F474348

General Info

Members Datasets Scaffolds Average Seq Length
674 374 657 244

Family's Representative Sequence

Representative Sequence 3300005338|Ga0068868_100052343|Ga0068868_1000523434
Length 251
Sequence MATGTGAPKPVALVIGAGDATGGAIARRFAREGYVACVTRRHLDKLQPLVDEIVAAGGEAHGFASDARKEEEVIALVDQIESAIGPIEVLVFNIGANAPSSILEETARKYFKIWEMACFGGFLNAREVAKRMVAREGDGHKGTIIFTGATASLRGSANFGAFAGAKHALRALAQSMARELGPRGIHVAHVVVDGAIDTEFIRETFPQRYALKDQDGILNPDHIADNYWMLHRQPRDAWTHELDLRPWIEKF

Samples

Sample ID Description Type Environment
1 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
2 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
3 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
4 2643221658 Variovorax sp. Root411 Isolate Unclassified
5 2643221665 Acinetobacter sp. Root1280 Isolate Unclassified
6 2643221672 Variovorax sp. Root434 Isolate Unclassified
7 2738541307 Variovorax sp. GV008 Isolate Unclassified
8 2738543013 Variovorax sp. BT01 Isolate Unclassified
9 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
10 2885266251 Ralstonia sp. SET104 Isolate Nodule
11 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
12 2904456579 Variovorax sp. 2002 Isolate Unclassified
13 2928058823 Ralstonia sp. 1138 Isolate Unclassified
14 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
15 2928515477 Acinetobacter bereziniae 1375 Isolate Rhizosphere
16 2929520902 Variovorax beijingensis 502 Isolate Unclassified
17 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
18 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
19 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
20 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
21 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
22 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
23 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
24 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
25 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
26 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
27 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
28 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
29 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
30 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
31 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
32 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
33 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
34 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
35 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
36 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
37 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
38 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
39 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
40 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
41 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
42 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
43 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
44 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
45 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
46 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
47 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
48 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
49 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
50 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
51 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
52 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
53 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
54 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
55 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
56 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
57 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
58 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
59 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
60 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
61 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
62 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
63 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
64 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
65 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
66 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
67 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
68 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
69 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
70 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
71 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
72 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
73 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
74 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
75 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
76 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
77 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
78 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
79 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
80 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
81 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
82 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
83 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
84 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
85 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
86 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
87 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
88 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
89 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
90 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
91 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
92 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
93 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
94 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
95 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
96 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
97 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
98 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
100 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
101 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
102 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
103 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
104 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
105 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
106 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
107 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
108 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
109 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
110 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
111 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
112 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
113 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
114 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
115 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
116 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
117 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
118 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
119 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
120 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
121 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
122 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
123 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
124 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
125 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
126 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
127 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
128 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
129 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
130 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
131 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
132 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
133 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
134 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
135 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
136 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
137 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
138 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
139 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
140 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
141 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
142 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
143 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
152 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
153 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
155 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
156 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
158 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
159 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
160 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
162 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
163 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
164 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
217 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
218 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
222 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
223 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
224 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
225 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
226 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
227 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
228 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
229 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
230 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
231 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
232 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
233 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
234 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
235 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
236 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
237 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
238 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
239 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
240 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
241 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
242 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
243 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
244 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
245 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
246 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
247 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
248 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
249 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
250 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
251 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
252 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
253 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
254 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
255 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
256 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
257 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
258 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
259 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
260 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
261 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
262 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
263 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
264 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
265 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
266 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
267 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
268 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
269 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
270 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
271 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
272 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
273 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
274 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
275 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
276 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
277 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
278 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
279 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
280 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
281 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
282 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
283 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
284 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
285 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
286 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
287 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
288 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
289 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
290 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
291 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
292 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
293 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
294 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
295 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
296 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
297 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
298 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
299 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
300 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
301 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
302 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
303 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
304 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
305 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
306 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
307 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
308 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
309 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
310 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
311 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
312 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
313 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
314 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
315 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
316 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
317 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
318 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
319 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
320 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
321 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
322 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
323 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
324 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
325 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
326 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
327 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
328 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
329 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
330 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
331 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
332 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
333 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
334 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
335 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
336 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
337 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
338 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
339 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
340 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
341 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
342 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
343 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
344 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
345 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
346 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
347 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
