F474348
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 674 | 374 | 657 | 244 |
Family's Representative Sequence
| Representative Sequence | 3300005338|Ga0068868_100052343|Ga0068868_1000523434 |
| Length | 251 |
| Sequence | MATGTGAPKPVALVIGAGDATGGAIARRFAREGYVACVTRRHLDKLQPLVDEIVAAGGEAHGFASDARKEEEVIALVDQIESAIGPIEVLVFNIGANAPSSILEETARKYFKIWEMACFGGFLNAREVAKRMVAREGDGHKGTIIFTGATASLRGSANFGAFAGAKHALRALAQSMARELGPRGIHVAHVVVDGAIDTEFIRETFPQRYALKDQDGILNPDHIADNYWMLHRQPRDAWTHELDLRPWIEKF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2599185178 | Ralstonia sp. NFACC01 | Isolate | Rhizoplane |
| 2 | 2643221603 | Noviherbaspirillum sp. Root189 | Isolate | Unclassified |
| 3 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 4 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 5 | 2643221665 | Acinetobacter sp. Root1280 | Isolate | Unclassified |
| 6 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 7 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 8 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 9 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 10 | 2885266251 | Ralstonia sp. SET104 | Isolate | Nodule |
| 11 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 12 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 13 | 2928058823 | Ralstonia sp. 1138 | Isolate | Unclassified |
| 14 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 15 | 2928515477 | Acinetobacter bereziniae 1375 | Isolate | Rhizosphere |
| 16 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 17 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
| 18 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 19 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 20 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 21 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 22 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 23 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 24 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 25 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 26 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 27 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 28 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 29 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 30 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 31 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 32 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 33 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 34 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 35 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 36 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 37 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 41 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 44 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 46 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 47 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 65 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 66 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 69 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 70 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 71 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 76 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 78 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 79 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 80 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 81 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 82 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 83 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 84 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 85 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 86 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 87 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 88 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 89 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 90 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 91 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 92 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 93 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 94 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 95 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 96 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 97 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 98 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 100 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 101 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 102 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 103 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 104 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 105 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 106 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 107 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 108 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 110 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 135 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 139 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 140 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 142 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 143 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 152 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 153 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 155 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 156 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 159 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 162 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 217 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 218 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 222 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 223 