_10323276 | |||
| 944 | Ga0105243_10459102 | |||
| 945 | Ga0105243_10689114 | |||
| 946 | Ga0105241_10589972 | |||
| 947 | Ga0105241_10853188 | |||
| 948 | Ga0105241_11344990 | |||
| 949 | Ga0105242_10049446 | |||
| 950 | Ga0105242_10118817 | |||
| 951 | Ga0105242_10227948 | |||
| 952 | Ga0105242_10427903 | |||
| 953 | Ga0105242_11595726 | |||
| 954 | Ga0105248_10963202 | |||
| 955 | Ga0105248_12577340 | |||
| 956 | Ga0105237_10037709 | |||
| 957 | Ga0105237_10736587 | |||
| 958 | Ga0105238_10735765 | |||
| 959 | Ga0105249_10009902 | |||
| 960 | Ga0105249_10152041 | |||
| 961 | Ga0105249_10523304 | |||
| 962 | Ga0105249_10579227 | |||
| 963 | Ga0105239_10278342 | |||
| 964 | Ga0105239_10396351 | |||
| 965 | Ga0105239_10602140 | |||
| 966 | Ga0105239_12694296 | |||
| 967 | Ga0105239_13544316 | |||
| 968 | Ga0157316_1016730 | |||
| 969 | Ga0157371_10305183 | |||
| 970 | Ga0157370_10110692 | |||
| 971 | Ga0157369_10061442 | |||
| 972 | Ga0157369_10182694 | |||
| 973 | Ga0157374_10034730 | |||
| 974 | Ga0157374_10037864 | |||
| 975 | Ga0157374_10116791 | |||
| 976 | Ga0157374_10147243 | |||
| 977 | Ga0157374_10315099 | |||
| 978 | Ga0157374_10651477 | |||
| 979 | Ga0157374_10814864 | |||
| 980 | Ga0157374_10821540 | |||
| 981 | Ga0157374_11218279 | |||
| 982 | Ga0157378_10016502 | |||
| 983 | Ga0157378_10066568 | |||
| 984 | Ga0157378_10170170 | |||
| 985 | Ga0157378_10312950 | |||
| 986 | Ga0157378_10970563 | |||
| 987 | Ga0157378_11694788 | |||
| 988 | Ga0163162_10029195 | |||
| 989 | Ga0163162_10406113 | |||
| 990 | Ga0163162_10822327 | |||
| 991 | Ga0163162_11150276 | |||
| 992 | Ga0163162_12280839 | |||
| 993 | Ga0163162_13104410 | |||
| 994 | Ga0157372_10020989 | |||
| 995 | Ga0157372_10521021 | |||
| 996 | Ga0157375_10001548 | |||
| 997 | Ga0157375_10025775 | |||
| 998 | Ga0157375_10040734 | |||
| 999 | Ga0157375_10143205 | |||
| 1000 | Ga0157375_11936233 | |||
| 1001 | Ga0157375_12215706 | |||
| 1002 | Ga0157375_12648606 | |||
| 1003 | Ga0163163_10064253 | |||
| 1004 | Ga0163163_10163317 | |||
| 1005 | Ga0163163_10870492 | |||
| 1006 | Ga0163163_10926203 | |||
| 1007 | Ga0157377_10179786 | |||
| 1008 | Ga0157377_10238996 | |||
| 1009 | Ga0157377_10269492 | |||
| 1010 | Ga0157377_10365048 | |||
| 1011 | Ga0157379_10012044 | |||
| 1012 | Ga0157379_10028693 | |||
| 1013 | Ga0157379_10535404 | |||
| 1014 | Ga0157376_10050363 | |||
| 1015 | Ga0157376_10061899 | |||
| 1016 | Ga0157376_10074374 | |||
| 1017 | Ga0157376_10093726 | |||
| 1018 | Ga0157376_10130559 | |||
| 1019 | Ga0157376_10456766 | |||
| 1020 | Ga0157376_11262548 | |||
| 1021 | Ga0182006_1113588 | |||
| 1022 | Ga0163161_10860641 | |||
| 1023 | Ga0206356_10566114 | |||
| 1024 | Ga0207666_1029321 | |||
| 1025 | Ga0207666_1042853 | |||