348 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
349 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
350 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
351 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
352 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
353 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
354 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
355 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
356 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
357 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
358 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
359 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
360 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
361 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
362 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
363 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
364 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
365 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
366 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
367 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
368 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
369 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
370 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
371 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
372 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
373 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
374 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.74
Metatranscriptomes 0.74
Isolates 2.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.57
Nodule 1.04
Rhizoplane 5.19
Rhizosphere 76.85
Stem 0
Stem Tuber 0
Unclassified 5.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10019621 3300001989 Bacteria 2419
2 JGI25156J39149_1003854 3300002705 Bacteria 4768
3 JGI25151J46595_10000732 3300003187 Bacteria 27119
4 Ga0006562J51391_1110457 3300003578 Bacteria 2700
5 Ga0006562J51391_1110458 3300003578 Bacteria 2692
6 Ga0006562J51391_1113999 3300003578 Bacteria 2341
7 Ga0006562J51391_1114001 3300003578 Bacteria 1800
8 Ga0055538_1002515 3300003751 Bacteria 2655
9 Ga0055533_1002572 3300003756 Bacteria 4053
10 Ga0055532_1000048 3300003758 Bacteria 175560
11 Ga0055535_1000035 3300003761 Bacteria 175560
12 Ga0055529_1000101 3300003763 Bacteria 130709
13 Ga0055526_1009224 3300003771 Bacteria 4786
14 Ga0055537_1000211 3300003773 Bacteria 43102
15 Ga0055537_1001221 3300003773 Bacteria 10815
16 Ga0055524_1001351 3300003775 Bacteria 14282
17 Ga0055536_1001127 3300003781 Bacteria 16744
18 Ga0055534_1000210 3300003784 Bacteria 43102
19 Ga0055528_1000852 3300003790 Bacteria 20709
20 Ga0055528_1033087 3300003790 Bacteria 1304
21 Ga0055530_10012071 3300003791 Bacteria 3041
22 Ga0055540_1000142 3300003792 Bacteria 71685
23 Ga0055540_1000440 3300003792 Bacteria 32622
24 Ga0055531_10000424 3300003794 Bacteria 40020
25 Ga0055531_10001478 3300003794 Bacteria 17287
26 Ga0065714_10002999 3300005288 Bacteria 16414
27 Ga0070658_10154081 3300005327 Bacteria 1925
28 Ga0070658_10157981 3300005327 Bacteria 1901
29 Ga0070676_10008256 3300005328 Bacteria 5606
30 Ga0070676_10035874 3300005328 Bacteria 2854
31 Ga0070676_10054380 3300005328 Bacteria 2360
32 Ga0070676_10118212 3300005328 Bacteria 1660
33 Ga0070683_100095147 3300005329 Bacteria 2800
34 Ga0070683_100423180 3300005329 Bacteria 1271
35 Ga0070690_100001686 3300005330 Bacteria 11638
36 Ga0070690_100017056 3300005330 Bacteria 4360
37 Ga0070670_100361184 3300005331 Bacteria 1277
38 Ga0070677_10025396 3300005333 Bacteria 2211
39 Ga0070677_10060993 3300005333 Bacteria 1556
40 Ga0070677_10086340 3300005333 Bacteria 1355
41 Ga0068869_100088813 3300005334 Bacteria 2320
42 Ga0068869_100135729 3300005334 Bacteria 1895
43 Ga0070666_10007800 3300005335 Bacteria 6612
44 Ga0070666_10532240 3300005335 Bacteria 854
45 Ga0068868_100000814 3300005338 Bacteria 21169
46 Ga0068868_100030698 3300005338 Bacteria 4121
47 Ga0068868_100033575 3300005338 Bacteria 3956
48 Ga0068868_100052343 3300005338 Bacteria 3214
49 Ga0068868_100084956 3300005338 Bacteria 2542
50 Ga0068868_100387269 3300005338 Bacteria 1204
51 Ga0070689_100007835 3300005340 Bacteria 7487
52 Ga0070687_100000820 3300005343 Bacteria 10356
53 Ga0070687_100129053 3300005343 Bacteria 1457
54 Ga0070661_100120983 3300005344 Unclassified 1961
55 Ga0070661_100526060 3300005344 Bacteria 949
56 Ga0070692_10329626 3300005345 Bacteria 942
57 Ga0070668_100001217 3300005347 Bacteria 18276
58 Ga0070668_100035227 3300005347 Bacteria 3816
59 Ga0070668_100511059 3300005347 Bacteria 1041
60 Ga0070669_100045715 3300005353 Bacteria 3191
61 Ga0070675_100000562 3300005354 Bacteria 25576
62 Ga0070675_100050345 3300005354 Bacteria 3420
63 Ga0070671_100004823 3300005355 Bacteria 10722
64 Ga0070671_100054225 3300005355 Bacteria 3333
65 Ga0070674_100117807 3300005356 Bacteria 1961
66 Ga0070673_100005821 3300005364 Bacteria 7942
67 Ga0070673_100033026 3300005364 Bacteria 3903
68 Ga0070673_100434680 3300005364 Bacteria 1178
69 Ga0070673_100845287 3300005364 Bacteria 847
70 Ga0070659_100062096 3300005366 Bacteria 2953
71 Ga0070667_100017861 3300005367 Bacteria 5879
72 Ga0070667_100064340 3300005367 Bacteria 3112
73 Ga0070711_100017044 3300005439 Bacteria 4620
74 Ga0070711_100318674 3300005439 Unclassified 1241
75 Ga0070705_100265918 3300005440 Bacteria 1212
76 Ga0070694_100039919 3300005444 Bacteria 3127
77 Ga0070708_100023257 3300005445 Bacteria 5267
78 Ga0070708_100289792 3300005445 Bacteria 1541
79 Ga0070678_100010669 3300005456 Bacteria 5626
80 Ga0070662_100019528 3300005457 Bacteria 4601
81 Ga0070662_100046327 3300005457 Bacteria 3124
82 Ga0070662_100069781 3300005457 Bacteria 2588
83 Ga0070681_10693433 3300005458 Bacteria 934
84 Ga0068867_100004609 3300005459 Bacteria 9699
85 Ga0068867_100041458 3300005459 Bacteria 3364
86 Ga0068867_100102432 3300005459 Bacteria 2188
87 Ga0070706_100002496 3300005467 Bacteria 18534
88 Ga0070707_100366167 3300005468 Bacteria 1400
89 Ga0070679_100585020 3300005530 Bacteria 1060
90 Ga0070684_100224165 3300005535 Bacteria 1715
91 Ga0068853_100033865 3300005539 Bacteria 4334
92 Ga0068853_100047135 3300005539 Bacteria 3699
93 Ga0068853_100181082 3300005539 Bacteria 1911
94 Ga0070672_100012578 3300005543 Bacteria 5950
95 Ga0070672_100045895 3300005543 Bacteria 3383
96 Ga0070672_100056157 3300005543 Bacteria 3086
97 Ga0070672_100061128 3300005543 Bacteria 2969
98 Ga0070695_100164525 3300005545 Bacteria 1560
99 Ga0070665_100364412 3300005548 Bacteria 1451
100 Ga0070704_100019332 3300005549 Bacteria 4375
101 Ga0068855_100043550 3300005563 Bacteria 5316
102 Ga0070664_100047384 3300005564 Bacteria 3631
103 Ga0070664_100364151 3300005564 Bacteria 1317
104 Ga0068857_100106310 3300005577 Bacteria 2520
105 Ga0068857_100118879 3300005577 Bacteria 2378
106 Ga0068857_100181224 3300005577 Bacteria 1917
107 Ga0068857_100478428 3300005577 Bacteria 1167
108 Ga0068854_100000396 3300005578 Bacteria 27398
109 Ga0068854_100067625 3300005578 Bacteria 2603
110 Ga0068854_100067736 3300005578 Bacteria 2601
111 Ga0068856_100044068 3300005614 Bacteria 4389
112 Ga0068852_100014277 3300005616 Bacteria 6108
113 Ga0068852_100078523 3300005616 Bacteria 2920
114 Ga0068852_100242421 3300005616 Bacteria 1723
115 Ga0068859_100045863 3300005617 Bacteria 4390
116 Ga0068859_100125212 3300005617 Bacteria 2639
117 Ga0068859_100184011 3300005617 Bacteria 2173
118 Ga0068864_100000666 3300005618 Bacteria 28646
119 Ga0068864_100070863 3300005618 Bacteria 3034
120 Ga0068864_100248842 3300005618 Bacteria 1649
121 Ga0068864_100414273 3300005618 Bacteria 1283
122 Ga0068861_100311637 3300005719 Bacteria 1367
123 Ga0068851_10027581 3300005834 Bacteria 2800
124 Ga0068851_10073293 3300005834 Bacteria 1776
125 Ga0068851_10180623 3300005834 Bacteria 1168
126 Ga0068870_10181875 3300005840 Bacteria 1262
127 Ga0068863_100000585 3300005841 Bacteria 37128
128 Ga0068863_100009834 3300005841 Bacteria 9318
129 Ga0068863_100523186 3300005841 Bacteria 1170
130 Ga0068858_100004762 3300005842 Bacteria 13288
131 Ga0068858_100007104 3300005842 Bacteria 10869
132 Ga0068860_100002804 3300005843 Bacteria 18134
133 Ga0068860_100150781 3300005843 Bacteria 2239
134 Ga0068860_100681797 3300005843 Bacteria 1037
135 Ga0068862_100030063 3300005844 Bacteria 4577
136 Ga0068862_100057153 3300005844 Bacteria 3344
137 Ga0068862_100153122 3300005844 Bacteria 2053
138 Ga0081540_1001565 3300005983 Bacteria 19566
139 Ga0075365_10012156 3300006038 Bacteria 5098
140 Ga0075365_10037769 3300006038 Bacteria 3137
141 Ga0075365_10282573 3300006038 Bacteria 1168
142 Ga0075363_100236535 3300006048 Bacteria 1049
143 Ga0075432_10015003 3300006058 Bacteria 2640
144 Ga0075362_10000626 3300006177 Bacteria 10333
145 Ga0075362_10020852 3300006177 Bacteria 2742
146 Ga0075362_10037317 3300006177 Bacteria 2129
147 Ga0075367_10251727 3300006178 Bacteria 1108
148 Ga0075369_10017548 3300006186 Bacteria 2902
149 Ga0075366_10005412 3300006195 Bacteria 6917
150 Ga0075366_10158104 3300006195 Bacteria 1373
151 Ga0097621_100018619 3300006237 Bacteria 5310
152 Ga0075370_10001410 3300006353 Bacteria 10388
153 Ga0075370_10003126 3300006353 Bacteria 7817
154 Ga0075370_10003497 3300006353 Bacteria 7487
155 Ga0075370_10049456 3300006353 Bacteria 2383
156 Ga0068871_100115888 3300006358 Bacteria 2258
157 Ga0068871_100156753 3300006358 Bacteria 1945
158 Ga0068871_100335788 3300006358 Bacteria 1333
159 Ga0068871_100433289 3300006358 Bacteria 1176
160 Ga0075428_100204783 3300006844 Bacteria 2132
161 Ga0075430_100062615 3300006846 Bacteria 3125
162 Ga0075430_100098468 3300006846 Bacteria 2443
163 Ga0075430_100139949 3300006846 Bacteria 2015
164 Ga0075430_100296315 3300006846 Bacteria 1338
165 Ga0075430_100756689 3300006846 Bacteria 801
166 Ga0075431_100005375 3300006847 Bacteria 12641
167 Ga0075431_100127842 3300006847 Bacteria 2622
168 Ga0075433_10367920 3300006852 Bacteria 1270
169 Ga0075433_10633349 3300006852 Bacteria 938
170 Ga0075434_100112835 3300006871 Bacteria 2730
171 Ga0075434_100247469 3300006871 Bacteria 1802
172 Ga0075434_100972424 3300006871 Bacteria 863
173 Ga0075429_100097936 3300006880 Bacteria 2559
174 Ga0068865_100006103 3300006881 Bacteria 7348
175 Ga0068865_100077319 3300006881 Bacteria 2378
176 Ga0068865_100170487 3300006881 Bacteria 1668
177 Ga0068865_100228416 3300006881 Bacteria 1459
178 Ga0097620_100045862 3300006931 Bacteria 4390
179 Ga0097620_100125211 3300006931 Bacteria 2639
180 Ga0097620_100158505 3300006931 Bacteria 2342
181 Ga0097620_100184001 3300006931 Bacteria 2173
182 Ga0099826_10000019 3300006948 Bacteria 188386
183 Ga0099826_10000124 3300006948 Bacteria 34781
184 Ga0099826_10111361 3300006948 Bacteria 1631
185 Ga0105244_10003295 3300009036 Bacteria 11628
186 Ga0105244_10102435 3300009036 Bacteria 1399
187 Ga0105250_10030527 3300009092 Bacteria 2166
188 Ga0105240_10190147 3300009093 Bacteria 2415
189 Ga0105240_10310580 3300009093 Bacteria 1801
190 Ga0105240_10440467 3300009093 Bacteria 1460
191 Ga0105240_10919149 3300009093 Bacteria 940
192 Ga0111539_10203014 3300009094 Bacteria 2311
193 Ga0105245_10155162 3300009098 Bacteria 2168
194 Ga0105245_10183341 3300009098 Bacteria 2001
195 Ga0105245_10266984 3300009098 Bacteria 1667
196 Ga0114129_10286641 3300009147 Bacteria 2199
197 Ga0105243_10003586 3300009148 Bacteria 12526
198 Ga0105243_10063029 3300009148 Bacteria 2970
199 Ga0105243_10189747 3300009148 Bacteria 1794
200 Ga0105243_10491158 3300009148 Bacteria 1161
201 Ga0105243_10628500 3300009148 Bacteria 1038
202 Ga0105241_10147033 3300009174 Bacteria 1924
203 Ga0105241_10230179 3300009174 Bacteria 1562
204 Ga0105242_10058464 3300009176 Bacteria 3161
205 Ga0105242_10402952 3300009176 Bacteria 1277
206 Ga0105248_10056296 3300009177 Bacteria 4412
207 Ga0105248_10106475 3300009177 Bacteria 3162
208 Ga0105248_10130470 3300009177 Bacteria 2835
209 Ga0105238_10050991 3300009551 Bacteria 4164
210 Ga0105238_10169153 3300009551 Bacteria 2162
211 Ga0105238_10173478 3300009551 Bacteria 2133
212 Ga0105238_10204266 3300009551 Bacteria 1952
213 Ga0105249_10018226 3300009553 Bacteria 6240
214 Ga0105249_10029758 3300009553 Bacteria 4933
215 Ga0105249_10039617 3300009553 Bacteria 4278
216 Ga0105239_10053753 3300010375 Bacteria 4417
217 Ga0105239_10296013 3300010375 Bacteria 1822
218 Ga0105239_10425490 3300010375 Bacteria 1505
219 Ga0105246_10076816 3300011119 Bacteria 2367
220 Ga0105246_10672405 3300011119 Bacteria 904
221 Ga0157373_10008499 3300013100 Bacteria 7628
222 Ga0157373_10010780 3300013100 Bacteria 6728
223 Ga0157373_10067909 3300013100 Bacteria 2521
224 Ga0157371_10002198 3300013102 Bacteria 18932
225 Ga0157369_10004358 3300013105 Bacteria 16698
226 Ga0157369_10022415 3300013105 Bacteria 7047
227 Ga0157369_10216882 3300013105 Bacteria 2004
228 Ga0157374_10100543 3300013296 Bacteria 2772
229 Ga0157374_10126901 3300013296 Bacteria 2466
230 Ga0157378_10144762 3300013297 Bacteria 2210
231 Ga0163162_10005819 3300013306 Bacteria 11923
232 Ga0163162_10059527 3300013306 Bacteria 3852
233 Ga0163162_10100125 3300013306 Bacteria 2989
234 Ga0163162_10121194 3300013306 Bacteria 2720
235 Ga0163162_10138801 3300013306 Bacteria 2543
236 Ga0163162_10850727 3300013306 Bacteria 1027
237 Ga0157372_10029194 3300013307 Bacteria 6020
238 Ga0157372_10166503 3300013307 Bacteria 2549
239 Ga0157375_10007620 3300013308 Bacteria 9468
240 Ga0157375_10025238 3300013308 Bacteria 5518
241 Ga0157375_10208598 3300013308 Bacteria 2111
242 Ga0163163_10006619 3300014325 Bacteria 10147
243 Ga0157380_10581210 3300014326 Bacteria 1105
244 Ga0157380_10851981 3300014326 Bacteria 933
245 Ga0182008_10000669 3300014497 Bacteria 24850
246 Ga0182008_10011327 3300014497 Bacteria 4748
247 Ga0182008_10011982 3300014497 Bacteria 4593
248 Ga0157377_10139293 3300014745 Bacteria 1489
249 Ga0157379_10003595 3300014968 Bacteria 13145
250 Ga0157379_10046697 3300014968 Bacteria 3864
251 Ga0157379_10082433 3300014968 Bacteria 2882
252 Ga0157376_10006041 3300014969 Bacteria 8512
253 Ga0157376_10092389 3300014969 Bacteria 2624
254 Ga0182006_1003951 3300015261 Bacteria 7413
255 Ga0182006_1006971 3300015261 Bacteria 5200
256 Ga0182006_1009607 3300015261 Bacteria 4330
257 Ga0182006_1016779 3300015261 Bacteria 3121
258 Ga0182007_10003759 3300015262 Bacteria 7078
259 Ga0182007_10015387 3300015262 Bacteria 2855
260 Ga0163161_10005078 3300017792 Bacteria 9163
261 Ga0163161_10056146 3300017792 Bacteria 2860
262 Ga0206351_10377698 3300020077 Bacteria 3746
263 Ga0213876_10024079 3300021384 Bacteria 3215
264 Ga0213876_10126376 3300021384 Bacteria 1358
265 Ga0209784_101654 3300025224 Bacteria 2726
266 Ga0209566_103076 3300025225 Bacteria 2727
267 Ga0209674_103712 3300025226 Bacteria 2715
268 Ga0209672_100127 3300025228 Bacteria 78095
269 Ga0209147_100008 3300025229 Bacteria 777096
270 Ga0209563_102375 3300025230 Bacteria 4288
271 Ga0209563_105100 3300025230 Bacteria 2423
272 Ga0209258_100013 3300025242 Bacteria 777096
273 Ga0209148_1015709 3300025254 Bacteria 1317
274 Ga0209759_1001412 3300025256 Bacteria 13705
275 Ga0209759_1004529 3300025256 Bacteria 5146
276 Ga0209565_1000039 3300025263 Bacteria 278026
277 Ga0209565_1000077 3300025263 Bacteria 161163
278 Ga0209455_1000042 3300025272 Bacteria 419638
279 Ga0209673_1000146 3300025273 Bacteria 150871
280 Ga0209673_1024153 3300025273 Bacteria 2050
281 Ga0209675_1000030 3300025291 Bacteria 278026
282 Ga0209675_1002647 3300025291 Bacteria 9040
283 Ga0209676_1000152 3300025292 Bacteria 166700
284 Ga0209676_1013324 3300025292 Bacteria 3168
285 Ga0209025_1000231 3300025294 Bacteria 130671
286 Ga0209564_1000080 3300025295 Bacteria 263547
287 Ga0209564_1000274 3300025295 Bacteria 107980
288 Ga0209564_1031142 3300025295 Bacteria 1636
289 Ga0209758_1042613 3300025297 Bacteria 1681
290 Ga0209050_1000210 3300025298 Bacteria 129834
291 Ga0209256_1000119 3300025299 Bacteria 168215
292 Ga0209051_1000025 3300025303 Bacteria 415397
293 Ga0209051_1000074 3300025303 Bacteria 208667
294 Ga0209051_1000161 3300025303 Bacteria 125704
295 Ga0209257_1000039 3300025304 Bacteria 591694
296 Ga0209257_1000072 3300025304 Bacteria 332791
297 Ga0207697_10024529 3300025315 Bacteria 2469
298 Ga0207697_10036058 3300025315 Bacteria 2025
299 Ga0207655_1001284 3300025728 Bacteria 23851
300 Ga0207655_1015387 3300025728 Bacteria 4255
301 Ga0207655_1015752 3300025728 Bacteria 4181
302 Ga0207642_10019186 3300025899 Bacteria 2643
303 Ga0207688_10029592 3300025901 Bacteria 3016
304 Ga0207645_10002245 3300025907 Bacteria 15384
305 Ga0207645_10043273 3300025907 Bacteria 2882
306 Ga0207645_10047006 3300025907 Bacteria 2756
307 Ga0207645_10053872 3300025907 Bacteria 2570
308 Ga0207645_10087978 3300025907 Bacteria 1996
309 Ga0207643_10036455 3300025908 Bacteria 2758