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 224 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 225 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 226 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 227 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 228 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 229 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 230 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 231 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 232 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 233 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 234 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 235 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 236 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 237 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 238 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 239 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 240 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 241 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 242 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 243 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 244 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 245 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 246 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 247 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 248 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 249 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 250 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 251 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 252 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 253 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 254 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 255 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 256 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 257 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 258 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 259 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 260 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 261 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 262 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 263 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 264 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 265 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 266 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 267 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 268 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 269 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 270 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 271 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 272 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 273 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 274 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 275 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 276 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 277 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 278 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 279 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 280 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 281 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 282 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 283 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 284 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 285 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 286 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 287 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 322 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 323 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 324 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 325 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 326 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 327 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 328 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 329 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 330 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 331 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 332 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 333 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 334 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 335 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 336 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 337 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 338 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 339 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 340 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 341 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 342 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 343 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 344 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 345 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 349 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 353 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 355 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 360 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 361 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 362 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 363 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 364 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 365 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 366 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 367 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 368 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 369 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 370 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 371 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 373 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 374 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.74 |
| Metatranscriptomes | 0.74 |
| Isolates | 2.52 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.57 |
| Nodule | 1.04 |
| Rhizoplane | 5.19 |
| Rhizosphere | 76.85 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.34 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10019621 | 3300001989 | Bacteria | 2419 |
| 2 | JGI25156J39149_1003854 | 3300002705 | Bacteria | 4768 |
| 3 | JGI25151J46595_10000732 | 3300003187 | Bacteria | 27119 |
| 4 | Ga0006562J51391_1110457 | 3300003578 | Bacteria | 2700 |
| 5 | Ga0006562J51391_1110458 | 3300003578 | Bacteria | 2692 |
| 6 | Ga0006562J51391_1113999 | 3300003578 | Bacteria | 2341 |
| 7 | Ga0006562J51391_1114001 | 3300003578 | Bacteria | 1800 |
| 8 | Ga0055538_1002515 | 3300003751 | Bacteria | 2655 |
| 9 | Ga0055533_1002572 | 3300003756 | Bacteria | 4053 |
| 10 | Ga0055532_1000048 | 3300003758 | Bacteria | 175560 |
| 11 | Ga0055535_1000035 | 3300003761 | Bacteria | 175560 |
| 12 | Ga0055529_1000101 | 3300003763 | Bacteria | 130709 |
| 13 | Ga0055526_1009224 | 3300003771 | Bacteria | 4786 |
| 14 | Ga0055537_1000211 | 3300003773 | Bacteria | 43102 |
| 15 | Ga0055537_1001221 | 3300003773 | Bacteria | 10815 |
| 16 | Ga0055524_1001351 | 3300003775 | Bacteria | 14282 |
| 17 | Ga0055536_1001127 | 3300003781 | Bacteria | 16744 |
| 18 | Ga0055534_1000210 | 3300003784 | Bacteria | 43102 |
| 19 | Ga0055528_1000852 | 3300003790 | Bacteria | 20709 |
| 20 | Ga0055528_1033087 | 3300003790 | Bacteria | 1304 |
| 21 | Ga0055530_10012071 | 3300003791 | Bacteria | 3041 |
| 22 | Ga0055540_1000142 | 3300003792 | Bacteria | 71685 |
| 23 | Ga0055540_1000440 | 3300003792 | Bacteria | 32622 |
| 24 | Ga0055531_10000424 | 3300003794 | Bacteria | 40020 |
| 25 | Ga0055531_10001478 | 3300003794 | Bacteria | 17287 |
| 26 | Ga0065714_10002999 | 3300005288 | Bacteria | 16414 |
| 27 | Ga0070658_10154081 | 3300005327 | Bacteria | 1925 |
| 28 | Ga0070658_10157981 | 3300005327 | Bacteria | 1901 |
| 29 | Ga0070676_10008256 | 3300005328 | Bacteria | 5606 |
| 30 | Ga0070676_10035874 | 3300005328 | Bacteria | 2854 |
| 31 | Ga0070676_10054380 | 3300005328 | Bacteria | 2360 |
| 32 | Ga0070676_10118212 | 3300005328 | Bacteria | 1660 |
| 33 | Ga0070683_100095147 | 3300005329 | Bacteria | 2800 |
| 34 | Ga0070683_100423180 | 3300005329 | Bacteria | 1271 |
| 35 | Ga0070690_100001686 | 3300005330 | Bacteria | 11638 |
| 36 | Ga0070690_100017056 | 3300005330 | Bacteria | 4360 |
| 37 | Ga0070670_100361184 | 3300005331 | Bacteria | 1277 |
| 38 | Ga0070677_10025396 | 3300005333 | Bacteria | 2211 |
| 39 | Ga0070677_10060993 | 3300005333 | Bacteria | 1556 |
| 40 | Ga0070677_10086340 | 3300005333 | Bacteria | 1355 |
| 41 | Ga0068869_100088813 | 3300005334 | Bacteria | 2320 |
| 42 | Ga0068869_100135729 | 3300005334 | Bacteria | 1895 |
| 43 | Ga0070666_10007800 | 3300005335 | Bacteria | 6612 |
| 44 | Ga0070666_10532240 | 3300005335 | Bacteria | 854 |
| 45 | Ga0068868_100000814 | 3300005338 | Bacteria | 21169 |
| 46 | Ga0068868_100030698 | 3300005338 | Bacteria | 4121 |
| 47 | Ga0068868_100033575 | 3300005338 | Bacteria | 3956 |
| 48 | Ga0068868_100052343 | 3300005338 | Bacteria | 3214 |
| 49 | Ga0068868_100084956 | 3300005338 | Bacteria | 2542 |
| 50 | Ga0068868_100387269 | 3300005338 | Bacteria | 1204 |
| 51 | Ga0070689_100007835 | 3300005340 | Bacteria | 7487 |
| 52 | Ga0070687_100000820 | 3300005343 | Bacteria | 10356 |
| 53 | Ga0070687_100129053 | 3300005343 | Bacteria | 1457 |
| 54 | Ga0070661_100120983 | 3300005344 | Unclassified | 1961 |
| 55 | Ga0070661_100526060 | 3300005344 | Bacteria | 949 |
| 56 | Ga0070692_10329626 | 3300005345 | Bacteria | 942 |
| 57 | Ga0070668_100001217 | 3300005347 | Bacteria | 18276 |
| 58 | Ga0070668_100035227 | 3300005347 | Bacteria | 3816 |
| 59 | Ga0070668_100511059 | 3300005347 | Bacteria | 1041 |
| 60 | Ga0070669_100045715 | 3300005353 | Bacteria | 3191 |
| 61 | Ga0070675_100000562 | 3300005354 | Bacteria | 25576 |
| 62 | Ga0070675_100050345 | 3300005354 | Bacteria | 3420 |
| 63 | Ga0070671_100004823 | 3300005355 | Bacteria | 10722 |
| 64 | Ga0070671_100054225 | 3300005355 | Bacteria | 3333 |
| 65 | Ga0070674_100117807 | 3300005356 | Bacteria | 1961 |
| 66 | Ga0070673_100005821 | 3300005364 | Bacteria | 7942 |
| 67 | Ga0070673_100033026 | 3300005364 | Bacteria | 3903 |
| 68 | Ga0070673_100434680 | 3300005364 | Bacteria | 1178 |
| 69 | Ga0070673_100845287 | 3300005364 | Bacteria | 847 |
| 70 | Ga0070659_100062096 | 3300005366 | Bacteria | 2953 |
| 71 | Ga0070667_100017861 | 3300005367 | Bacteria | 5879 |
| 72 | Ga0070667_100064340 | 3300005367 | Bacteria | 3112 |
| 73 | Ga0070711_100017044 | 3300005439 | Bacteria | 4620 |
| 74 | Ga0070711_100318674 | 3300005439 | Unclassified | 1241 |
| 75 | Ga0070705_100265918 | 3300005440 | Bacteria | 1212 |
| 76 | Ga0070694_100039919 | 3300005444 | Bacteria | 3127 |
| 77 | Ga0070708_100023257 | 3300005445 | Bacteria | 5267 |
| 78 | Ga0070708_100289792 | 3300005445 | Bacteria | 1541 |
| 79 | Ga0070678_100010669 | 3300005456 | Bacteria | 5626 |
| 80 | Ga0070662_100019528 | 3300005457 | Bacteria | 4601 |
| 81 | Ga0070662_100046327 | 3300005457 | Bacteria | 3124 |
| 82 | Ga0070662_100069781 | 3300005457 | Bacteria | 2588 |
| 83 | Ga0070681_10693433 | 3300005458 | Bacteria | 934 |
| 84 | Ga0068867_100004609 | 3300005459 | Bacteria | 9699 |
| 85 | Ga0068867_100041458 | 3300005459 | Bacteria | 3364 |
| 86 | Ga0068867_100102432 | 3300005459 | Bacteria | 2188 |
| 87 | Ga0070706_100002496 | 3300005467 | Bacteria | 18534 |
| 88 | Ga0070707_100366167 | 3300005468 | Bacteria | 1400 |
| 89 | Ga0070679_100585020 | 3300005530 | Bacteria | 1060 |