| 1026 | Ga0207666_1054998 | |||
| 1027 | Ga0207673_1009361 | |||
| 1028 | Ga0207697_10003532 | |||
| 1029 | Ga0207697_10006740 | |||
| 1030 | Ga0207697_10010555 | |||
| 1031 | Ga0207697_10015764 | |||
| 1032 | Ga0207697_10016996 | |||
| 1033 | Ga0207697_10023747 | |||
| 1034 | Ga0207697_10035138 | |||
| 1035 | Ga0207697_10055078 | |||
| 1036 | Ga0207697_10060082 | |||
| 1037 | Ga0207697_10121324 | |||
| 1038 | Ga0207697_10267885 | |||
| 1039 | Ga0207653_10336833 | |||
| 1040 | Ga0207653_10425421 | |||
| 1041 | Ga0207692_10070261 | |||
| 1042 | Ga0207692_10176901 | |||
| 1043 | Ga0207692_10324762 | |||
| 1044 | Ga0207692_10363097 | |||
| 1045 | Ga0207692_10694162 | |||
| 1046 | Ga0207642_11049248 | |||
| 1047 | Ga0207710_10052701 | |||
| 1048 | Ga0207688_10176821 | |||
| 1049 | Ga0207688_10340326 | |||
| 1050 | Ga0207688_10691161 | |||
| 1051 | Ga0207680_10266721 | |||
| 1052 | Ga0207680_10544712 | |||
| 1053 | Ga0207680_11029385 | |||
| 1054 | Ga0207647_10004405 | |||
| 1055 | Ga0207685_10069859 | |||
| 1056 | Ga0207685_10432805 | |||
| 1057 | Ga0207699_10382427 | |||
| 1058 | Ga0207699_10427696 | |||
| 1059 | Ga0207645_10498720 | |||
| 1060 | Ga0207645_10742481 | |||
| 1061 | Ga0207684_10028772 | |||
| 1062 | Ga0207684_10112191 | |||
| 1063 | Ga0207684_10297886 | |||
| 1064 | Ga0207707_10009207 | |||
| 1065 | Ga0207671_10100422 | |||
| 1066 | Ga0207693_10016156 | |||
| 1067 | Ga0207693_10020481 | |||
| 1068 | Ga0207693_10033176 | |||
| 1069 | Ga0207693_10078439 | |||
| 1070 | Ga0207693_10144822 | |||
| 1071 | Ga0207693_10144888 | |||
| 1072 | Ga0207693_10178691 | |||
| 1073 | Ga0207693_10220110 | |||
| 1074 | Ga0207693_10352091 | |||
| 1075 | Ga0207693_10541598 | |||
| 1076 | Ga0207693_10853601 | |||
| 1077 | Ga0207663_10068037 | |||
| 1078 | Ga0207663_10078900 | |||
| 1079 | Ga0207663_10311865 | |||
| 1080 | Ga0207663_10775126 | |||
| 1081 | Ga0207663_10916627 | |||
| 1082 | Ga0207660_10534621 | |||
| 1083 | Ga0207662_10014895 | |||
| 1084 | Ga0207657_10136555 | |||
| 1085 | Ga0207657_10270543 | |||
| 1086 | Ga0207657_10536746 | |||
| 1087 | Ga0207649_10293546 | |||
| 1088 | Ga0207649_10415991 | |||
| 1089 | Ga0207652_10105901 | |||
| 1090 | Ga0207646_10029498 | |||
| 1091 | Ga0207646_10081724 | |||
| 1092 | Ga0207646_10538668 | |||
| 1093 | Ga0207646_11463863 | |||
| 1094 | Ga0207646_11511929 | |||
| 1095 | Ga0207681_11091492 | |||
| 1096 | Ga0207650_10246672 | |||
| 1097 | Ga0207650_10305138 | |||
| 1098 | Ga0207659_10005881 | |||
| 1099 | Ga0207659_10020462 | |||
| 1100 | Ga0207659_10135733 | |||
| 1101 | Ga0207659_10203035 | |||
| 1102 | Ga0207687_10444339 | |||
| 1103 | Ga0207687_10602735 | |||
| 1104 | Ga0207700_10010804 | |||
| 1105 | Ga0207700_10171127 | |||
| 1106 | Ga0207700_10348734 | |||