310 Ga0207643_10427526 3300025908 Bacteria 840
311 Ga0207705_10110955 3300025909 Bacteria 2026
312 Ga0207705_10272171 3300025909 Unclassified 1295
313 Ga0207684_10019594 3300025910 Bacteria 5786
314 Ga0207654_10188462 3300025911 Bacteria 1350
315 Ga0207695_10000739 3300025913 Bacteria 63264
316 Ga0207695_10366422 3300025913 Bacteria 1327
317 Ga0207663_10009233 3300025916 Bacteria 5202
318 Ga0207662_10001818 3300025918 Bacteria 10475
319 Ga0207662_10067399 3300025918 Bacteria 2159
320 Ga0207657_10041050 3300025919 Bacteria 4094
321 Ga0207649_10078094 3300025920 Bacteria 2135
322 Ga0207646_10133980 3300025922 Bacteria 2231
323 Ga0207681_10131700 3300025923 Bacteria 1850
324 Ga0207681_10185837 3300025923 Bacteria 1586
325 Ga0207694_10116619 3300025924 Bacteria 2128
326 Ga0207650_10000856 3300025925 Bacteria 23101
327 Ga0207650_10043175 3300025925 Bacteria 3309
328 Ga0207650_10302337 3300025925 Bacteria 1307
329 Ga0207650_10532929 3300025925 Bacteria 983
330 Ga0207659_10001396 3300025926 Bacteria 14395
331 Ga0207659_10094953 3300025926 Bacteria 2235
332 Ga0207659_10117768 3300025926 Bacteria 2030
333 Ga0207659_10484234 3300025926 Bacteria 1046
334 Ga0207687_10125912 3300025927 Bacteria 1923
335 Ga0207687_10728662 3300025927 Bacteria 843
336 Ga0207644_10018092 3300025931 Bacteria 4764
337 Ga0207644_10030603 3300025931 Bacteria 3745
338 Ga0207644_10086595 3300025931 Bacteria 2326
339 Ga0207644_10209862 3300025931 Bacteria 1539
340 Ga0207644_10257453 3300025931 Bacteria 1394
341 Ga0207690_10052886 3300025932 Bacteria 2722
342 Ga0207690_10152525 3300025932 Bacteria 1714
343 Ga0207706_10006621 3300025933 Bacteria 10724
344 Ga0207706_10079459 3300025933 Bacteria 2884
345 Ga0207706_10102599 3300025933 Bacteria 2516
346 Ga0207706_10157950 3300025933 Bacteria 1994
347 Ga0207686_10008279 3300025934 Bacteria 5611
348 Ga0207709_10003293 3300025935 Bacteria 9694
349 Ga0207709_10127833 3300025935 Bacteria 1727
350 Ga0207709_10154628 3300025935 Bacteria 1592
351 Ga0207709_10491146 3300025935 Bacteria 956
352 Ga0207670_10011864 3300025936 Bacteria 5074
353 Ga0207669_10042458 3300025937 Bacteria 2655
354 Ga0207704_10011710 3300025938 Bacteria 4331
355 Ga0207704_10608494 3300025938 Bacteria 895
356 Ga0207665_10169566 3300025939 Bacteria 1575
357 Ga0207691_10042905 3300025940 Bacteria 4169
358 Ga0207691_10110267 3300025940 Bacteria 2448
359 Ga0207691_10133300 3300025940 Bacteria 2193
360 Ga0207691_10156980 3300025940 Bacteria 1998
361 Ga0207711_10040669 3300025941 Bacteria 3955
362 Ga0207711_10073327 3300025941 Bacteria 2975
363 Ga0207689_10001177 3300025942 Bacteria 25141
364 Ga0207689_10005845 3300025942 Bacteria 10904
365 Ga0207661_11040760 3300025944 Bacteria 754
366 Ga0207679_10007872 3300025945 Bacteria 6770
367 Ga0207679_10351562 3300025945 Bacteria 1285
368 Ga0207667_10123620 3300025949 Bacteria 2666
369 Ga0207651_10009043 3300025960 Bacteria 5421
370 Ga0207651_10024787 3300025960 Bacteria 3717
371 Ga0207651_10064944 3300025960 Bacteria 2557
372 Ga0207651_10205883 3300025960 Bacteria 1580
373 Ga0207651_10256796 3300025960 Bacteria 1433
374 Ga0207712_10676406 3300025961 Bacteria 899
375 Ga0207668_10011422 3300025972 Bacteria 5395
376 Ga0207640_10000058 3300025981 Bacteria 92862
377 Ga0207640_10038517 3300025981 Bacteria 3018
378 Ga0207658_10005206 3300025986 Bacteria 8952
379 Ga0207658_10005491 3300025986 Bacteria 8691
380 Ga0207658_10093633 3300025986 Bacteria 2336
381 Ga0207677_10001603 3300026023 Bacteria 12013
382 Ga0207677_10014282 3300026023 Bacteria 4632
383 Ga0207677_10115678 3300026023 Bacteria 2007
384 Ga0207703_10001832 3300026035 Bacteria 18948
385 Ga0207703_10007388 3300026035 Bacteria 8730
386 Ga0207639_10036440 3300026041 Bacteria 3645
387 Ga0207639_10113223 3300026041 Bacteria 2216
388 Ga0207639_10142888 3300026041 Bacteria 1996
389 Ga0207678_10013824 3300026067 Bacteria 7093
390 Ga0207678_10135116 3300026067 Bacteria 2104
391 Ga0207708_10009773 3300026075 Bacteria 7118
392 Ga0207641_10004752 3300026088 Bacteria 11709
393 Ga0207641_10007502 3300026088 Bacteria 9077
394 Ga0207641_10054157 3300026088 Bacteria 3403
395 Ga0207641_10480487 3300026088 Bacteria 1204
396 Ga0207648_10008479 3300026089 Bacteria 9946
397 Ga0207648_10009736 3300026089 Bacteria 9188
398 Ga0207648_10036649 3300026089 Bacteria 4321
399 Ga0207676_10005947 3300026095 Bacteria 8607
400 Ga0207676_10064545 3300026095 Bacteria 2912
401 Ga0207676_10067325 3300026095 Bacteria 2860
402 Ga0207674_10013420 3300026116 Bacteria 9092
403 Ga0207674_10037026 3300026116 Bacteria 5077
404 Ga0207674_10098923 3300026116 Bacteria 2900
405 Ga0207674_10221007 3300026116 Bacteria 1842
406 Ga0207674_10242196 3300026116 Bacteria 1750
407 Ga0207674_10711878 3300026116 Bacteria 969
408 Ga0207675_100017493 3300026118 Bacteria 6691
409 Ga0207675_100069363 3300026118 Bacteria 3295
410 Ga0207675_100886005 3300026118 Bacteria 908
411 Ga0207683_10004171 3300026121 Bacteria 12510
412 Ga0207683_10034448 3300026121 Bacteria 4400
413 Ga0207683_10046071 3300026121 Bacteria 3814
414 Ga0207683_10348811 3300026121 Bacteria 1358
415 Ga0207698_10015788 3300026142 Bacteria 5071
416 Ga0207698_10022489 3300026142 Bacteria 4383
417 Ga0207698_10171911 3300026142 Bacteria 1909
418 Ga0209282_1000148 3300027666 Bacteria 41213
419 Ga0209282_1000271 3300027666 Bacteria 25770
420 Ga0209282_1092749 3300027666 Bacteria 1577
421 Ga0207428_10061830 3300027907 Bacteria 2963
422 Ga0207428_10188209 3300027907 Bacteria 1557
423 Ga0268266_10195415 3300028379 Bacteria 1849
424 Ga0268265_10028549 3300028380 Bacteria 3995
425 Ga0268265_10167875 3300028380 Bacteria 1872
426 Ga0268265_10538108 3300028380 Bacteria 1107
427 Ga0268264_10032047 3300028381 Bacteria 4312
428 Ga0268264_10644293 3300028381 Bacteria 1048
429 Ga0268264_10837644 3300028381 Bacteria 921
430 Ga0316181_1140414 3300030744 Bacteria 1086
431 Ga0265332_10000014 3300031238 Bacteria 249035
432 Ga0265328_10034067 3300031239 Bacteria 1886
433 Ga0265327_10026190 3300031251 Bacteria 3383
434 Ga0307408_100025535 3300031548 Bacteria 4047
435 Ga0307408_100067122 3300031548 Bacteria 2637
436 Ga0307408_100239453 3300031548 Bacteria 1490
437 Ga0307408_100315472 3300031548 Bacteria 1315
438 Ga0307408_100504090 3300031548 Bacteria 1060
439 Ga0307408_100611555 3300031548 Bacteria 970
440 Ga0307408_100638469 3300031548 Bacteria 950
441 Ga0307508_10000540 3300031616 Bacteria 44861
442 Ga0316575_10106083 3300031665 Bacteria 1144
443 Ga0316578_10229714 3300031728 Unclassified 1115
444 Ga0307516_10002755 3300031730 Bacteria 23168
445 Ga0307405_10087738 3300031731 Bacteria 2051
446 Ga0307413_10049566 3300031824 Bacteria 2517
447 Ga0307413_10065116 3300031824 Bacteria 2268
448 Ga0307410_10046909 3300031852 Bacteria 2885
449 Ga0307406_10086285 3300031901 Bacteria 2101
450 Ga0307407_10336374 3300031903 Bacteria 1064
451 Ga0307412_10077763 3300031911 Bacteria 2283
452 Ga0307412_10128185 3300031911 Bacteria 1839
453 Ga0307412_10129338 3300031911 Bacteria 1831
454 Ga0307412_10191498 3300031911 Bacteria 1546
455 Ga0307409_100073132 3300031995 Bacteria 2733
456 Ga0307409_100261529 3300031995 Bacteria 1588
457 Ga0307416_100129803 3300032002 Bacteria 2266
458 Ga0307416_100627346 3300032002 Bacteria 1157
459 Ga0307414_10030580 3300032004 Bacteria 3520
460 Ga0307414_10089167 3300032004 Bacteria 2285
461 Ga0307411_10084373 3300032005 Bacteria 2197
462 Ga0307510_10202538 3300033180 Bacteria 1517
463 Ga0373944_0024531 3300035089 Bacteria 1768
464 Ga0373943_0240013 3300035170 Bacteria 1015
465 Ga0373946_0084044 3300035171 Bacteria 1399
466 Ga0316574_0042028 3300035398 Bacteria 2819
467 Ga0373924_0163708 3300035410 Bacteria 976
468 Ga0373927_0111346 3300035695 Bacteria 1784
469 Ga0373947_0161205 3300035725 Bacteria 1450
470 Ga0373937_0781581 3300036401 Bacteria 902
471 Ga0316584_0478966 3300036712 Unclassified 877
472 Ga0373925_0003358 3300037068 Bacteria 12416
473 Ga0373925_0005178 3300037068 Bacteria 9762
474 Ga0373925_0147075 3300037068 Bacteria 1847
475 Ga0395899_0000167 3300037312 Bacteria 100973
476 Ga0395899_0202396 3300037312 Bacteria 1384
477 Ga0395900_0000009 3300037418 Bacteria 476249
478 Ga0395900_0004085 3300037418 Bacteria 15559
479 Ga0395900_0033996 3300037418 Bacteria 5248
480 Ga0395898_0016157 3300037466 Bacteria 7644
481 Ga0395898_0527700 3300037466 Bacteria 1122
482 Ga0395905_0000954 3300037471 Bacteria 37082
483 Ga0395905_0007853 3300037471 Bacteria 10567
484 Ga0395905_0014728 3300037471 Bacteria 7456
485 Ga0395905_0109667 3300037471 Bacteria 2591
486 Ga0395905_0273363 3300037471 Bacteria 1575
487 Ga0395905_0472423 3300037471 Bacteria 1153
488 Ga0436364_1510508 3300037853 Bacteria 1335
489 Ga0395901_0000014 3300038443 Bacteria 375100
490 Ga0395901_0081149 3300038443 Bacteria 3388
491 Ga0395901_0090234 3300038443 Bacteria 3208
492 Ga0436365_0010849 3300039437 Bacteria 1025
493 Ga0436365_0045417 3300039437 Bacteria 1544
494 Ga0436365_1112386 3300039437 Bacteria 3401
495 Ga0439436_0091158 3300041404 Bacteria 849
496 Ga0439439_0021499 3300041406 Bacteria 1608
497 Ga0439447_017483 3300041407 Bacteria 1952
498 Ga0439461_0008914 3300041410 Bacteria 1810
499 Ga0439466_0013462 3300041411 Bacteria 2994
500 Ga0439465_0002620 3300041413 Bacteria 5872
501 Ga0439431_0009625 3300041997 Bacteria 2183
502 Ga0439433_0004321 3300041999 Bacteria 3061
503 Ga0439442_014798 3300042002 Bacteria 1606
504 Ga0439432_005849 3300042006 Bacteria 4413
505 Ga0439432_014181 3300042006 Bacteria 2698
506 Ga0439449_0000247 3300042007 Bacteria 19331
507 Ga0439449_0005204 3300042007 Bacteria 4991
508 Ga0439449_0017901 3300042007 Bacteria 2659
509 Ga0439452_009766 3300042010 Bacteria 2817
510 Ga0439457_017767 3300042014 Bacteria 1579
511 Ga0439462_0008533 3300042015 Bacteria 2586
512 Ga0439462_0021195 3300042015 Bacteria 1696
513 Ga0439462_0086393 3300042015 Bacteria 858
514 Ga0450920_024778 3300042122 Bacteria 1166
515 Ga0450890_002097 3300042127 Bacteria 2796
516 Ga0450896_022952 3300042133 Bacteria 921
517 Ga0450898_018504 3300042134 Bacteria 1207
518 Ga0450903_017704 3300042138 Bacteria 1112
519 Ga0439446_0038133 3300042156 Bacteria 1408
520 Ga0439434_0022567 3300042435 Bacteria 1892
521 Ga0439459_0023475 3300042438 Bacteria 1202
522 Ga0450918_001959 3300042531 Bacteria 3973
523 Ga0451577_0117470 3300042876 Bacteria 2382
524 Ga0466969_0049815 3300044656 Bacteria 2066
525 Ga0453683_0002378 3300044673 Bacteria 14700
526 Ga0466970_0294801 3300044765 Bacteria 914
527 Ga0451576_0007815 3300045051 Bacteria 12675
528 Ga0451576_0705789 3300045051 Bacteria 1060
529 Ga0466967_0080851 3300045976 Bacteria 2934
530 Ga0495617_000173 3300046452 Bacteria 40755
531 Ga0495629_0207622 3300046459 Bacteria 1353
532 Ga0495580_0000052 3300046472 Bacteria 66203
533 Ga0495580_0219698 3300046472 Bacteria 1306
534 Ga0495605_0000191 3300046474 Bacteria 76513
535 Ga0495605_0002922 3300046474 Bacteria 10362
536 Ga0495596_0000184 3300046500 Bacteria 43662
537 Ga0495607_0007490 3300046501 Bacteria 7546
538 Ga0495610_0000362 3300046512 Bacteria 47404
539 Ga0495610_0065701 3300046512 Bacteria 1711
540 Ga0495616_0004205 3300046513 Bacteria 9118
541 Ga0495632_0005145 3300046519 Bacteria 8731
542 Ga0495648_0021496 3300046524 Bacteria 4464
543 Ga0495598_0036444 3300046537 Bacteria 1413
544 Ga0495609_0007914 3300046538 Bacteria 5253
545 Ga0495621_0077057 3300046539 Bacteria 1237
546 Ga0495597_0009759 3300046542 Bacteria 4727
547 Ga0495633_0085213 3300046558 Bacteria 1470
548 Ga0495633_0137254 3300046558 Bacteria 1131
549 Ga0495656_0012345 3300046615 Bacteria 3150
550 Ga0495656_0042534 3300046615 Bacteria 1903
551 Ga0495625_0000224 3300046660 Bacteria 89521
552 Ga0495625_0033145 3300046660 Bacteria 3823
553 Ga0495659_0120422 3300046664 Bacteria 1033
554 Ga0495661_0002318 3300046665 Bacteria 14690
555 Ga0495599_0219509 3300046678 Bacteria 1164
556 Ga0495658_0098803 3300046683 Bacteria 1739
557 Ga0495669_0072193 3300046684 Bacteria 1575
558 Ga0495671_0002080 3300046692 Bacteria 12832
559 Ga0495649_0001610 3300046694 Bacteria 16823
560 Ga0495660_0014552 3300046810 Bacteria 4550
561 Ga0495581_0267370 3300047315 Bacteria 1000
562 Ga0495674_0044424 3300047319 Bacteria 3951
563 Ga0495672_0009637 3300047320 Bacteria 6970
564 Ga0495687_000196 3300047443 Bacteria 87053
565 Ga0495687_018609 3300047443 Bacteria 3431
566 Ga0495687_075566 3300047443 Bacteria 1335
567 Ga0495685_007602 3300047447 Bacteria 3584
568 Ga0495684_0114960 3300047471 Bacteria 2029
569 Ga0495686_0000966 3300047472 Bacteria 35392
570 Ga0495614_0079503 3300048089 Bacteria 1420
571 Ga0495626_0041260 3300048091 Bacteria 2175
572 Ga0496100_0161959 3300048903 Bacteria 1604
573 Ga0496100_0552865 3300048903 Bacteria 891
574 Ga0496101_0000635 3300048904 Bacteria 21296
575 Ga0496101_0471835 3300048904 Bacteria 991
576 Ga0496102_0005808 3300048905 Bacteria 10492
577 Ga0496102_0075001 3300048905 Bacteria 3109
578 Ga0496102_0300799 3300048905 Unclassified 1512
579 Ga0496103_0190326 3300048906 Bacteria 1319
580 Ga0496104_0024424 3300048907 Bacteria 5558
581 Ga0496104_0103618 3300048907 Unclassified 2726
582 Ga0496105_0013557 3300048908 Bacteria 6475
583 Ga0496106_0108055 3300048909 Unclassified 2164
584 Ga0496106_0242495 3300048909 Bacteria 1440
585 Ga0496106_0338159 3300048909 Bacteria 1209
586 Ga0496107_0015376 3300048910 Bacteria 5363
587 Ga0496107_0088700 3300048910 Bacteria 2258
588 Ga0496107_0134240 3300048910 Bacteria 1828
589 Ga0496108_0051852 3300048911 Bacteria 3437
590 Ga0496108_0193817 3300048911 Bacteria 1762
591 Ga0496108_0242938 3300048911 Bacteria 1566
592 Ga0496108_0320276 3300048911 Unclassified 1352
593 Ga0496109_0149812 3300048912 Bacteria 2184
594 Ga0496109_0284743 3300048912 Bacteria 1558
595 Ga0496109_0412295 3300048912 Bacteria 1276
596 Ga0496110_0074208 3300048913 Bacteria 3020
597 Ga0496110_0106461 3300048913 Bacteria 2516
598 Ga0496111_0018220 3300048914 Bacteria 4863
599 Ga0496111_0260751 3300048914 Bacteria 1286
600 Ga0496112_0123866 3300048915 Bacteria 2556
601 Ga0496113_0111883 3300048916 Bacteria 2126
602 Ga0496113_0187121 3300048916 Bacteria 1643
603 Ga0496114_0076605 3300048917 Bacteria 2818
604 Ga0496115_0009542 3300048918 Bacteria 7209
605 Ga0496115_0119214 3300048918 Unclassified 2170
606 Ga0496116_0002766 3300048919 Bacteria 18026
607 Ga0496116_0083250 3300048919 Bacteria 1976
608 Ga0496117_0017981 3300048920 Bacteria 5883
609 Ga0496118_0110091 3300048921 Bacteria 1831
610 Ga0496121_0002439 3300048924 Bacteria 28439
611 Ga0496121_0044718 3300048924 Bacteria 3815
612 Ga0496122_0004611 3300048925 Bacteria 16964
613 Ga0496123_0002704 3300048926 Bacteria 21311
614 Ga0496124_0139835 3300048927 Bacteria 1912
615 Ga0496125_0085219 3300048928 Bacteria 2395
616 Ga0495682_0017412 3300049460 Bacteria 2713
617 Ga0501032_0045980 3300049569 Bacteria 2951
618 Ga0501032_0111620 3300049569 Bacteria 1809
619 Ga0501033_0000165 3300049570 Bacteria 63213
620 Ga0501034_0018663 3300049571 Bacteria 7109
621 Ga0501034_0615750 3300049571 Bacteria 990
622 Ga0501036_0276376 3300049572 Bacteria 1406
623 Ga0501037_0023650 3300049573 Bacteria 4543
624 Ga0501038_0154089 3300049574 Bacteria 1872
625 Ga0501047_0069235 3300049581 Bacteria 3398
626 Ga0501068_0100682 3300049584 Bacteria 1791
627 Ga0501073_0064106 3300049589 Bacteria 2562
628 Ga0501080_0000678 3300049742 Bacteria 27197
629 Ga0501083_0219998 3300049744 Bacteria 1237
630 Ga0501035_0001055 3300049822 Bacteria 28892
631 Ga0501044_0264268 3300049823 Bacteria 1658
632 nmdc:mga03683_2500_c1 3300050489 Bacteria 5721
633 nmdc:mga03683_87072_c1 3300050489 Bacteria 1357
634 nmdc:mga03n38_38719_c1 3300050490 Bacteria 2064
635 nmdc:mga0yw44_385983_c1 3300050492 Bacteria 946
636 nmdc:mga0k408_168172_c1 3300050493 Bacteria 1307
637 nmdc:mga0k408_287262_c1 3300050493 Bacteria 982
638 nmdc:mga0k408_319333_c1 3300050493 Bacteria 927
639 nmdc:mga07m45_10347_c1 3300050496 Bacteria 4869
640 nmdc:mga07m45_5338_c1 3300050496 Bacteria 6394
641 nmdc:mga07m45_63216_c1 3300050496 Bacteria 2099
642 nmdc:mga07m45_9761_c1 3300050496 Bacteria 4992
643 nmdc:mga05p37_275394_c1 3300050507 Bacteria 2009
644 nmdc:mga09592_148270_c1 3300050508 Bacteria 2023
645 nmdc:mga0qj67_236595_c1 3300050509 Bacteria 1482
646 nmdc:mga0qj67_36735_c1 3300050509 Bacteria 3835
647 nmdc:mga06r32_267873_c1 3300050510 Bacteria 1696
648 nmdc:mga06r32_727143_c1 3300050510 Bacteria 957
649 nmdc:mga08y16_320507_c1 3300050511 Bacteria 1596
650 nmdc:mga08y16_328123_c1 3300050511 Bacteria 1575
651 nmdc:mga0n895_56020_c1 3300050512 Bacteria 3882
652 nmdc:mga0n895_595761_c1 3300050512 Bacteria 1108
653 nmdc:mga0sz30_2078_c1 3300050516 Bacteria 7150
654 Ga0495619_0105215 3300053085 Bacteria 1924
655 Ga0500608_004413 3300053122 Bacteria 5445
656 Ga0500616_0177739 3300053153 Bacteria 961
657 Ga0466962_0063115 3300061719 Bacteria 1769