| 90 | Ga0070684_100224165 | 3300005535 | Bacteria | 1715 |
| 91 | Ga0068853_100033865 | 3300005539 | Bacteria | 4334 |
| 92 | Ga0068853_100047135 | 3300005539 | Bacteria | 3699 |
| 93 | Ga0068853_100181082 | 3300005539 | Bacteria | 1911 |
| 94 | Ga0070672_100012578 | 3300005543 | Bacteria | 5950 |
| 95 | Ga0070672_100045895 | 3300005543 | Bacteria | 3383 |
| 96 | Ga0070672_100056157 | 3300005543 | Bacteria | 3086 |
| 97 | Ga0070672_100061128 | 3300005543 | Bacteria | 2969 |
| 98 | Ga0070695_100164525 | 3300005545 | Bacteria | 1560 |
| 99 | Ga0070665_100364412 | 3300005548 | Bacteria | 1451 |
| 100 | Ga0070704_100019332 | 3300005549 | Bacteria | 4375 |
| 101 | Ga0068855_100043550 | 3300005563 | Bacteria | 5316 |
| 102 | Ga0070664_100047384 | 3300005564 | Bacteria | 3631 |
| 103 | Ga0070664_100364151 | 3300005564 | Bacteria | 1317 |
| 104 | Ga0068857_100106310 | 3300005577 | Bacteria | 2520 |
| 105 | Ga0068857_100118879 | 3300005577 | Bacteria | 2378 |
| 106 | Ga0068857_100181224 | 3300005577 | Bacteria | 1917 |
| 107 | Ga0068857_100478428 | 3300005577 | Bacteria | 1167 |
| 108 | Ga0068854_100000396 | 3300005578 | Bacteria | 27398 |
| 109 | Ga0068854_100067625 | 3300005578 | Bacteria | 2603 |
| 110 | Ga0068854_100067736 | 3300005578 | Bacteria | 2601 |
| 111 | Ga0068856_100044068 | 3300005614 | Bacteria | 4389 |
| 112 | Ga0068852_100014277 | 3300005616 | Bacteria | 6108 |
| 113 | Ga0068852_100078523 | 3300005616 | Bacteria | 2920 |
| 114 | Ga0068852_100242421 | 3300005616 | Bacteria | 1723 |
| 115 | Ga0068859_100045863 | 3300005617 | Bacteria | 4390 |
| 116 | Ga0068859_100125212 | 3300005617 | Bacteria | 2639 |
| 117 | Ga0068859_100184011 | 3300005617 | Bacteria | 2173 |
| 118 | Ga0068864_100000666 | 3300005618 | Bacteria | 28646 |
| 119 | Ga0068864_100070863 | 3300005618 | Bacteria | 3034 |
| 120 | Ga0068864_100248842 | 3300005618 | Bacteria | 1649 |
| 121 | Ga0068864_100414273 | 3300005618 | Bacteria | 1283 |
| 122 | Ga0068861_100311637 | 3300005719 | Bacteria | 1367 |
| 123 | Ga0068851_10027581 | 3300005834 | Bacteria | 2800 |
| 124 | Ga0068851_10073293 | 3300005834 | Bacteria | 1776 |
| 125 | Ga0068851_10180623 | 3300005834 | Bacteria | 1168 |
| 126 | Ga0068870_10181875 | 3300005840 | Bacteria | 1262 |
| 127 | Ga0068863_100000585 | 3300005841 | Bacteria | 37128 |
| 128 | Ga0068863_100009834 | 3300005841 | Bacteria | 9318 |
| 129 | Ga0068863_100523186 | 3300005841 | Bacteria | 1170 |
| 130 | Ga0068858_100004762 | 3300005842 | Bacteria | 13288 |
| 131 | Ga0068858_100007104 | 3300005842 | Bacteria | 10869 |
| 132 | Ga0068860_100002804 | 3300005843 | Bacteria | 18134 |
| 133 | Ga0068860_100150781 | 3300005843 | Bacteria | 2239 |
| 134 | Ga0068860_100681797 | 3300005843 | Bacteria | 1037 |
| 135 | Ga0068862_100030063 | 3300005844 | Bacteria | 4577 |
| 136 | Ga0068862_100057153 | 3300005844 | Bacteria | 3344 |
| 137 | Ga0068862_100153122 | 3300005844 | Bacteria | 2053 |
| 138 | Ga0081540_1001565 | 3300005983 | Bacteria | 19566 |
| 139 | Ga0075365_10012156 | 3300006038 | Bacteria | 5098 |
| 140 | Ga0075365_10037769 | 3300006038 | Bacteria | 3137 |
| 141 | Ga0075365_10282573 | 3300006038 | Bacteria | 1168 |
| 142 | Ga0075363_100236535 | 3300006048 | Bacteria | 1049 |
| 143 | Ga0075432_10015003 | 3300006058 | Bacteria | 2640 |
| 144 | Ga0075362_10000626 | 3300006177 | Bacteria | 10333 |
| 145 | Ga0075362_10020852 | 3300006177 | Bacteria | 2742 |
| 146 | Ga0075362_10037317 | 3300006177 | Bacteria | 2129 |
| 147 | Ga0075367_10251727 | 3300006178 | Bacteria | 1108 |
| 148 | Ga0075369_10017548 | 3300006186 | Bacteria | 2902 |
| 149 | Ga0075366_10005412 | 3300006195 | Bacteria | 6917 |
| 150 | Ga0075366_10158104 | 3300006195 | Bacteria | 1373 |
| 151 | Ga0097621_100018619 | 3300006237 | Bacteria | 5310 |
| 152 | Ga0075370_10001410 | 3300006353 | Bacteria | 10388 |
| 153 | Ga0075370_10003126 | 3300006353 | Bacteria | 7817 |
| 154 | Ga0075370_10003497 | 3300006353 | Bacteria | 7487 |
| 155 | Ga0075370_10049456 | 3300006353 | Bacteria | 2383 |
| 156 | Ga0068871_100115888 | 3300006358 | Bacteria | 2258 |
| 157 | Ga0068871_100156753 | 3300006358 | Bacteria | 1945 |
| 158 | Ga0068871_100335788 | 3300006358 | Bacteria | 1333 |
| 159 | Ga0068871_100433289 | 3300006358 | Bacteria | 1176 |
| 160 | Ga0075428_100204783 | 3300006844 | Bacteria | 2132 |
| 161 | Ga0075430_100062615 | 3300006846 | Bacteria | 3125 |
| 162 | Ga0075430_100098468 | 3300006846 | Bacteria | 2443 |
| 163 | Ga0075430_100139949 | 3300006846 | Bacteria | 2015 |
| 164 | Ga0075430_100296315 | 3300006846 | Bacteria | 1338 |
| 165 | Ga0075430_100756689 | 3300006846 | Bacteria | 801 |
| 166 | Ga0075431_100005375 | 3300006847 | Bacteria | 12641 |
| 167 | Ga0075431_100127842 | 3300006847 | Bacteria | 2622 |
| 168 | Ga0075433_10367920 | 3300006852 | Bacteria | 1270 |
| 169 | Ga0075433_10633349 | 3300006852 | Bacteria | 938 |
| 170 | Ga0075434_100112835 | 3300006871 | Bacteria | 2730 |
| 171 | Ga0075434_100247469 | 3300006871 | Bacteria | 1802 |
| 172 | Ga0075434_100972424 | 3300006871 | Bacteria | 863 |
| 173 | Ga0075429_100097936 | 3300006880 | Bacteria | 2559 |
| 174 | Ga0068865_100006103 | 3300006881 | Bacteria | 7348 |
| 175 | Ga0068865_100077319 | 3300006881 | Bacteria | 2378 |
| 176 | Ga0068865_100170487 | 3300006881 | Bacteria | 1668 |
| 177 | Ga0068865_100228416 | 3300006881 | Bacteria | 1459 |
| 178 | Ga0097620_100045862 | 3300006931 | Bacteria | 4390 |
| 179 | Ga0097620_100125211 | 3300006931 | Bacteria | 2639 |
| 180 | Ga0097620_100158505 | 3300006931 | Bacteria | 2342 |
| 181 | Ga0097620_100184001 | 3300006931 | Bacteria | 2173 |
| 182 | Ga0099826_10000019 | 3300006948 | Bacteria | 188386 |
| 183 | Ga0099826_10000124 | 3300006948 | Bacteria | 34781 |
| 184 | Ga0099826_10111361 | 3300006948 | Bacteria | 1631 |
| 185 | Ga0105244_10003295 | 3300009036 | Bacteria | 11628 |
| 186 | Ga0105244_10102435 | 3300009036 | Bacteria | 1399 |