| 1107 | Ga0207700_10433536 | |||
| 1108 | Ga0207664_10291984 | |||
| 1109 | Ga0207664_10447436 | |||
| 1110 | Ga0207664_10596558 | |||
| 1111 | Ga0207664_11009933 | |||
| 1112 | Ga0207644_10524469 | |||
| 1113 | Ga0207644_10676056 | |||
| 1114 | Ga0207690_10004400 | |||
| 1115 | Ga0207690_10397652 | |||
| 1116 | Ga0207690_10401851 | |||
| 1117 | Ga0207690_10918337 | |||
| 1118 | Ga0207706_10016988 | |||
| 1119 | Ga0207706_10064529 | |||
| 1120 | Ga0207706_10100812 | |||
| 1121 | Ga0207706_10137473 | |||
| 1122 | Ga0207686_11747477 | |||
| 1123 | Ga0207709_10567462 | |||
| 1124 | Ga0207709_10887358 | |||
| 1125 | Ga0207709_11200280 | |||
| 1126 | Ga0207670_10104783 | |||
| 1127 | Ga0207670_10120781 | |||
| 1128 | Ga0207670_10362356 | |||
| 1129 | Ga0207670_10732351 | |||
| 1130 | Ga0207670_11538963 | |||
| 1131 | Ga0207669_10893430 | |||
| 1132 | Ga0207669_11595449 | |||
| 1133 | Ga0207704_10161570 | |||
| 1134 | Ga0207704_10333853 | |||
| 1135 | Ga0207665_10015418 | |||
| 1136 | Ga0207665_10041014 | |||
| 1137 | Ga0207665_10093165 | |||
| 1138 | Ga0207665_10116751 | |||
| 1139 | Ga0207665_10399468 | |||
| 1140 | Ga0207689_10450584 | |||
| 1141 | Ga0207689_11595692 | |||
| 1142 | Ga0207661_10106868 | |||
| 1143 | Ga0207661_11271379 | |||
| 1144 | Ga0207661_11705300 | |||
| 1145 | Ga0207679_10064848 | |||
| 1146 | Ga0207679_10224654 | |||
| 1147 | Ga0207667_11328807 | |||
| 1148 | Ga0207651_10022770 | |||
| 1149 | Ga0207712_10020363 | |||
| 1150 | Ga0207712_10651284 | |||
| 1151 | Ga0207712_11320730 | |||
| 1152 | Ga0207668_10049861 | |||
| 1153 | Ga0207668_11080830 | |||
| 1154 | Ga0207640_10518897 | |||
| 1155 | Ga0207640_10962403 | |||
| 1156 | Ga0207658_10141124 | |||
| 1157 | Ga0207677_10071270 | |||
| 1158 | Ga0207677_12286347 | |||
| 1159 | Ga0207703_10013636 | |||
| 1160 | Ga0207703_10088418 | |||
| 1161 | Ga0207703_10776489 | |||
| 1162 | Ga0207678_10004776 | |||
| 1163 | Ga0207678_10573280 | |||
| 1164 | Ga0207708_10018830 | |||
| 1165 | Ga0207708_10459956 | |||
| 1166 | Ga0207641_10012208 | |||
| 1167 | Ga0207641_10949616 | |||
| 1168 | Ga0207641_11514424 | |||
| 1169 | Ga0207676_10218833 | |||
| 1170 | Ga0207676_10991716 | |||
| 1171 | Ga0207676_11037319 | |||
| 1172 | Ga0207676_11830387 | |||
| 1173 | Ga0207675_100155199 | |||
| 1174 | Ga0207675_100804506 | |||
| 1175 | Ga0207683_10175732 | |||
| 1176 | Ga0207683_10197105 | |||
| 1177 | Ga0207683_11722571 | |||
| 1178 | Ga0209179_1050374 | |||
| 1179 | Ga0209974_10107290 | |||
| 1180 | Ga0209974_10461053 | |||
| 1181 | Ga0268266_10028113 | |||
| 1182 | Ga0268266_10399958 | |||
| 1183 | Ga0268264_10030610 | |||
| 1184 | Ga0268264_11494962 | |||
| 1185 | Ga0373928_0127275 | |||
| 1186 | Ga0373934_0327272 | |||