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042438 Ga0439459_0023475 Ga0439459_0023475_422_1048 193
2 3300006846 Ga0075430_100296315 Ga0075430_1002963152 223
3 3300042127 Ga0450890_002097 Ga0450890_002097_1891_2628 230
4 3300042138 Ga0450903_017704 Ga0450903_017704_312_1049 230
5 3300003794 Ga0055531_10001478 Ga0055531_100014782 231
6 3300006038 Ga0075365_10282573 Ga0075365_102825732 231
7 3300006178 Ga0075367_10251727 Ga0075367_102517271 231
8 3300025303 Ga0209051_1000025 Ga0209051_1000025104 231
9 3300025304 Ga0209257_1000039 Ga0209257_1000039504 231
10 3300044673 Ga0453683_0002378 Ga0453683_0002378_5729_6466 231
11 3300044765 Ga0466970_0294801 Ga0466970_0294801_50_787 231
12 3300045051 Ga0451576_0007815 Ga0451576_0007815_8423_9160 231
13 3300006058 Ga0075432_10015003 Ga0075432_100150033 232
14 3300006177 Ga0075362_10000626 Ga0075362_100006268 232
15 3300031824 Ga0307413_10065116 Ga0307413_100651162 232
16 3300049574 Ga0501038_0154089 Ga0501038_0154089_228_932 233
17 iso_pu_bacteria 2928115317 2928118164 233
18 3300041404 Ga0439436_0091158 Ga0439436_0091158_25_729 234
19 3300048907 Ga0496104_0103618 Ga0496104_0103618_471_1184 235
20 3300006844 Ga0075428_100204783 Ga0075428_1002047833 236
21 3300006846 Ga0075430_100139949 Ga0075430_1001399492 236
22 3300006847 Ga0075431_100005375 Ga0075431_1000053752 236
23 3300050509 nmdc:mga0qj67_236595_c1 nmdc:mga0qj67_236595_c1_53_763 236
24 3300050510 nmdc:mga06r32_727143_c1 nmdc:mga06r32_727143_c1_182_892 236
25 3300042134 Ga0450898_018504 Ga0450898_018504_482_1195 237
26 3300050489 nmdc:mga03683_87072_c1 nmdc:mga03683_87072_c1_161_874 237
27 3300037471 Ga0395905_0472423 Ga0395905_0472423_370_1092 238
28 3300037853 Ga0436364_1510508 Ga0436364_1510508_232_975 238
29 iso_pu_bacteria 2738541307 2738881500 238
30 iso_pu_bacteria 2954767861 2954771609 238
31 3300005347 Ga0070668_100511059 Ga0070668_1005110592 239
32 3300005439 Ga0070711_100017044 Ga0070711_1000170442 239
33 3300005440 Ga0070705_100265918 Ga0070705_1002659182 239
34 3300005530 Ga0070679_100585020 Ga0070679_1005850202 239
35 3300006871 Ga0075434_100247469 Ga0075434_1002474692 239
36 3300009094 Ga0111539_10203014 Ga0111539_102030143 239
37 3300025916 Ga0207663_10009233 Ga0207663_100092333 239
38 3300027907 Ga0207428_10188209 Ga0207428_101882092 239
39 3300035410 Ga0373924_0163708 Ga0373924_0163708_32_757 239
40 3300050511 nmdc:mga08y16_320507_c1 nmdc:mga08y16_320507_c1_668_1393 239
41 3300050512 nmdc:mga0n895_56020_c1 nmdc:mga0n895_56020_c1_2725_3450 239
42 iso_pu_bacteria 2599185178 2599444729 239
43 iso_pu_bacteria 2885266251 2885266356 239
44 iso_pu_bacteria 2928058823 2928059864 239
45 3300005468 Ga0070707_100366167 Ga0070707_1003661672 240
46 3300006038 Ga0075365_10012156 Ga0075365_100121564 240
47 3300009148 Ga0105243_10189747 Ga0105243_101897472 240
48 3300025922 Ga0207646_10133980 Ga0207646_101339803 240
49 3300026089 Ga0207648_10036649 Ga0207648_100366494 240
50 3300028380 Ga0268265_10167875 Ga0268265_101678752 240
51 3300028380 Ga0268265_10538108 Ga0268265_105381082 240
52 3300028381 Ga0268264_10837644 Ga0268264_108376442 240
53 3300031548 Ga0307408_100504090 Ga0307408_1005040902 240
54 3300031728 Ga0316578_10229714 Ga0316578_102297142 240
55 3300031911 Ga0307412_10128185 Ga0307412_101281852 240
56 3300036712 Ga0316584_0478966 Ga0316584_0478966_26_763 240
57 3300046558 Ga0495633_0085213 Ga0495633_0085213_610_1332 240
58 3300046684 Ga0495669_0072193 Ga0495669_0072193_287_1009 240
59 iso_pu_bacteria 2643221603 2644029323 240
60 3300005445 Ga0070708_100289792 Ga0070708_1002897922 241
61 3300006881 Ga0068865_100006103 Ga0068865_1000061032 241
62 3300009551 Ga0105238_10050991 Ga0105238_100509914 241
63 3300013105 Ga0157369_10216882 Ga0157369_102168821 241
64 3300013306 Ga0163162_10138801 Ga0163162_101388013 241
65 3300013306 Ga0163162_10850727 Ga0163162_108507272 241
66 3300025938 Ga0207704_10011710 Ga0207704_100117103 241
67 3300025944 Ga0207661_11040760 Ga0207661_110407601 241
68 3300031730 Ga0307516_10002755 Ga0307516_1000275517 241
69 3300031911 Ga0307412_10077763 Ga0307412_100777633 241
70 3300035089 Ga0373944_0024531 Ga0373944_0024531_86_811 241
71 3300035170 Ga0373943_0240013 Ga0373943_0240013_251_976 241
72 3300035725 Ga0373947_0161205 Ga0373947_0161205_438_1163 241
73 3300037068 Ga0373925_0003358 Ga0373925_0003358_1009_1734 241
74 3300037312 Ga0395899_0000167 Ga0395899_0000167_22479_23204 241
75 3300037418 Ga0395900_0000009 Ga0395900_0000009_383174_383899 241
76 3300037466 Ga0395898_0016157 Ga0395898_0016157_4503_5228 241
77 3300037471 Ga0395905_0007853 Ga0395905_0007853_7575_8300 241
78 3300037471 Ga0395905_0014728 Ga0395905_0014728_1053_1778 241
79 3300038443 Ga0395901_0000014 Ga0395901_0000014_334380_335105 241
80 3300047319 Ga0495674_0044424 Ga0495674_0044424_1028_1753 241
81 3300049569 Ga0501032_0111620 Ga0501032_0111620_51_782 241
82 3300049571 Ga0501034_0018663 Ga0501034_0018663_791_1522 241
83 3300049572 Ga0501036_0276376 Ga0501036_0276376_37_774 241
84 3300049573 Ga0501037_0023650 Ga0501037_0023650_1617_2348 241
85 3300049581 Ga0501047_0069235 Ga0501047_0069235_1084_1815 241
86 3300049584 Ga0501068_0100682 Ga0501068_0100682_702_1433 241
87 3300049589 Ga0501073_0064106 Ga0501073_0064106_1692_2423 241
88 3300049742 Ga0501080_0000678 Ga0501080_0000678_17565_18296 241
89 3300049744 Ga0501083_0219998 Ga0501083_0219998_492_1223 241
90 3300049823 Ga0501044_0264268 Ga0501044_0264268_348_1079 241
91 iso_pu_bacteria 2643221665 2644362327 241
92 iso_pu_bacteria 2738543013 2739249395 241
93 3300005328 Ga0070676_10118212 Ga0070676_101182122 242
94 3300005330 Ga0070690_100001686 Ga0070690_1000016868 242
95 3300005331 Ga0070670_100361184 Ga0070670_1003611841 242
96 3300005333 Ga0070677_10060993 Ga0070677_100609931 242
97 3300005335 Ga0070666_10007800 Ga0070666_100078003 242
98 3300005338 Ga0068868_100000814 Ga0068868_1000008143 242
99 3300005340 Ga0070689_100007835 Ga0070689_1000078356 242
100 3300005343 Ga0070687_100129053 Ga0070687_1001290532 242
101 3300005347 Ga0070668_100035227 Ga0070668_1000352273 242
102 3300005353 Ga0070669_100045715 Ga0070669_1000457152 242
103 3300005354 Ga0070675_100000562 Ga0070675_1000005627 242
104 3300005355 Ga0070671_100004823 Ga0070671_1000048237 242
105 3300005364 Ga0070673_100005821 Ga0070673_1000058216 242
106 3300005444 Ga0070694_100039919 Ga0070694_1000399194 242
107 3300005456 Ga0070678_100010669 Ga0070678_1000106694 242
108 3300005457 Ga0070662_100046327 Ga0070662_1000463272 242
109 3300005459 Ga0068867_100041458 Ga0068867_1000414582 242
110 3300005467 Ga0070706_100002496 Ga0070706_1000024964 242
111 3300005549 Ga0070704_100019332 Ga0070704_1000193325 242
112 3300005616 Ga0068852_100014277 Ga0068852_1000142776 242
113 3300005617 Ga0068859_100125212 Ga0068859_1001252122 242
114 3300005618 Ga0068864_100000666 Ga0068864_10000066615 242
115 3300005719 Ga0068861_100311637 Ga0068861_1003116372 242
116 3300005841 Ga0068863_100000585 Ga0068863_1000005857 242
117 3300005842 Ga0068858_100004762 Ga0068858_1000047626 242
118 3300005843 Ga0068860_100150781 Ga0068860_1001507813 242
119 3300005844 Ga0068862_100057153 Ga0068862_1000571532 242
120 3300005844 Ga0068862_100153122 Ga0068862_1001531222 242
121 3300006358 Ga0068871_100156753 Ga0068871_1001567531 242
122 3300006846 Ga0075430_100098468 Ga0075430_1000984682 242
123 3300006846 Ga0075430_100756689 Ga0075430_1007566891 242
124 3300006847 Ga0075431_100127842 Ga0075431_1001278422 242
125 3300006852 Ga0075433_10367920 Ga0075433_103679201 242
126 3300006852 Ga0075433_10633349 Ga0075433_106333491 242
127 3300006931 Ga0097620_100125211 Ga0097620_1001252112 242
128 3300006931 Ga0097620_100158505 Ga0097620_1001585053 242
129 3300006948 Ga0099826_10000019 Ga0099826_1000001996 242
130 3300009098 Ga0105245_10266984 Ga0105245_102669842 242
131 3300009147 Ga0114129_10286641 Ga0114129_102866412 242
132 3300009176 Ga0105242_10402952 Ga0105242_104029522 242
133 3300009177 Ga0105248_10056296 Ga0105248_100562961 242
134 3300009177 Ga0105248_10130470 Ga0105248_101304702 242
135 3300009553 Ga0105249_10039617 Ga0105249_100396172 242
136 3300013297 Ga0157378_10144762 Ga0157378_101447623 242
137 3300013306 Ga0163162_10100125 Ga0163162_101001252 242
138 3300013308 Ga0157375_10025238 Ga0157375_100252383 242
139 3300013308 Ga0157375_10208598 Ga0157375_102085982 242
140 3300014325 Ga0163163_10006619 Ga0163163_100066197 242
141 3300014326 Ga0157380_10851981 Ga0157380_108519811 242
142 3300014968 Ga0157379_10003595 Ga0157379_100035954 242
143 3300014969 Ga0157376_10006041 Ga0157376_100060416 242
144 3300025899 Ga0207642_10019186 Ga0207642_100191862 242
145 3300025907 Ga0207645_10087978 Ga0207645_100879782 242
146 3300025910 Ga0207684_10019594 Ga0207684_100195943 242
147 3300025918 Ga0207662_10067399 Ga0207662_100673993 242
148 3300025923 Ga0207681_10185837 Ga0207681_101858371 242
149 3300025925 Ga0207650_10302337 Ga0207650_103023371 242
150 3300025926 Ga0207659_10001396 Ga0207659_100013964 242
151 3300025931 Ga0207644_10018092 Ga0207644_100180925 242
152 3300025933 Ga0207706_10079459 Ga0207706_100794592 242
153 3300025936 Ga0207670_10011864 Ga0207670_100118645 242
154 3300025937 Ga0207669_10042458 Ga0207669_100424582 242
155 3300025941 Ga0207711_10073327 Ga0207711_100733274 242
156 3300025960 Ga0207651_10009043 Ga0207651_100090434 242
157 3300025961 Ga0207712_10676406 Ga0207712_106764061 242
158 3300025986 Ga0207658_10005491 Ga0207658_100054915 242
159 3300026023 Ga0207677_10001603 Ga0207677_100016033 242
160 3300026035 Ga0207703_10007388 Ga0207703_100073884 242
161 3300026088 Ga0207641_10007502 Ga0207641_100075025 242
162 3300026095 Ga0207676_10005947 Ga0207676_100059474 242
163 3300026118 Ga0207675_100886005 Ga0207675_1008860051 242
164 3300026121 Ga0207683_10004171 Ga0207683_100041716 242
165 3300027666 Ga0209282_1000148 Ga0209282_100014820 242
166 3300027907 Ga0207428_10061830 Ga0207428_100618306 242
167 3300028379 Ga0268266_10195415 Ga0268266_101954152 242
168 3300030744 Ga0316181_1140414 Ga0316181_11404141 242
169 3300031548 Ga0307408_100315472 Ga0307408_1003154722 242
170 3300031665 Ga0316575_10106083 Ga0316575_101060831 242
171 3300032004 Ga0307414_10089167 Ga0307414_100891671 242