| 187 | Ga0105250_10030527 | 3300009092 | Bacteria | 2166 |
| 188 | Ga0105240_10190147 | 3300009093 | Bacteria | 2415 |
| 189 | Ga0105240_10310580 | 3300009093 | Bacteria | 1801 |
| 190 | Ga0105240_10440467 | 3300009093 | Bacteria | 1460 |
| 191 | Ga0105240_10919149 | 3300009093 | Bacteria | 940 |
| 192 | Ga0111539_10203014 | 3300009094 | Bacteria | 2311 |
| 193 | Ga0105245_10155162 | 3300009098 | Bacteria | 2168 |
| 194 | Ga0105245_10183341 | 3300009098 | Bacteria | 2001 |
| 195 | Ga0105245_10266984 | 3300009098 | Bacteria | 1667 |
| 196 | Ga0114129_10286641 | 3300009147 | Bacteria | 2199 |
| 197 | Ga0105243_10003586 | 3300009148 | Bacteria | 12526 |
| 198 | Ga0105243_10063029 | 3300009148 | Bacteria | 2970 |
| 199 | Ga0105243_10189747 | 3300009148 | Bacteria | 1794 |
| 200 | Ga0105243_10491158 | 3300009148 | Bacteria | 1161 |
| 201 | Ga0105243_10628500 | 3300009148 | Bacteria | 1038 |
| 202 | Ga0105241_10147033 | 3300009174 | Bacteria | 1924 |
| 203 | Ga0105241_10230179 | 3300009174 | Bacteria | 1562 |
| 204 | Ga0105242_10058464 | 3300009176 | Bacteria | 3161 |
| 205 | Ga0105242_10402952 | 3300009176 | Bacteria | 1277 |
| 206 | Ga0105248_10056296 | 3300009177 | Bacteria | 4412 |
| 207 | Ga0105248_10106475 | 3300009177 | Bacteria | 3162 |
| 208 | Ga0105248_10130470 | 3300009177 | Bacteria | 2835 |
| 209 | Ga0105238_10050991 | 3300009551 | Bacteria | 4164 |
| 210 | Ga0105238_10169153 | 3300009551 | Bacteria | 2162 |
| 211 | Ga0105238_10173478 | 3300009551 | Bacteria | 2133 |
| 212 | Ga0105238_10204266 | 3300009551 | Bacteria | 1952 |
| 213 | Ga0105249_10018226 | 3300009553 | Bacteria | 6240 |
| 214 | Ga0105249_10029758 | 3300009553 | Bacteria | 4933 |
| 215 | Ga0105249_10039617 | 3300009553 | Bacteria | 4278 |
| 216 | Ga0105239_10053753 | 3300010375 | Bacteria | 4417 |
| 217 | Ga0105239_10296013 | 3300010375 | Bacteria | 1822 |
| 218 | Ga0105239_10425490 | 3300010375 | Bacteria | 1505 |
| 219 | Ga0105246_10076816 | 3300011119 | Bacteria | 2367 |
| 220 | Ga0105246_10672405 | 3300011119 | Bacteria | 904 |
| 221 | Ga0157373_10008499 | 3300013100 | Bacteria | 7628 |
| 222 | Ga0157373_10010780 | 3300013100 | Bacteria | 6728 |
| 223 | Ga0157373_10067909 | 3300013100 | Bacteria | 2521 |
| 224 | Ga0157371_10002198 | 3300013102 | Bacteria | 18932 |
| 225 | Ga0157369_10004358 | 3300013105 | Bacteria | 16698 |
| 226 | Ga0157369_10022415 | 3300013105 | Bacteria | 7047 |
| 227 | Ga0157369_10216882 | 3300013105 | Bacteria | 2004 |
| 228 | Ga0157374_10100543 | 3300013296 | Bacteria | 2772 |
| 229 | Ga0157374_10126901 | 3300013296 | Bacteria | 2466 |
| 230 | Ga0157378_10144762 | 3300013297 | Bacteria | 2210 |
| 231 | Ga0163162_10005819 | 3300013306 | Bacteria | 11923 |
| 232 | Ga0163162_10059527 | 3300013306 | Bacteria | 3852 |
| 233 | Ga0163162_10100125 | 3300013306 | Bacteria | 2989 |
| 234 | Ga0163162_10121194 | 3300013306 | Bacteria | 2720 |
| 235 | Ga0163162_10138801 | 3300013306 | Bacteria | 2543 |
| 236 | Ga0163162_10850727 | 3300013306 | Bacteria | 1027 |
| 237 | Ga0157372_10029194 | 3300013307 | Bacteria | 6020 |
| 238 | Ga0157372_10166503 | 3300013307 | Bacteria | 2549 |
| 239 | Ga0157375_10007620 | 3300013308 | Bacteria | 9468 |
| 240 | Ga0157375_10025238 | 3300013308 | Bacteria | 5518 |
| 241 | Ga0157375_10208598 | 3300013308 | Bacteria | 2111 |
| 242 | Ga0163163_10006619 | 3300014325 | Bacteria | 10147 |
| 243 | Ga0157380_10581210 | 3300014326 | Bacteria | 1105 |
| 244 | Ga0157380_10851981 | 3300014326 | Bacteria | 933 |
| 245 | Ga0182008_10000669 | 3300014497 | Bacteria | 24850 |
| 246 | Ga0182008_10011327 | 3300014497 | Bacteria | 4748 |
| 247 | Ga0182008_10011982 | 3300014497 | Bacteria | 4593 |
| 248 | Ga0157377_10139293 | 3300014745 | Bacteria | 1489 |
| 249 | Ga0157379_10003595 | 3300014968 | Bacteria | 13145 |
| 250 | Ga0157379_10046697 | 3300014968 | Bacteria | 3864 |
| 251 | Ga0157379_10082433 | 3300014968 | Bacteria | 2882 |
| 252 | Ga0157376_10006041 | 3300014969 | Bacteria | 8512 |
| 253 | Ga0157376_10092389 | 3300014969 | Bacteria | 2624 |
| 254 | Ga0182006_1003951 | 3300015261 | Bacteria | 7413 |
| 255 | Ga0182006_1006971 | 3300015261 | Bacteria | 5200 |
| 256 | Ga0182006_1009607 | 3300015261 | Bacteria | 4330 |
| 257 | Ga0182006_1016779 | 3300015261 | Bacteria | 3121 |
| 258 | Ga0182007_10003759 | 3300015262 | Bacteria | 7078 |
| 259 | Ga0182007_10015387 | 3300015262 | Bacteria | 2855 |
| 260 | Ga0163161_10005078 | 3300017792 | Bacteria | 9163 |
| 261 | Ga0163161_10056146 | 3300017792 | Bacteria | 2860 |
| 262 | Ga0206351_10377698 | 3300020077 | Bacteria | 3746 |
| 263 | Ga0213876_10024079 | 3300021384 | Bacteria | 3215 |
| 264 | Ga0213876_10126376 | 3300021384 | Bacteria | 1358 |
| 265 | Ga0209784_101654 | 3300025224 | Bacteria | 2726 |
| 266 | Ga0209566_103076 | 3300025225 | Bacteria | 2727 |
| 267 | Ga0209674_103712 | 3300025226 | Bacteria | 2715 |
| 268 | Ga0209672_100127 | 3300025228 | Bacteria | 78095 |
| 269 | Ga0209147_100008 | 3300025229 | Bacteria | 777096 |
| 270 | Ga0209563_102375 | 3300025230 | Bacteria | 4288 |
| 271 | Ga0209563_105100 | 3300025230 | Bacteria | 2423 |
| 272 | Ga0209258_100013 | 3300025242 | Bacteria | 777096 |
| 273 | Ga0209148_1015709 | 3300025254 | Bacteria | 1317 |
| 274 | Ga0209759_1001412 | 3300025256 | Bacteria | 13705 |
| 275 | Ga0209759_1004529 | 3300025256 | Bacteria | 5146 |
| 276 | Ga0209565_1000039 | 3300025263 | Bacteria | 278026 |
| 277 | Ga0209565_1000077 | 3300025263 | Bacteria | 161163 |
| 278 | Ga0209455_1000042 | 3300025272 | Bacteria | 419638 |
| 279 | Ga0209673_1000146 | 3300025273 | Bacteria | 150871 |
| 280 | Ga0209673_1024153 | 3300025273 | Bacteria | 2050 |
| 281 | Ga0209675_1000030 | 3300025291 | Bacteria | 278026 |
| 282 | Ga0209675_1002647 | 3300025291 | Bacteria | 9040 |
| 283 | Ga0209676_1000152 | 3300025292 | Bacteria | 166700 |
| 284 | Ga0209676_1013324 | 3300025292 | Bacteria | 3168 |
| 285 | Ga0209025_1000231 | 3300025294 | Bacteria | 130671 |