| 1187 | Ga0373944_0192212 | |||
| 1188 | Ga0373936_0403802 | |||
| 1189 | Ga0373939_0247853 | |||
| 1190 | Ga0373945_0109044 | |||
| 1191 | Ga0373956_0025043 | |||
| 1192 | Ga0373956_0416931 | |||
| 1193 | Ga0373956_0440740 | |||
| 1194 | Ga0373957_0073023 | |||
| 1195 | Ga0373943_0071366 | |||
| 1196 | Ga0373943_0165411 | |||
| 1197 | Ga0373943_0530174 | |||
| 1198 | Ga0373946_0297937 | |||
| 1199 | Ga0373946_0608817 | |||
| 1200 | Ga0373955_0877162 | |||
| 1201 | Ga0373924_0174673 | |||
| 1202 | Ga0373935_0079938 | |||
| 1203 | Ga0373935_0500422 | |||
| 1204 | Ga0373935_1232592 | |||
| 1205 | Ga0373935_1387534 | |||
| 1206 | Ga0373927_0481790 | |||
| 1207 | Ga0373933_0040369 | |||
| 1208 | Ga0373933_0421529 | |||
| 1209 | Ga0373933_1046609 | |||
| 1210 | Ga0373947_0017333 | |||
| 1211 | Ga0373937_0387297 | |||
| 1212 | Ga0373937_0793797 | |||
| 1213 | Ga0373937_0840844 | |||
| 1214 | Ga0373937_0851185 | |||
| 1215 | Ga0373925_0439825 | |||
| 1216 | Ga0373925_1239468 | |||
| 1217 | Ga0395901_0415695 | |||
| 1218 | Ga0451853_0278490 | |||
| 1219 | Ga0439458_0102530 | |||
| 1220 | Ga0439464_0078339 | |||
| 1221 | Ga0439464_0107422 | |||
| 1222 | Ga0495592_0074693 | |||
| 1223 | Ga0495592_0594555 | |||
| 1224 | Ga0495603_0220779 | |||
| 1225 | Ga0495603_0454335 | |||
| 1226 | Ga0495629_0579437 | |||
| 1227 | Ga0495641_0035818 | |||
| 1228 | Ga0495580_0854236 | |||
| 1229 | Ga0495582_0095602 | |||
| 1230 | Ga0495582_0181888 | |||
| 1231 | Ga0495639_0054143 | |||
| 1232 | Ga0495639_0565160 | |||
| 1233 | Ga0495664_0044459 | |||
| 1234 | Ga0495664_0116419 | |||
| 1235 | Ga0495664_0224945 | |||
| 1236 | Ga0495585_0168262 | |||
| 1237 | Ga0495608_0845903 | |||
| 1238 | Ga0495618_0109961 | |||
| 1239 | Ga0495628_0033015 | |||
| 1240 | Ga0495630_0006745 | |||
| 1241 | Ga0495630_0181032 | |||
| 1242 | Ga0495630_0624602 | |||
| 1243 | Ga0495644_0372330 | |||
| 1244 | Ga0495666_0245379 | |||
| 1245 | Ga0495652_0085453 | |||
| 1246 | Ga0495652_0288864 | |||
| 1247 | Ga0495665_0437385 | |||
| 1248 | Ga0495640_0449850 | |||
| 1249 | Ga0495586_0068883 | |||
| 1250 | Ga0495587_0057733 | |||
| 1251 | Ga0495587_0093719 | |||
| 1252 | Ga0495587_0103157 | |||
| 1253 | Ga0495667_0066277 | |||
| 1254 | Ga0495667_0831796 | |||
| 1255 | Ga0495667_0911587 | |||
| 1256 | Ga0495634_0033262 | |||
| 1257 | Ga0495657_0496932 | |||
| 1258 | Ga0495657_0714066 | |||
| 1259 | Ga0495599_0023095 | |||
| 1260 | Ga0495599_0025704 | |||
| 1261 | Ga0495623_0033348 | |||
| 1262 | Ga0495646_0014061 | |||
| 1263 | Ga0495646_0137486 | |||
| 1264 | Ga0495647_0358195 | |||
| 1265 | Ga0495658_0102679 | |||
| 1266 | Ga0495669_0581869 | |||
| 1267 | Ga0495613_0155306 | |||
| 1268 | Ga0495624_0493547 | |||
| 1269 | Ga0495600_0568963 | |||