172 3300035171 Ga0373946_0084044 Ga0373946_0084044_292_1041 242
173 3300035398 Ga0316574_0042028 Ga0316574_0042028_1251_1979 242
174 3300041999 Ga0439433_0004321 Ga0439433_0004321_1331_2059 242
175 3300042876 Ga0451577_0117470 Ga0451577_0117470_1159_1887 242
176 3300044656 Ga0466969_0049815 Ga0466969_0049815_515_1243 242
177 3300046474 Ga0495605_0002922 Ga0495605_0002922_4528_5256 242
178 3300046500 Ga0495596_0000184 Ga0495596_0000184_37229_37957 242
179 3300046501 Ga0495607_0007490 Ga0495607_0007490_6701_7429 242
180 3300046512 Ga0495610_0000362 Ga0495610_0000362_481_1209 242
181 3300046513 Ga0495616_0004205 Ga0495616_0004205_2571_3299 242
182 3300046524 Ga0495648_0021496 Ga0495648_0021496_1959_2687 242
183 3300046537 Ga0495598_0036444 Ga0495598_0036444_640_1368 242
184 3300046538 Ga0495609_0007914 Ga0495609_0007914_555_1283 242
185 3300046539 Ga0495621_0077057 Ga0495621_0077057_104_832 242
186 3300046542 Ga0495597_0009759 Ga0495597_0009759_3165_3893 242
187 3300046558 Ga0495633_0137254 Ga0495633_0137254_140_868 242
188 3300046665 Ga0495661_0002318 Ga0495661_0002318_2354_3082 242
189 3300046683 Ga0495658_0098803 Ga0495658_0098803_508_1257 242
190 3300046692 Ga0495671_0002080 Ga0495671_0002080_4293_5021 242
191 3300047320 Ga0495672_0009637 Ga0495672_0009637_5560_6288 242
192 3300047447 Ga0495685_007602 Ga0495685_007602_118_846 242
193 3300048909 Ga0496106_0338159 Ga0496106_0338159_295_1023 242
194 3300048910 Ga0496107_0088700 Ga0496107_0088700_970_1698 242
195 3300048912 Ga0496109_0149812 Ga0496109_0149812_683_1411 242
196 3300048912 Ga0496109_0284743 Ga0496109_0284743_212_940 242
197 3300048914 Ga0496111_0018220 Ga0496111_0018220_2692_3420 242
198 3300048916 Ga0496113_0187121 Ga0496113_0187121_413_1141 242
199 3300048919 Ga0496116_0002766 Ga0496116_0002766_14219_14947 242
200 3300048924 Ga0496121_0002439 Ga0496121_0002439_5646_6374 242
201 3300048925 Ga0496122_0004611 Ga0496122_0004611_5314_6042 242
202 3300048926 Ga0496123_0002704 Ga0496123_0002704_7392_8120 242
203 3300050507 nmdc:mga05p37_275394_c1 nmdc:mga05p37_275394_c1_888_1616 242
204 3300050509 nmdc:mga0qj67_36735_c1 nmdc:mga0qj67_36735_c1_460_1188 242
205 3300050510 nmdc:mga06r32_267873_c1 nmdc:mga06r32_267873_c1_460_1188 242
206 3300050511 nmdc:mga08y16_328123_c1 nmdc:mga08y16_328123_c1_703_1497 242
207 3300061719 Ga0466962_0063115 Ga0466962_0063115_615_1343 242
208 iso_pu_bacteria 2643221628 2644158982 242
209 iso_pu_bacteria 2643221658 2644328269 242
210 iso_pu_bacteria 2643221672 2644400120 242
211 iso_pu_bacteria 2885192300 2885195144 242
212 iso_pu_bacteria 2904449895 2904453284 242
213 iso_pu_bacteria 2904456579 2904459278 242
214 iso_pu_bacteria 2929520902 2929525324 242
215 3300002705 JGI25156J39149_1003854 JGI25156J39149_10038544 243
216 3300003578 Ga0006562J51391_1110457 Ga0006562J51391_11104571 243
217 3300003578 Ga0006562J51391_1110458 Ga0006562J51391_11104584 243
218 3300003751 Ga0055538_1002515 Ga0055538_10025152 243
219 3300003756 Ga0055533_1002572 Ga0055533_10025726 243
220 3300003758 Ga0055532_1000048 Ga0055532_1000048141 243
221 3300003761 Ga0055535_1000035 Ga0055535_1000035141 243
222 3300003763 Ga0055529_1000101 Ga0055529_100010129 243
223 3300005327 Ga0070658_10154081 Ga0070658_101540813 243
224 3300005328 Ga0070676_10054380 Ga0070676_100543802 243
225 3300005329 Ga0070683_100095147 Ga0070683_1000951472 243
226 3300005329 Ga0070683_100423180 Ga0070683_1004231801 243
227 3300005330 Ga0070690_100017056 Ga0070690_1000170562 243
228 3300005333 Ga0070677_10025396 Ga0070677_100253962 243
229 3300005333 Ga0070677_10086340 Ga0070677_100863401 243
230 3300005334 Ga0068869_100088813 Ga0068869_1000888132 243
231 3300005338 Ga0068868_100030698 Ga0068868_1000306983 243
232 3300005338 Ga0068868_100084956 Ga0068868_1000849562 243
233 3300005343 Ga0070687_100000820 Ga0070687_1000008208 243
234 3300005344 Ga0070661_100120983 Ga0070661_1001209832 243
235 3300005347 Ga0070668_100001217 Ga0070668_1000012178 243
236 3300005354 Ga0070675_100050345 Ga0070675_1000503451 243
237 3300005355 Ga0070671_100054225 Ga0070671_1000542253 243
238 3300005356 Ga0070674_100117807 Ga0070674_1001178071 243
239 3300005364 Ga0070673_100434680 Ga0070673_1004346801 243
240 3300005367 Ga0070667_100017861 Ga0070667_1000178615 243
241 3300005439 Ga0070711_100318674 Ga0070711_1003186742 243
242 3300005459 Ga0068867_100004609 Ga0068867_1000046095 243
243 3300005535 Ga0070684_100224165 Ga0070684_1002241652 243
244 3300005539 Ga0068853_100033865 Ga0068853_1000338652 243
245 3300005539 Ga0068853_100047135 Ga0068853_1000471353 243
246 3300005543 Ga0070672_100056157 Ga0070672_1000561572 243
247 3300005563 Ga0068855_100043550 Ga0068855_1000435505 243
248 3300005577 Ga0068857_100106310 Ga0068857_1001063102 243
249 3300005577 Ga0068857_100478428 Ga0068857_1004784282 243
250 3300005578 Ga0068854_100000396 Ga0068854_1000003967 243
251 3300005578 Ga0068854_100067625 Ga0068854_1000676253 243
252 3300005614 Ga0068856_100044068 Ga0068856_1000440683 243
253 3300005616 Ga0068852_100078523 Ga0068852_1000785233 243
254 3300005616 Ga0068852_100242421 Ga0068852_1002424212 243
255 3300005617 Ga0068859_100045863 Ga0068859_1000458633 243
256 3300005617 Ga0068859_100184011 Ga0068859_1001840113 243
257 3300005618 Ga0068864_100070863 Ga0068864_1000708633 243
258 3300005618 Ga0068864_100248842 Ga0068864_1002488422 243
259 3300005618 Ga0068864_100414273 Ga0068864_1004142732 243
260 3300005834 Ga0068851_10027581 Ga0068851_100275813 243
261 3300005834 Ga0068851_10073293 Ga0068851_100732932 243
262 3300005834 Ga0068851_10180623 Ga0068851_101806232 243
263 3300005840 Ga0068870_10181875 Ga0068870_101818752 243
264 3300005841 Ga0068863_100009834 Ga0068863_1000098348 243
265 3300005842 Ga0068858_100007104 Ga0068858_1000071049 243
266 3300005843 Ga0068860_100002804 Ga0068860_1000028042 243
267 3300005844 Ga0068862_100030063 Ga0068862_1000300632 243
268 3300006038 Ga0075365_10037769 Ga0075365_100377693 243
269 3300006195 Ga0075366_10158104 Ga0075366_101581042 243
270 3300006237 Ga0097621_100018619 Ga0097621_1000186196 243
271 3300006358 Ga0068871_100115888 Ga0068871_1001158882 243
272 3300006871 Ga0075434_100112835 Ga0075434_1001128352 243
273 3300006871 Ga0075434_100972424 Ga0075434_1009724241 243
274 3300006931 Ga0097620_100045862 Ga0097620_1000458623 243
275 3300006931 Ga0097620_100184001 Ga0097620_1001840013 243
276 3300009093 Ga0105240_10190147 Ga0105240_101901473 243
277 3300009093 Ga0105240_10310580 Ga0105240_103105802 243
278 3300009093 Ga0105240_10440467 Ga0105240_104404672 243
279 3300009174 Ga0105241_10230179 Ga0105241_102301792 243
280 3300009176 Ga0105242_10058464 Ga0105242_100584643 243
281 3300009177 Ga0105248_10106475 Ga0105248_101064753 243
282 3300009551 Ga0105238_10173478 Ga0105238_101734783 243
283 3300009551 Ga0105238_10204266 Ga0105238_102042662 243
284 3300009553 Ga0105249_10029758 Ga0105249_100297584 243
285 3300010375 Ga0105239_10296013 Ga0105239_102960132 243
286 3300013100 Ga0157373_10010780 Ga0157373_100107806 243
287 3300013100 Ga0157373_10067909 Ga0157373_100679093 243
288 3300013105 Ga0157369_10004358 Ga0157369_100043583 243
289 3300013105 Ga0157369_10022415 Ga0157369_100224156 243
290 3300013296 Ga0157374_10100543 Ga0157374_101005433 243
291 3300013296 Ga0157374_10126901 Ga0157374_101269013 243
292 3300013306 Ga0163162_10005819 Ga0163162_100058194 243
293 3300013306 Ga0163162_10121194 Ga0163162_101211943 243
294 3300013307 Ga0157372_10029194 Ga0157372_100291945 243
295 3300013307 Ga0157372_10166503 Ga0157372_101665033 243
296 3300013308 Ga0157375_10007620 Ga0157375_100076208 243
297 3300014968 Ga0157379_10046697 Ga0157379_100466971 243
298 3300014968 Ga0157379_10082433 Ga0157379_100824333 243
299 3300014969 Ga0157376_10092389 Ga0157376_100923893 243
300 3300015261 Ga0182006_1016779 Ga0182006_10167791 243
301 3300020077 Ga0206351_10377698 Ga0206351_103776984 243
302 3300021384 Ga0213876_10024079 Ga0213876_100240792 243
303 3300021384 Ga0213876_10126376 Ga0213876_101263762 243
304 3300025224 Ga0209784_101654 Ga0209784_1016543 243
305 3300025225 Ga0209566_103076 Ga0209566_1030763 243
306 3300025226 Ga0209674_103712 Ga0209674_1037123 243
307 3300025228 Ga0209672_100127 Ga0209672_10012752 243
308 3300025229 Ga0209147_100008 Ga0209147_100008159 243
309 3300025230 Ga0209563_102375 Ga0209563_1023757 243
310 3300025230 Ga0209563_105100 Ga0209563_1051002 243
311 3300025242 Ga0209258_100013 Ga0209258_100013159 243
312 3300025254 Ga0209148_1015709 Ga0209148_10157092 243
313 3300025256 Ga0209759_1004529 Ga0209759_10045296 243
314 3300025272 Ga0209455_1000042 Ga0209455_1000042159 243
315 3300025901 Ga0207688_10029592 Ga0207688_100295922 243
316 3300025907 Ga0207645_10047006 Ga0207645_100470063 243
317 3300025907 Ga0207645_10053872 Ga0207645_100538722 243
318 3300025908 Ga0207643_10427526 Ga0207643_104275261 243
319 3300025909 Ga0207705_10110955 Ga0207705_101109553 243
320 3300025909 Ga0207705_10272171 Ga0207705_102721712 243
321 3300025913 Ga0207695_10000739 Ga0207695_1000073956 243
322 3300025913 Ga0207695_10366422 Ga0207695_103664221 243
323 3300025918 Ga0207662_10001818 Ga0207662_100018188 243
324 3300025919 Ga0207657_10041050 Ga0207657_100410505 243
325 3300025920 Ga0207649_10078094 Ga0207649_100780943 243
326 3300025924 Ga0207694_10116619 Ga0207694_101166193 243
327 3300025925 Ga0207650_10000856 Ga0207650_1000085611 243
328 3300025925 Ga0207650_10532929 Ga0207650_105329291 243
329 3300025926 Ga0207659_10094953 Ga0207659_100949533 243
330 3300025926 Ga0207659_10117768 Ga0207659_101177682 243
331 3300025931 Ga0207644_10086595 Ga0207644_100865953 243
332 3300025931 Ga0207644_10209862 Ga0207644_102098622 243
333 3300025932 Ga0207690_10052886 Ga0207690_100528862 243
334 3300025932 Ga0207690_10152525 Ga0207690_101525252 243
335 3300025934 Ga0207686_10008279 Ga0207686_100082795 243
336 3300025935 Ga0207709_10127833 Ga0207709_101278332 243
337 3300025939 Ga0207665_10169566 Ga0207665_101695661 243
338 3300025940 Ga0207691_10133300 Ga0207691_101333002 243
339 3300025941 Ga0207711_10040669 Ga0207711_100406693 243
340 3300025942 Ga0207689_10001177 Ga0207689_100011775 243