| 286 | Ga0209564_1000080 | 3300025295 | Bacteria | 263547 |
| 287 | Ga0209564_1000274 | 3300025295 | Bacteria | 107980 |
| 288 | Ga0209564_1031142 | 3300025295 | Bacteria | 1636 |
| 289 | Ga0209758_1042613 | 3300025297 | Bacteria | 1681 |
| 290 | Ga0209050_1000210 | 3300025298 | Bacteria | 129834 |
| 291 | Ga0209256_1000119 | 3300025299 | Bacteria | 168215 |
| 292 | Ga0209051_1000025 | 3300025303 | Bacteria | 415397 |
| 293 | Ga0209051_1000074 | 3300025303 | Bacteria | 208667 |
| 294 | Ga0209051_1000161 | 3300025303 | Bacteria | 125704 |
| 295 | Ga0209257_1000039 | 3300025304 | Bacteria | 591694 |
| 296 | Ga0209257_1000072 | 3300025304 | Bacteria | 332791 |
| 297 | Ga0207697_10024529 | 3300025315 | Bacteria | 2469 |
| 298 | Ga0207697_10036058 | 3300025315 | Bacteria | 2025 |
| 299 | Ga0207655_1001284 | 3300025728 | Bacteria | 23851 |
| 300 | Ga0207655_1015387 | 3300025728 | Bacteria | 4255 |
| 301 | Ga0207655_1015752 | 3300025728 | Bacteria | 4181 |
| 302 | Ga0207642_10019186 | 3300025899 | Bacteria | 2643 |
| 303 | Ga0207688_10029592 | 3300025901 | Bacteria | 3016 |
| 304 | Ga0207645_10002245 | 3300025907 | Bacteria | 15384 |
| 305 | Ga0207645_10043273 | 3300025907 | Bacteria | 2882 |
| 306 | Ga0207645_10047006 | 3300025907 | Bacteria | 2756 |
| 307 | Ga0207645_10053872 | 3300025907 | Bacteria | 2570 |
| 308 | Ga0207645_10087978 | 3300025907 | Bacteria | 1996 |
| 309 | Ga0207643_10036455 | 3300025908 | Bacteria | 2758 |
| 310 | Ga0207643_10427526 | 3300025908 | Bacteria | 840 |
| 311 | Ga0207705_10110955 | 3300025909 | Bacteria | 2026 |
| 312 | Ga0207705_10272171 | 3300025909 | Unclassified | 1295 |
| 313 | Ga0207684_10019594 | 3300025910 | Bacteria | 5786 |
| 314 | Ga0207654_10188462 | 3300025911 | Bacteria | 1350 |
| 315 | Ga0207695_10000739 | 3300025913 | Bacteria | 63264 |
| 316 | Ga0207695_10366422 | 3300025913 | Bacteria | 1327 |
| 317 | Ga0207663_10009233 | 3300025916 | Bacteria | 5202 |
| 318 | Ga0207662_10001818 | 3300025918 | Bacteria | 10475 |
| 319 | Ga0207662_10067399 | 3300025918 | Bacteria | 2159 |
| 320 | Ga0207657_10041050 | 3300025919 | Bacteria | 4094 |
| 321 | Ga0207649_10078094 | 3300025920 | Bacteria | 2135 |
| 322 | Ga0207646_10133980 | 3300025922 | Bacteria | 2231 |
| 323 | Ga0207681_10131700 | 3300025923 | Bacteria | 1850 |
| 324 | Ga0207681_10185837 | 3300025923 | Bacteria | 1586 |
| 325 | Ga0207694_10116619 | 3300025924 | Bacteria | 2128 |
| 326 | Ga0207650_10000856 | 3300025925 | Bacteria | 23101 |
| 327 | Ga0207650_10043175 | 3300025925 | Bacteria | 3309 |
| 328 | Ga0207650_10302337 | 3300025925 | Bacteria | 1307 |
| 329 | Ga0207650_10532929 | 3300025925 | Bacteria | 983 |
| 330 | Ga0207659_10001396 | 3300025926 | Bacteria | 14395 |
| 331 | Ga0207659_10094953 | 3300025926 | Bacteria | 2235 |
| 332 | Ga0207659_10117768 | 3300025926 | Bacteria | 2030 |
| 333 | Ga0207659_10484234 | 3300025926 | Bacteria | 1046 |
| 334 | Ga0207687_10125912 | 3300025927 | Bacteria | 1923 |
| 335 | Ga0207687_10728662 | 3300025927 | Bacteria | 843 |
| 336 | Ga0207644_10018092 | 3300025931 | Bacteria | 4764 |
| 337 | Ga0207644_10030603 | 3300025931 | Bacteria | 3745 |
| 338 | Ga0207644_10086595 | 3300025931 | Bacteria | 2326 |
| 339 | Ga0207644_10209862 | 3300025931 | Bacteria | 1539 |
| 340 | Ga0207644_10257453 | 3300025931 | Bacteria | 1394 |
| 341 | Ga0207690_10052886 | 3300025932 | Bacteria | 2722 |
| 342 | Ga0207690_10152525 | 3300025932 | Bacteria | 1714 |
| 343 | Ga0207706_10006621 | 3300025933 | Bacteria | 10724 |
| 344 | Ga0207706_10079459 | 3300025933 | Bacteria | 2884 |
| 345 | Ga0207706_10102599 | 3300025933 | Bacteria | 2516 |
| 346 | Ga0207706_10157950 | 3300025933 | Bacteria | 1994 |
| 347 | Ga0207686_10008279 | 3300025934 | Bacteria | 5611 |
| 348 | Ga0207709_10003293 | 3300025935 | Bacteria | 9694 |
| 349 | Ga0207709_10127833 | 3300025935 | Bacteria | 1727 |
| 350 | Ga0207709_10154628 | 3300025935 | Bacteria | 1592 |
| 351 | Ga0207709_10491146 | 3300025935 | Bacteria | 956 |
| 352 | Ga0207670_10011864 | 3300025936 | Bacteria | 5074 |
| 353 | Ga0207669_10042458 | 3300025937 | Bacteria | 2655 |
| 354 | Ga0207704_10011710 | 3300025938 | Bacteria | 4331 |
| 355 | Ga0207704_10608494 | 3300025938 | Bacteria | 895 |
| 356 | Ga0207665_10169566 | 3300025939 | Bacteria | 1575 |
| 357 | Ga0207691_10042905 | 3300025940 | Bacteria | 4169 |
| 358 | Ga0207691_10110267 | 3300025940 | Bacteria | 2448 |
| 359 | Ga0207691_10133300 | 3300025940 | Bacteria | 2193 |
| 360 | Ga0207691_10156980 | 3300025940 | Bacteria | 1998 |
| 361 | Ga0207711_10040669 | 3300025941 | Bacteria | 3955 |
| 362 | Ga0207711_10073327 | 3300025941 | Bacteria | 2975 |
| 363 | Ga0207689_10001177 | 3300025942 | Bacteria | 25141 |
| 364 | Ga0207689_10005845 | 3300025942 | Bacteria | 10904 |
| 365 | Ga0207661_11040760 | 3300025944 | Bacteria | 754 |
| 366 | Ga0207679_10007872 | 3300025945 | Bacteria | 6770 |
| 367 | Ga0207679_10351562 | 3300025945 | Bacteria | 1285 |
| 368 | Ga0207667_10123620 | 3300025949 | Bacteria | 2666 |
| 369 | Ga0207651_10009043 | 3300025960 | Bacteria | 5421 |
| 370 | Ga0207651_10024787 | 3300025960 | Bacteria | 3717 |
| 371 | Ga0207651_10064944 | 3300025960 | Bacteria | 2557 |
| 372 | Ga0207651_10205883 | 3300025960 | Bacteria | 1580 |
| 373 | Ga0207651_10256796 | 3300025960 | Bacteria | 1433 |
| 374 | Ga0207712_10676406 | 3300025961 | Bacteria | 899 |
| 375 | Ga0207668_10011422 | 3300025972 | Bacteria | 5395 |
| 376 | Ga0207640_10000058 | 3300025981 | Bacteria | 92862 |
| 377 | Ga0207640_10038517 | 3300025981 | Bacteria | 3018 |
| 378 | Ga0207658_10005206 | 3300025986 | Bacteria | 8952 |
| 379 | Ga0207658_10005491 | 3300025986 | Bacteria | 8691 |
| 380 | Ga0207658_10093633 | 3300025986 | Bacteria | 2336 |
| 381 | Ga0207677_10001603 | 3300026023 | Bacteria | 12013 |
| 382 | Ga0207677_10014282 | 3300026023 | Bacteria | 4632 |