| 1270 | Ga0495581_0174594 | |||
| 1271 | Ga0495581_0734868 | |||
| 1272 | Ga0495604_0254971 | |||
| 1273 | Ga0495604_0545157 | |||
| 1274 | Ga0495604_0665195 | |||
| 1275 | Ga0495604_0814068 | |||
| 1276 | Ga0495674_0224411 | |||
| 1277 | Ga0495674_0320297 | |||
| 1278 | Ga0495676_0583747 | |||
| 1279 | Ga0495680_0167055 | |||
| 1280 | Ga0495675_0127864 | |||
| 1281 | Ga0495684_0023115 | |||
| 1282 | Ga0495684_1086170 | |||
| 1283 | Ga0495593_0514643 | |||
| 1284 | Ga0495602_0047897 | |||
| 1285 | Ga0495602_0335621 | |||
| 1286 | Ga0495602_0404759 | |||
| 1287 | Ga0495614_0176608 | |||
| 1288 | Ga0496100_0199727 | |||
| 1289 | Ga0496100_0205201 | |||
| 1290 | Ga0496100_0575234 | |||
| 1291 | Ga0496101_0060938 | |||
| 1292 | Ga0496101_1025353 | |||
| 1293 | Ga0496102_0031097 | |||
| 1294 | Ga0496102_0255355 | |||
| 1295 | Ga0496102_0643045 | |||
| 1296 | Ga0496102_0756227 | |||
| 1297 | Ga0496102_1055202 | |||
| 1298 | Ga0496103_0330913 | |||
| 1299 | Ga0496104_0032542 | |||
| 1300 | Ga0496104_0305361 | |||
| 1301 | Ga0496104_0319377 | |||
| 1302 | Ga0496104_0468423 | |||
| 1303 | Ga0496105_0352942 | |||
| 1304 | Ga0496105_0511145 | |||
| 1305 | Ga0496106_0030256 | |||
| 1306 | Ga0496107_0088694 | |||
| 1307 | Ga0496107_0493739 | |||
| 1308 | Ga0496107_0494531 | |||
| 1309 | Ga0496107_0575116 | |||
| 1310 | Ga0496108_0254649 | |||
| 1311 | Ga0496108_0817322 | |||
| 1312 | Ga0496108_0978858 | |||
| 1313 | Ga0496109_0023921 | |||
| 1314 | Ga0496109_0168958 | |||
| 1315 | Ga0496110_0033252 | |||
| 1316 | Ga0496111_0076616 | |||
| 1317 | Ga0496112_0112225 | |||
| 1318 | Ga0496112_0156317 | |||
| 1319 | Ga0496112_0530678 | |||
| 1320 | Ga0496112_0937251 | |||
| 1321 | Ga0496112_1128207 | |||
| 1322 | Ga0496113_0013986 | |||
| 1323 | Ga0496113_0544797 | |||
| 1324 | Ga0496114_0016154 | |||
| 1325 | Ga0496114_0108854 | |||
| 1326 | Ga0496114_0975899 | |||
| 1327 | Ga0496115_0005638 | |||
| 1328 | Ga0496115_0019542 | |||
| 1329 | Ga0496115_0139995 | |||
| 1330 | nmdc:mga05p37_1224377_c1 | |||
| 1331 | nmdc:mga05p37_1526559_c1 | |||
| 1332 | nmdc:mga05p37_1940392_c1 | |||
| 1333 | nmdc:mga05p37_734041_c1 | |||
| 1334 | nmdc:mga05p37_746635_c1 | |||
| 1335 | nmdc:mga08y16_1351193_c1 | |||
| 1336 | nmdc:mga0n895_125593_c1 | |||
| 1337 | nmdc:mga0n895_728674_c1 | |||
| 1338 | nmdc:mga0n895_742303_c1 | |||
| 1339 | nmdc:mga0n895_860344_c1 | |||
| 1340 | nmdc:mga0rr50_1785391_c1 | |||
| 1341 | nmdc:mga0a205_694348_c1 | |||
| 1342 | nmdc:mga0a205_721605_c1 | |||
| 1343 | Ga0495601_0030537 | |||
| 1344 | Ga0495601_0093523 | |||
| 1345 | Ga0495612_0022640 | |||
| 1346 | Ga0495612_0518772 | |||
| 1347 | Ga0495595_0291104 | |||
| 1348 | Ga0495595_0310429 | |||
| 1349 | Ga0495619_0384801 | |||
| 1350 | Ga0495619_0646066 |