341 3300025942 Ga0207689_10005845 Ga0207689_100058453 243
342 3300025949 Ga0207667_10123620 Ga0207667_101236203 243
343 3300025960 Ga0207651_10064944 Ga0207651_100649442 243
344 3300025960 Ga0207651_10205883 Ga0207651_102058832 243
345 3300025972 Ga0207668_10011422 Ga0207668_100114224 243
346 3300025981 Ga0207640_10000058 Ga0207640_1000005823 243
347 3300025981 Ga0207640_10038517 Ga0207640_100385172 243
348 3300025986 Ga0207658_10005206 Ga0207658_100052068 243
349 3300026035 Ga0207703_10001832 Ga0207703_100018324 243
350 3300026041 Ga0207639_10036440 Ga0207639_100364403 243
351 3300026041 Ga0207639_10113223 Ga0207639_101132232 243
352 3300026067 Ga0207678_10013824 Ga0207678_100138246 243
353 3300026075 Ga0207708_10009773 Ga0207708_100097735 243
354 3300026088 Ga0207641_10004752 Ga0207641_100047528 243
355 3300026088 Ga0207641_10054157 Ga0207641_100541573 243
356 3300026089 Ga0207648_10008479 Ga0207648_100084792 243
357 3300026095 Ga0207676_10064545 Ga0207676_100645453 243
358 3300026095 Ga0207676_10067325 Ga0207676_100673252 243
359 3300026116 Ga0207674_10013420 Ga0207674_100134208 243
360 3300026116 Ga0207674_10098923 Ga0207674_100989233 243
361 3300026118 Ga0207675_100017493 Ga0207675_1000174932 243
362 3300026121 Ga0207683_10034448 Ga0207683_100344483 243
363 3300026142 Ga0207698_10015788 Ga0207698_100157884 243
364 3300026142 Ga0207698_10022489 Ga0207698_100224894 243
365 3300026142 Ga0207698_10171911 Ga0207698_101719112 243
366 3300028380 Ga0268265_10028549 Ga0268265_100285493 243
367 3300028381 Ga0268264_10032047 Ga0268264_100320473 243
368 3300035695 Ga0373927_0111346 Ga0373927_0111346_432_1169 243
369 3300036401 Ga0373937_0781581 Ga0373937_0781581_128_859 243
370 3300037068 Ga0373925_0005178 Ga0373925_0005178_2096_2833 243
371 3300037312 Ga0395899_0202396 Ga0395899_0202396_232_969 243
372 3300037418 Ga0395900_0004085 Ga0395900_0004085_2053_2787 243
373 3300037418 Ga0395900_0033996 Ga0395900_0033996_4170_4907 243
374 3300037471 Ga0395905_0109667 Ga0395905_0109667_27_764 243
375 3300037471 Ga0395905_0273363 Ga0395905_0273363_726_1463 243
376 3300038443 Ga0395901_0090234 Ga0395901_0090234_1060_1797 243
377 3300039437 Ga0436365_0045417 Ga0436365_0045417_479_1225 243
378 3300039437 Ga0436365_1112386 Ga0436365_1112386_368_1099 243
379 3300045976 Ga0466967_0080851 Ga0466967_0080851_1108_1845 243
380 3300046472 Ga0495580_0000052 Ga0495580_0000052_47782_48519 243
381 3300046472 Ga0495580_0219698 Ga0495580_0219698_470_1201 243
382 3300047471 Ga0495684_0114960 Ga0495684_0114960_333_1064 243
383 3300048903 Ga0496100_0552865 Ga0496100_0552865_143_874 243
384 3300048904 Ga0496101_0471835 Ga0496101_0471835_243_974 243
385 3300048905 Ga0496102_0075001 Ga0496102_0075001_1369_2100 243
386 3300048905 Ga0496102_0300799 Ga0496102_0300799_613_1359 243
387 3300048909 Ga0496106_0108055 Ga0496106_0108055_553_1299 243
388 3300048910 Ga0496107_0134240 Ga0496107_0134240_966_1697 243
389 3300048911 Ga0496108_0051852 Ga0496108_0051852_734_1465 243
390 3300048911 Ga0496108_0242938 Ga0496108_0242938_95_826 243
391 3300048911 Ga0496108_0320276 Ga0496108_0320276_115_861 243
392 3300048913 Ga0496110_0106461 Ga0496110_0106461_1155_1886 243
393 3300048914 Ga0496111_0260751 Ga0496111_0260751_220_951 243
394 3300048915 Ga0496112_0123866 Ga0496112_0123866_648_1379 243
395 3300048916 Ga0496113_0111883 Ga0496113_0111883_340_1071 243
396 3300048918 Ga0496115_0009542 Ga0496115_0009542_4017_4748 243
397 3300048918 Ga0496115_0119214 Ga0496115_0119214_244_990 243
398 3300049569 Ga0501032_0045980 Ga0501032_0045980_914_1651 243
399 3300049570 Ga0501033_0000165 Ga0501033_0000165_32372_33109 243
400 3300049822 Ga0501035_0001055 Ga0501035_0001055_26722_27459 243
401 3300050492 nmdc:mga0yw44_385983_c1 nmdc:mga0yw44_385983_c1_57_797 243
402 3300050512 nmdc:mga0n895_595761_c1 nmdc:mga0n895_595761_c1_82_813 243
403 3300053085 Ga0495619_0105215 Ga0495619_0105215_887_1618 243
404 3300005338 Ga0068868_100387269 Ga0068868_1003872691 244
405 3300005345 Ga0070692_10329626 Ga0070692_103296261 244
406 3300005459 Ga0068867_100102432 Ga0068867_1001024322 244
407 3300005543 Ga0070672_100045895 Ga0070672_1000458953 244
408 3300005548 Ga0070665_100364412 Ga0070665_1003644122 244
409 3300005578 Ga0068854_100067736 Ga0068854_1000677363 244
410 3300025315 Ga0207697_10024529 Ga0207697_100245292 244
411 3300025923 Ga0207681_10131700 Ga0207681_101317002 244
412 3300025925 Ga0207650_10043175 Ga0207650_100431753 244
413 3300025933 Ga0207706_10157950 Ga0207706_101579502 244
414 3300025940 Ga0207691_10156980 Ga0207691_101569802 244
415 3300026023 Ga0207677_10014282 Ga0207677_100142822 244
416 3300026067 Ga0207678_10135116 Ga0207678_101351162 244
417 3300026116 Ga0207674_10711878 Ga0207674_107118781 244
418 3300031548 Ga0307408_100611555 Ga0307408_1006115551 244
419 iso_pu_bacteria 2928515477 2928517792 244
420 3300005338 Ga0068868_100052343 Ga0068868_1000523434 245
421 3300005458 Ga0070681_10693433 Ga0070681_106934331 245
422 3300005983 Ga0081540_1001565 Ga0081540_100156515 245
423 3300010375 Ga0105239_10053753 Ga0105239_100537534 245
424 3300014497 Ga0182008_10000669 Ga0182008_1000066919 245
425 3300025256 Ga0209759_1001412 Ga0209759_10014123 245
426 3300026023 Ga0207677_10115678 Ga0207677_101156782 245
427 3300031616 Ga0307508_10000540 Ga0307508_100005409 245
428 3300033180 Ga0307510_10202538 Ga0307510_102025382 245
429 3300039437 Ga0436365_0010849 Ga0436365_0010849_28_768 245
430 3300046452 Ga0495617_000173 Ga0495617_000173_27426_28163 245
431 3300046512 Ga0495610_0065701 Ga0495610_0065701_499_1236 245
432 3300046519 Ga0495632_0005145 Ga0495632_0005145_3824_4561 245
433 3300046694 Ga0495649_0001610 Ga0495649_0001610_9737_10474 245
434 3300046810 Ga0495660_0014552 Ga0495660_0014552_1715_2452 245
435 3300047443 Ga0495687_018609 Ga0495687_018609_307_1044 245
436 3300047443 Ga0495687_075566 Ga0495687_075566_295_1032 245
437 3300047472 Ga0495686_0000966 Ga0495686_0000966_29394_30134 245
438 3300048091 Ga0495626_0041260 Ga0495626_0041260_629_1366 245
439 3300049460 Ga0495682_0017412 Ga0495682_0017412_1868_2605 245
440 3300001989 JGI24739J22299_10019621 JGI24739J22299_100196213 246
441 3300003187 JGI25151J46595_10000732 JGI25151J46595_1000073219 246
442 3300003578 Ga0006562J51391_1113999 Ga0006562J51391_11139992 246
443 3300003578 Ga0006562J51391_1114001 Ga0006562J51391_11140012 246
444 3300003771 Ga0055526_1009224 Ga0055526_10092242 246
445 3300003773 Ga0055537_1000211 Ga0055537_100021118 246
446 3300003773 Ga0055537_1001221 Ga0055537_10012217 246
447 3300003775 Ga0055524_1001351 Ga0055524_10013518 246
448 3300003781 Ga0055536_1001127 Ga0055536_100112716 246
449 3300003784 Ga0055534_1000210 Ga0055534_100021019 246
450 3300003790 Ga0055528_1000852 Ga0055528_10008527 246
451 3300003790 Ga0055528_1033087 Ga0055528_10330872 246
452 3300003791 Ga0055530_10012071 Ga0055530_100120714 246
453 3300003792 Ga0055540_1000142 Ga0055540_100014256 246
454 3300003792 Ga0055540_1000440 Ga0055540_100044025 246
455 3300003794 Ga0055531_10000424 Ga0055531_1000042419 246
456 3300005288 Ga0065714_10002999 Ga0065714_1000299914 246
457 3300005327 Ga0070658_10157981 Ga0070658_101579812 246
458 3300005328 Ga0070676_10008256 Ga0070676_100082564 246
459 3300005328 Ga0070676_10035874 Ga0070676_100358742 246
460 3300005334 Ga0068869_100135729 Ga0068869_1001357291 246
461 3300005335 Ga0070666_10532240 Ga0070666_105322401 246
462 3300005338 Ga0068868_100033575 Ga0068868_1000335752 246
463 3300005344 Ga0070661_100526060 Ga0070661_1005260601 246
464 3300005364 Ga0070673_100033026 Ga0070673_1000330263 246
465 3300005364 Ga0070673_100845287 Ga0070673_1008452871 246
466 3300005366 Ga0070659_100062096 Ga0070659_1000620963 246
467 3300005367 Ga0070667_100064340 Ga0070667_1000643402 246
468 3300005445 Ga0070708_100023257 Ga0070708_1000232573 246
469 3300005457 Ga0070662_100019528 Ga0070662_1000195282 246
470 3300005457 Ga0070662_100069781 Ga0070662_1000697813 246
471 3300005539 Ga0068853_100181082 Ga0068853_1001810822 246
472 3300005543 Ga0070672_100012578 Ga0070672_1000125785 246
473 3300005543 Ga0070672_100061128 Ga0070672_1000611282 246
474 3300005545 Ga0070695_100164525 Ga0070695_1001645253 246
475 3300005564 Ga0070664_100047384 Ga0070664_1000473842 246
476 3300005564 Ga0070664_100364151 Ga0070664_1003641512 246
477 3300005577 Ga0068857_100118879 Ga0068857_1001188792 246
478 3300005577 Ga0068857_100181224 Ga0068857_1001812242 246
479 3300005841 Ga0068863_100523186 Ga0068863_1005231862 246
480 3300005843 Ga0068860_100681797 Ga0068860_1006817971 246
481 3300006048 Ga0075363_100236535 Ga0075363_1002365351 246
482 3300006177 Ga0075362_10020852 Ga0075362_100208522 246
483 3300006177 Ga0075362_10037317 Ga0075362_100373172 246
484 3300006186 Ga0075369_10017548 Ga0075369_100175482 246
485 3300006195 Ga0075366_10005412 Ga0075366_100054129 246
486 3300006353 Ga0075370_10001410 Ga0075370_1000141011 246
487 3300006353 Ga0075370_10003126 Ga0075370_100031261 246
488 3300006353 Ga0075370_10003497 Ga0075370_100034978 246
489 3300006353 Ga0075370_10049456 Ga0075370_100494563 246
490 3300006358 Ga0068871_100335788 Ga0068871_1003357882 246
491 3300006358 Ga0068871_100433289 Ga0068871_1004332891 246
492 3300006846 Ga0075430_100062615 Ga0075430_1000626152 246
493 3300006880 Ga0075429_100097936 Ga0075429_1000979363 246
494 3300006881 Ga0068865_100077319 Ga0068865_1000773193 246
495 3300006881 Ga0068865_100170487 Ga0068865_1001704872 246
496 3300006881 Ga0068865_100228416 Ga0068865_1002284162 246
497 3300006948 Ga0099826_10000124 Ga0099826_1000012424 246
498 3300006948 Ga0099826_10111361 Ga0099826_101113612 246
499 3300009036 Ga0105244_10003295 Ga0105244_1000329514 246
500 3300009036 Ga0105244_10102435 Ga0105244_101024351 246
501 3300009092 Ga0105250_10030527 Ga0105250_100305271 246
502 3300009093 Ga0105240_10919149 Ga0105240_109191491 246
503 3300009098 Ga0105245_10155162 Ga0105245_101551622 246
504 3300009098 Ga0105245_10183341 Ga0105245_101833412 246
505 3300009148 Ga0105243_10003586 Ga0105243_1000358611 246
506 3300009148 Ga0105243_10063029 Ga0105243_100630292 246
507 3300009148 Ga0105243_10491158 Ga0105243_104911582 246
508 3300009148 Ga0105243_10628500 Ga0105243_106285002 246