| 383 | Ga0207677_10115678 | 3300026023 | Bacteria | 2007 |
| 384 | Ga0207703_10001832 | 3300026035 | Bacteria | 18948 |
| 385 | Ga0207703_10007388 | 3300026035 | Bacteria | 8730 |
| 386 | Ga0207639_10036440 | 3300026041 | Bacteria | 3645 |
| 387 | Ga0207639_10113223 | 3300026041 | Bacteria | 2216 |
| 388 | Ga0207639_10142888 | 3300026041 | Bacteria | 1996 |
| 389 | Ga0207678_10013824 | 3300026067 | Bacteria | 7093 |
| 390 | Ga0207678_10135116 | 3300026067 | Bacteria | 2104 |
| 391 | Ga0207708_10009773 | 3300026075 | Bacteria | 7118 |
| 392 | Ga0207641_10004752 | 3300026088 | Bacteria | 11709 |
| 393 | Ga0207641_10007502 | 3300026088 | Bacteria | 9077 |
| 394 | Ga0207641_10054157 | 3300026088 | Bacteria | 3403 |
| 395 | Ga0207641_10480487 | 3300026088 | Bacteria | 1204 |
| 396 | Ga0207648_10008479 | 3300026089 | Bacteria | 9946 |
| 397 | Ga0207648_10009736 | 3300026089 | Bacteria | 9188 |
| 398 | Ga0207648_10036649 | 3300026089 | Bacteria | 4321 |
| 399 | Ga0207676_10005947 | 3300026095 | Bacteria | 8607 |
| 400 | Ga0207676_10064545 | 3300026095 | Bacteria | 2912 |
| 401 | Ga0207676_10067325 | 3300026095 | Bacteria | 2860 |
| 402 | Ga0207674_10013420 | 3300026116 | Bacteria | 9092 |
| 403 | Ga0207674_10037026 | 3300026116 | Bacteria | 5077 |
| 404 | Ga0207674_10098923 | 3300026116 | Bacteria | 2900 |
| 405 | Ga0207674_10221007 | 3300026116 | Bacteria | 1842 |
| 406 | Ga0207674_10242196 | 3300026116 | Bacteria | 1750 |
| 407 | Ga0207674_10711878 | 3300026116 | Bacteria | 969 |
| 408 | Ga0207675_100017493 | 3300026118 | Bacteria | 6691 |
| 409 | Ga0207675_100069363 | 3300026118 | Bacteria | 3295 |
| 410 | Ga0207675_100886005 | 3300026118 | Bacteria | 908 |
| 411 | Ga0207683_10004171 | 3300026121 | Bacteria | 12510 |
| 412 | Ga0207683_10034448 | 3300026121 | Bacteria | 4400 |
| 413 | Ga0207683_10046071 | 3300026121 | Bacteria | 3814 |
| 414 | Ga0207683_10348811 | 3300026121 | Bacteria | 1358 |
| 415 | Ga0207698_10015788 | 3300026142 | Bacteria | 5071 |
| 416 | Ga0207698_10022489 | 3300026142 | Bacteria | 4383 |
| 417 | Ga0207698_10171911 | 3300026142 | Bacteria | 1909 |
| 418 | Ga0209282_1000148 | 3300027666 | Bacteria | 41213 |
| 419 | Ga0209282_1000271 | 3300027666 | Bacteria | 25770 |
| 420 | Ga0209282_1092749 | 3300027666 | Bacteria | 1577 |
| 421 | Ga0207428_10061830 | 3300027907 | Bacteria | 2963 |
| 422 | Ga0207428_10188209 | 3300027907 | Bacteria | 1557 |
| 423 | Ga0268266_10195415 | 3300028379 | Bacteria | 1849 |
| 424 | Ga0268265_10028549 | 3300028380 | Bacteria | 3995 |
| 425 | Ga0268265_10167875 | 3300028380 | Bacteria | 1872 |
| 426 | Ga0268265_10538108 | 3300028380 | Bacteria | 1107 |
| 427 | Ga0268264_10032047 | 3300028381 | Bacteria | 4312 |
| 428 | Ga0268264_10644293 | 3300028381 | Bacteria | 1048 |
| 429 | Ga0268264_10837644 | 3300028381 | Bacteria | 921 |
| 430 | Ga0316181_1140414 | 3300030744 | Bacteria | 1086 |
| 431 | Ga0265332_10000014 | 3300031238 | Bacteria | 249035 |
| 432 | Ga0265328_10034067 | 3300031239 | Bacteria | 1886 |
| 433 | Ga0265327_10026190 | 3300031251 | Bacteria | 3383 |
| 434 | Ga0307408_100025535 | 3300031548 | Bacteria | 4047 |
| 435 | Ga0307408_100067122 | 3300031548 | Bacteria | 2637 |
| 436 | Ga0307408_100239453 | 3300031548 | Bacteria | 1490 |
| 437 | Ga0307408_100315472 | 3300031548 | Bacteria | 1315 |
| 438 | Ga0307408_100504090 | 3300031548 | Bacteria | 1060 |
| 439 | Ga0307408_100611555 | 3300031548 | Bacteria | 970 |
| 440 | Ga0307408_100638469 | 3300031548 | Bacteria | 950 |
| 441 | Ga0307508_10000540 | 3300031616 | Bacteria | 44861 |
| 442 | Ga0316575_10106083 | 3300031665 | Bacteria | 1144 |
| 443 | Ga0316578_10229714 | 3300031728 | Unclassified | 1115 |
| 444 | Ga0307516_10002755 | 3300031730 | Bacteria | 23168 |
| 445 | Ga0307405_10087738 | 3300031731 | Bacteria | 2051 |
| 446 | Ga0307413_10049566 | 3300031824 | Bacteria | 2517 |
| 447 | Ga0307413_10065116 | 3300031824 | Bacteria | 2268 |
| 448 | Ga0307410_10046909 | 3300031852 | Bacteria | 2885 |
| 449 | Ga0307406_10086285 | 3300031901 | Bacteria | 2101 |
| 450 | Ga0307407_10336374 | 3300031903 | Bacteria | 1064 |
| 451 | Ga0307412_10077763 | 3300031911 | Bacteria | 2283 |
| 452 | Ga0307412_10128185 | 3300031911 | Bacteria | 1839 |
| 453 | Ga0307412_10129338 | 3300031911 | Bacteria | 1831 |
| 454 | Ga0307412_10191498 | 3300031911 | Bacteria | 1546 |
| 455 | Ga0307409_100073132 | 3300031995 | Bacteria | 2733 |
| 456 | Ga0307409_100261529 | 3300031995 | Bacteria | 1588 |
| 457 | Ga0307416_100129803 | 3300032002 | Bacteria | 2266 |
| 458 | Ga0307416_100627346 | 3300032002 | Bacteria | 1157 |
| 459 | Ga0307414_10030580 | 3300032004 | Bacteria | 3520 |
| 460 | Ga0307414_10089167 | 3300032004 | Bacteria | 2285 |
| 461 | Ga0307411_10084373 | 3300032005 | Bacteria | 2197 |
| 462 | Ga0307510_10202538 | 3300033180 | Bacteria | 1517 |
| 463 | Ga0373944_0024531 | 3300035089 | Bacteria | 1768 |
| 464 | Ga0373943_0240013 | 3300035170 | Bacteria | 1015 |
| 465 | Ga0373946_0084044 | 3300035171 | Bacteria | 1399 |
| 466 | Ga0316574_0042028 | 3300035398 | Bacteria | 2819 |
| 467 | Ga0373924_0163708 | 3300035410 | Bacteria | 976 |
| 468 | Ga0373927_0111346 | 3300035695 | Bacteria | 1784 |
| 469 | Ga0373947_0161205 | 3300035725 | Bacteria | 1450 |
| 470 | Ga0373937_0781581 | 3300036401 | Bacteria | 902 |
| 471 | Ga0316584_0478966 | 3300036712 | Unclassified | 877 |
| 472 | Ga0373925_0003358 | 3300037068 | Bacteria | 12416 |
| 473 | Ga0373925_0005178 | 3300037068 | Bacteria | 9762 |
| 474 | Ga0373925_0147075 | 3300037068 | Bacteria | 1847 |
| 475 | Ga0395899_0000167 | 3300037312 | Bacteria | 100973 |
| 476 | Ga0395899_0202396 | 3300037312 | Bacteria | 1384 |
| 477 | Ga0395900_0000009 | 3300037418 | Bacteria | 476249 |
| 478 | Ga0395900_0004085 | 3300037418 | Bacteria | 15559 |
| 479 | Ga0395900_0033996 | 3300037418 | Bacteria | 5248 |
| 480 | Ga0395898_0016157 | 3300037466 | Bacteria | 7644 |