509 3300009174 Ga0105241_10147033 Ga0105241_101470332 246
510 3300009551 Ga0105238_10169153 Ga0105238_101691532 246
511 3300009553 Ga0105249_10018226 Ga0105249_100182269 246
512 3300010375 Ga0105239_10425490 Ga0105239_104254902 246
513 3300011119 Ga0105246_10076816 Ga0105246_100768163 246
514 3300011119 Ga0105246_10672405 Ga0105246_106724051 246
515 3300013100 Ga0157373_10008499 Ga0157373_100084996 246
516 3300013102 Ga0157371_10002198 Ga0157371_100021988 246
517 3300013306 Ga0163162_10059527 Ga0163162_100595273 246
518 3300014326 Ga0157380_10581210 Ga0157380_105812102 246
519 3300014497 Ga0182008_10011327 Ga0182008_100113274 246
520 3300014497 Ga0182008_10011982 Ga0182008_100119824 246
521 3300014745 Ga0157377_10139293 Ga0157377_101392932 246
522 3300015261 Ga0182006_1003951 Ga0182006_10039515 246
523 3300015261 Ga0182006_1006971 Ga0182006_10069716 246
524 3300015261 Ga0182006_1009607 Ga0182006_10096073 246
525 3300015262 Ga0182007_10003759 Ga0182007_100037595 246
526 3300015262 Ga0182007_10015387 Ga0182007_100153873 246
527 3300017792 Ga0163161_10005078 Ga0163161_100050786 246
528 3300017792 Ga0163161_10056146 Ga0163161_100561464 246
529 3300025263 Ga0209565_1000039 Ga0209565_1000039141 246
530 3300025263 Ga0209565_1000077 Ga0209565_100007727 246
531 3300025273 Ga0209673_1000146 Ga0209673_1000146123 246
532 3300025273 Ga0209673_1024153 Ga0209673_10241532 246
533 3300025291 Ga0209675_1000030 Ga0209675_1000030141 246
534 3300025291 Ga0209675_1002647 Ga0209675_10026473 246
535 3300025292 Ga0209676_1000152 Ga0209676_1000152137 246
536 3300025292 Ga0209676_1013324 Ga0209676_10133243 246
537 3300025294 Ga0209025_1000231 Ga0209025_1000231100 246
538 3300025295 Ga0209564_1000080 Ga0209564_1000080152 246
539 3300025295 Ga0209564_1000274 Ga0209564_100027427 246
540 3300025295 Ga0209564_1031142 Ga0209564_10311422 246
541 3300025297 Ga0209758_1042613 Ga0209758_10426132 246
542 3300025298 Ga0209050_1000210 Ga0209050_100021029 246
543 3300025299 Ga0209256_1000119 Ga0209256_100011927 246
544 3300025303 Ga0209051_1000074 Ga0209051_100007428 246
545 3300025303 Ga0209051_1000161 Ga0209051_100016117 246
546 3300025304 Ga0209257_1000072 Ga0209257_100007229 246
547 3300025315 Ga0207697_10036058 Ga0207697_100360582 246
548 3300025728 Ga0207655_1001284 Ga0207655_100128431 246
549 3300025728 Ga0207655_1015387 Ga0207655_10153873 246
550 3300025728 Ga0207655_1015752 Ga0207655_10157521 246
551 3300025907 Ga0207645_10002245 Ga0207645_100022454 246
552 3300025907 Ga0207645_10043273 Ga0207645_100432733 246
553 3300025908 Ga0207643_10036455 Ga0207643_100364553 246
554 3300025911 Ga0207654_10188462 Ga0207654_101884621 246
555 3300025926 Ga0207659_10484234 Ga0207659_104842342 246
556 3300025927 Ga0207687_10125912 Ga0207687_101259122 246
557 3300025927 Ga0207687_10728662 Ga0207687_107286621 246
558 3300025931 Ga0207644_10030603 Ga0207644_100306032 246
559 3300025931 Ga0207644_10257453 Ga0207644_102574531 246
560 3300025933 Ga0207706_10006621 Ga0207706_100066218 246
561 3300025933 Ga0207706_10102599 Ga0207706_101025993 246
562 3300025935 Ga0207709_10003293 Ga0207709_1000329310 246
563 3300025935 Ga0207709_10154628 Ga0207709_101546282 246
564 3300025935 Ga0207709_10491146 Ga0207709_104911461 246
565 3300025938 Ga0207704_10608494 Ga0207704_106084942 246
566 3300025940 Ga0207691_10042905 Ga0207691_100429054 246
567 3300025940 Ga0207691_10110267 Ga0207691_101102672 246
568 3300025945 Ga0207679_10007872 Ga0207679_100078723 246
569 3300025945 Ga0207679_10351562 Ga0207679_103515622 246
570 3300025960 Ga0207651_10024787 Ga0207651_100247872 246
571 3300025960 Ga0207651_10256796 Ga0207651_102567961 246
572 3300025986 Ga0207658_10093633 Ga0207658_100936333 246
573 3300026041 Ga0207639_10142888 Ga0207639_101428882 246
574 3300026088 Ga0207641_10480487 Ga0207641_104804872 246
575 3300026089 Ga0207648_10009736 Ga0207648_100097362 246
576 3300026116 Ga0207674_10037026 Ga0207674_100370266 246
577 3300026116 Ga0207674_10221007 Ga0207674_102210072 246
578 3300026116 Ga0207674_10242196 Ga0207674_102421962 246
579 3300026118 Ga0207675_100069363 Ga0207675_1000693631 246
580 3300026121 Ga0207683_10046071 Ga0207683_100460713 246
581 3300026121 Ga0207683_10348811 Ga0207683_103488112 246
582 3300027666 Ga0209282_1000271 Ga0209282_10002714 246
583 3300027666 Ga0209282_1092749 Ga0209282_10927492 246
584 3300028381 Ga0268264_10644293 Ga0268264_106442931 246
585 3300031238 Ga0265332_10000014 Ga0265332_10000014150 246
586 3300031239 Ga0265328_10034067 Ga0265328_100340672 246
587 3300031251 Ga0265327_10026190 Ga0265327_100261904 246
588 3300031548 Ga0307408_100025535 Ga0307408_1000255354 246
589 3300031548 Ga0307408_100067122 Ga0307408_1000671222 246
590 3300031548 Ga0307408_100239453 Ga0307408_1002394532 246
591 3300031548 Ga0307408_100638469 Ga0307408_1006384692 246
592 3300031731 Ga0307405_10087738 Ga0307405_100877381 246
593 3300031824 Ga0307413_10049566 Ga0307413_100495663 246
594 3300031852 Ga0307410_10046909 Ga0307410_100469093 246
595 3300031901 Ga0307406_10086285 Ga0307406_100862852 246
596 3300031903 Ga0307407_10336374 Ga0307407_103363742 246
597 3300031911 Ga0307412_10129338 Ga0307412_101293382 246
598 3300031911 Ga0307412_10191498 Ga0307412_101914982 246
599 3300031995 Ga0307409_100073132 Ga0307409_1000731322 246
600 3300031995 Ga0307409_100261529 Ga0307409_1002615291 246
601 3300032002 Ga0307416_100129803 Ga0307416_1001298032 246
602 3300032002 Ga0307416_100627346 Ga0307416_1006273462 246
603 3300032004 Ga0307414_10030580 Ga0307414_100305804 246
604 3300032005 Ga0307411_10084373 Ga0307411_100843732 246
605 3300037068 Ga0373925_0147075 Ga0373925_0147075_898_1638 246
606 3300037466 Ga0395898_0527700 Ga0395898_0527700_198_1013 246
607 3300037471 Ga0395905_0000954 Ga0395905_0000954_33362_34102 246
608 3300038443 Ga0395901_0081149 Ga0395901_0081149_726_1541 246
609 3300041406 Ga0439439_0021499 Ga0439439_0021499_823_1563 246
610 3300041407 Ga0439447_017483 Ga0439447_017483_139_879 246
611 3300041410 Ga0439461_0008914 Ga0439461_0008914_905_1645 246
612 3300041411 Ga0439466_0013462 Ga0439466_0013462_1971_2711 246
613 3300041413 Ga0439465_0002620 Ga0439465_0002620_3483_4223 246
614 3300041997 Ga0439431_0009625 Ga0439431_0009625_1134_1874 246
615 3300042002 Ga0439442_014798 Ga0439442_014798_396_1136 246
616 3300042006 Ga0439432_005849 Ga0439432_005849_629_1369 246
617 3300042006 Ga0439432_014181 Ga0439432_014181_786_1526 246
618 3300042007 Ga0439449_0000247 Ga0439449_0000247_13789_14529 246
619 3300042007 Ga0439449_0005204 Ga0439449_0005204_1438_2178 246
620 3300042007 Ga0439449_0017901 Ga0439449_0017901_1879_2619 246
621 3300042010 Ga0439452_009766 Ga0439452_009766_636_1376 246
622 3300042014 Ga0439457_017767 Ga0439457_017767_76_816 246
623 3300042015 Ga0439462_0008533 Ga0439462_0008533_1279_2019 246
624 3300042015 Ga0439462_0021195 Ga0439462_0021195_941_1681 246
625 3300042015 Ga0439462_0086393 Ga0439462_0086393_18_758 246
626 3300042122 Ga0450920_024778 Ga0450920_024778_323_1063 246
627 3300042133 Ga0450896_022952 Ga0450896_022952_97_837 246
628 3300042156 Ga0439446_0038133 Ga0439446_0038133_618_1358 246
629 3300042435 Ga0439434_0022567 Ga0439434_0022567_177_917 246
630 3300042531 Ga0450918_001959 Ga0450918_001959_2364_3104 246
631 3300045051 Ga0451576_0705789 Ga0451576_0705789_59_799 246
632 3300046459 Ga0495629_0207622 Ga0495629_0207622_378_1118 246
633 3300046474 Ga0495605_0000191 Ga0495605_0000191_73954_74694 246
634 3300046615 Ga0495656_0012345 Ga0495656_0012345_1932_2672 246
635 3300046615 Ga0495656_0042534 Ga0495656_0042534_541_1281 246
636 3300046660 Ga0495625_0000224 Ga0495625_0000224_32532_33272 246
637 3300046660 Ga0495625_0033145 Ga0495625_0033145_1439_2206 246
638 3300046664 Ga0495659_0120422 Ga0495659_0120422_42_782 246
639 3300046678 Ga0495599_0219509 Ga0495599_0219509_178_918 246
640 3300047315 Ga0495581_0267370 Ga0495581_0267370_175_915 246
641 3300047443 Ga0495687_000196 Ga0495687_000196_49897_50649 246
642 3300048089 Ga0495614_0079503 Ga0495614_0079503_82_822 246
643 3300048903 Ga0496100_0161959 Ga0496100_0161959_181_921 246
644 3300048904 Ga0496101_0000635 Ga0496101_0000635_241_981 246
645 3300048905 Ga0496102_0005808 Ga0496102_0005808_856_1596 246
646 3300048906 Ga0496103_0190326 Ga0496103_0190326_25_765 246
647 3300048907 Ga0496104_0024424 Ga0496104_0024424_1580_2320 246
648 3300048908 Ga0496105_0013557 Ga0496105_0013557_2629_3369 246
649 3300048909 Ga0496106_0242495 Ga0496106_0242495_450_1190 246
650 3300048910 Ga0496107_0015376 Ga0496107_0015376_2360_3100 246
651 3300048911 Ga0496108_0193817 Ga0496108_0193817_96_836 246
652 3300048912 Ga0496109_0412295 Ga0496109_0412295_503_1243 246
653 3300048913 Ga0496110_0074208 Ga0496110_0074208_104_844 246
654 3300048917 Ga0496114_0076605 Ga0496114_0076605_1306_2046 246
655 3300048919 Ga0496116_0083250 Ga0496116_0083250_578_1318 246
656 3300048920 Ga0496117_0017981 Ga0496117_0017981_5027_5767 246
657 3300048921 Ga0496118_0110091 Ga0496118_0110091_1039_1779 246
658 3300048924 Ga0496121_0044718 Ga0496121_0044718_309_1049 246
659 3300048927 Ga0496124_0139835 Ga0496124_0139835_203_943 246
660 3300048928 Ga0496125_0085219 Ga0496125_0085219_147_887 246
661 3300049571 Ga0501034_0615750 Ga0501034_0615750_178_924 246
662 3300050489 nmdc:mga03683_2500_c1 nmdc:mga03683_2500_c1_3906_4646 246
663 3300050490 nmdc:mga03n38_38719_c1 nmdc:mga03n38_38719_c1_342_1082 246
664 3300050493 nmdc:mga0k408_168172_c1 nmdc:mga0k408_168172_c1_91_831 246
665 3300050493 nmdc:mga0k408_287262_c1 nmdc:mga0k408_287262_c1_199_942 246
666 3300050493 nmdc:mga0k408_319333_c1 nmdc:mga0k408_319333_c1_171_911 246
667 3300050496 nmdc:mga07m45_10347_c1 nmdc:mga07m45_10347_c1_3599_4339 246
668 3300050496 nmdc:mga07m45_5338_c1 nmdc:mga07m45_5338_c1_2165_2905 246
669 3300050496 nmdc:mga07m45_63216_c1 nmdc:mga07m45_63216_c1_113_853 246
670 3300050496 nmdc:mga07m45_9761_c1 nmdc:mga07m45_9761_c1_892_1635 246
671 3300050508 nmdc:mga09592_148270_c1 nmdc:mga09592_148270_c1_235_975 246
672 3300050516 nmdc:mga0sz30_2078_c1 nmdc:mga0sz30_2078_c1_2163_2903 246
673 3300053122 Ga0500608_004413 Ga0500608_004413_1838_2578 246
674 3300053153 Ga0500616_0177739 Ga0500616_0177739_115_855 246

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

10

208

0.96

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

16

225

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3h7a-assembly1.cif.gz_D crystal structure of short-chain dehydrogenase from rhodopseudomonas palustris 0.9494 6 242
3h7a-assembly1.cif.gz_D crystal structure of short-chain dehydrogenase from rhodopseudomonas palustris 0.945 6 242
1gz6-assembly1.cif.gz_B (3r)-hydroxyacyl-coa dehydrogenase fragment of rat peroxisomal multifunctional enzyme type 2 0.9285 10 221
3tfo-assembly1.cif.gz_C crystal structure of a putative 3-oxoacyl-(acyl-carrier-protein) reductase from sinorhizobium meliloti 0.9186 10 241
3rkr-assembly1.cif.gz_A-2 crystal structure of a metagenomic short-chain oxidoreductase (sdr) in complex with nadp 0.9127 7 244
ID Description Score Start End Superfamily
3h7aB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9449 6 242 3.40.50.720
3h7aB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9406 6 242 3.40.50.720
af_Q54Q52_3_240_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9163 10 246 3.40.50.720
af_Q2QLP7_18_222_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9131 10 186 3.40.50.720
3rkrA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9127 7 244 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A0S8B7B9-F1-model_v4 Glucose 1-dehydrogenase 0.9747 25 246
AF-A0A7V7WY37-F1-model_v4 SDR family oxidoreductase 0.9743 9 246
AF-Q1LFL2-F1-model_v4 Short-chain dehydrogenase/reductase SDR 0.9722 7 246
AF-V2IPS4-F1-model_v4 Short-chain dehydrogenase 0.9713 5 246
AF-A0A2R6XL40-F1-model_v4 Short-chain dehydrogenase/reductase SDR 0.9701 9 246

Feature Viewer

pLDDT pTM Quality
92.91 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map