| 481 | Ga0395898_0527700 | 3300037466 | Bacteria | 1122 |
| 482 | Ga0395905_0000954 | 3300037471 | Bacteria | 37082 |
| 483 | Ga0395905_0007853 | 3300037471 | Bacteria | 10567 |
| 484 | Ga0395905_0014728 | 3300037471 | Bacteria | 7456 |
| 485 | Ga0395905_0109667 | 3300037471 | Bacteria | 2591 |
| 486 | Ga0395905_0273363 | 3300037471 | Bacteria | 1575 |
| 487 | Ga0395905_0472423 | 3300037471 | Bacteria | 1153 |
| 488 | Ga0436364_1510508 | 3300037853 | Bacteria | 1335 |
| 489 | Ga0395901_0000014 | 3300038443 | Bacteria | 375100 |
| 490 | Ga0395901_0081149 | 3300038443 | Bacteria | 3388 |
| 491 | Ga0395901_0090234 | 3300038443 | Bacteria | 3208 |
| 492 | Ga0436365_0010849 | 3300039437 | Bacteria | 1025 |
| 493 | Ga0436365_0045417 | 3300039437 | Bacteria | 1544 |
| 494 | Ga0436365_1112386 | 3300039437 | Bacteria | 3401 |
| 495 | Ga0439436_0091158 | 3300041404 | Bacteria | 849 |
| 496 | Ga0439439_0021499 | 3300041406 | Bacteria | 1608 |
| 497 | Ga0439447_017483 | 3300041407 | Bacteria | 1952 |
| 498 | Ga0439461_0008914 | 3300041410 | Bacteria | 1810 |
| 499 | Ga0439466_0013462 | 3300041411 | Bacteria | 2994 |
| 500 | Ga0439465_0002620 | 3300041413 | Bacteria | 5872 |
| 501 | Ga0439431_0009625 | 3300041997 | Bacteria | 2183 |
| 502 | Ga0439433_0004321 | 3300041999 | Bacteria | 3061 |
| 503 | Ga0439442_014798 | 3300042002 | Bacteria | 1606 |
| 504 | Ga0439432_005849 | 3300042006 | Bacteria | 4413 |
| 505 | Ga0439432_014181 | 3300042006 | Bacteria | 2698 |
| 506 | Ga0439449_0000247 | 3300042007 | Bacteria | 19331 |
| 507 | Ga0439449_0005204 | 3300042007 | Bacteria | 4991 |
| 508 | Ga0439449_0017901 | 3300042007 | Bacteria | 2659 |
| 509 | Ga0439452_009766 | 3300042010 | Bacteria | 2817 |
| 510 | Ga0439457_017767 | 3300042014 | Bacteria | 1579 |
| 511 | Ga0439462_0008533 | 3300042015 | Bacteria | 2586 |
| 512 | Ga0439462_0021195 | 3300042015 | Bacteria | 1696 |
| 513 | Ga0439462_0086393 | 3300042015 | Bacteria | 858 |
| 514 | Ga0450920_024778 | 3300042122 | Bacteria | 1166 |
| 515 | Ga0450890_002097 | 3300042127 | Bacteria | 2796 |
| 516 | Ga0450896_022952 | 3300042133 | Bacteria | 921 |
| 517 | Ga0450898_018504 | 3300042134 | Bacteria | 1207 |
| 518 | Ga0450903_017704 | 3300042138 | Bacteria | 1112 |
| 519 | Ga0439446_0038133 | 3300042156 | Bacteria | 1408 |
| 520 | Ga0439434_0022567 | 3300042435 | Bacteria | 1892 |
| 521 | Ga0439459_0023475 | 3300042438 | Bacteria | 1202 |
| 522 | Ga0450918_001959 | 3300042531 | Bacteria | 3973 |
| 523 | Ga0451577_0117470 | 3300042876 | Bacteria | 2382 |
| 524 | Ga0466969_0049815 | 3300044656 | Bacteria | 2066 |
| 525 | Ga0453683_0002378 | 3300044673 | Bacteria | 14700 |
| 526 | Ga0466970_0294801 | 3300044765 | Bacteria | 914 |
| 527 | Ga0451576_0007815 | 3300045051 | Bacteria | 12675 |
| 528 | Ga0451576_0705789 | 3300045051 | Bacteria | 1060 |
| 529 | Ga0466967_0080851 | 3300045976 | Bacteria | 2934 |
| 530 | Ga0495617_000173 | 3300046452 | Bacteria | 40755 |
| 531 | Ga0495629_0207622 | 3300046459 | Bacteria | 1353 |
| 532 | Ga0495580_0000052 | 3300046472 | Bacteria | 66203 |
| 533 | Ga0495580_0219698 | 3300046472 | Bacteria | 1306 |
| 534 | Ga0495605_0000191 | 3300046474 | Bacteria | 76513 |
| 535 | Ga0495605_0002922 | 3300046474 | Bacteria | 10362 |
| 536 | Ga0495596_0000184 | 3300046500 | Bacteria | 43662 |
| 537 | Ga0495607_0007490 | 3300046501 | Bacteria | 7546 |
| 538 | Ga0495610_0000362 | 3300046512 | Bacteria | 47404 |
| 539 | Ga0495610_0065701 | 3300046512 | Bacteria | 1711 |
| 540 | Ga0495616_0004205 | 3300046513 | Bacteria | 9118 |
| 541 | Ga0495632_0005145 | 3300046519 | Bacteria | 8731 |
| 542 | Ga0495648_0021496 | 3300046524 | Bacteria | 4464 |
| 543 | Ga0495598_0036444 | 3300046537 | Bacteria | 1413 |
| 544 | Ga0495609_0007914 | 3300046538 | Bacteria | 5253 |
| 545 | Ga0495621_0077057 | 3300046539 | Bacteria | 1237 |
| 546 | Ga0495597_0009759 | 3300046542 | Bacteria | 4727 |
| 547 | Ga0495633_0085213 | 3300046558 | Bacteria | 1470 |
| 548 | Ga0495633_0137254 | 3300046558 | Bacteria | 1131 |
| 549 | Ga0495656_0012345 | 3300046615 | Bacteria | 3150 |
| 550 | Ga0495656_0042534 | 3300046615 | Bacteria | 1903 |
| 551 | Ga0495625_0000224 | 3300046660 | Bacteria | 89521 |
| 552 | Ga0495625_0033145 | 3300046660 | Bacteria | 3823 |
| 553 | Ga0495659_0120422 | 3300046664 | Bacteria | 1033 |
| 554 | Ga0495661_0002318 | 3300046665 | Bacteria | 14690 |
| 555 | Ga0495599_0219509 | 3300046678 | Bacteria | 1164 |
| 556 | Ga0495658_0098803 | 3300046683 | Bacteria | 1739 |
| 557 | Ga0495669_0072193 | 3300046684 | Bacteria | 1575 |
| 558 | Ga0495671_0002080 | 3300046692 | Bacteria | 12832 |
| 559 | Ga0495649_0001610 | 3300046694 | Bacteria | 16823 |
| 560 | Ga0495660_0014552 | 3300046810 | Bacteria | 4550 |
| 561 | Ga0495581_0267370 | 3300047315 | Bacteria | 1000 |
| 562 | Ga0495674_0044424 | 3300047319 | Bacteria | 3951 |
| 563 | Ga0495672_0009637 | 3300047320 | Bacteria | 6970 |
| 564 | Ga0495687_000196 | 3300047443 | Bacteria | 87053 |
| 565 | Ga0495687_018609 | 3300047443 | Bacteria | 3431 |
| 566 | Ga0495687_075566 | 3300047443 | Bacteria | 1335 |
| 567 | Ga0495685_007602 | 3300047447 | Bacteria | 3584 |
| 568 | Ga0495684_0114960 | 3300047471 | Bacteria | 2029 |
| 569 | Ga0495686_0000966 | 3300047472 | Bacteria | 35392 |
| 570 | Ga0495614_0079503 | 3300048089 | Bacteria | 1420 |
| 571 | Ga0495626_0041260 | 3300048091 | Bacteria | 2175 |
| 572 | Ga0496100_0161959 | 3300048903 | Bacteria | 1604 |
| 573 | Ga0496100_0552865 | 3300048903 | Bacteria | 891 |
| 574 | Ga0496101_0000635 | 3300048904 | Bacteria | 21296 |
| 575 | Ga0496101_0471835 | 3300048904 | Bacteria | 991 |
| 576 | Ga0496102_0005808 | 3300048905 | Bacteria | 10492 |
| 577 | Ga0496102_0075001 | 3300048905 | Bacteria | 3109 |
| 578 | Ga0496102_0300799 | 3300048905 | Unclassified | 1512 |
| 579 | Ga0496103_0190326 | 3300048906 | Bacteria | 1319 |
| 580 | Ga0496104_0024424 | 3300048907 | Bacteria | 5558 |
| 581 | Ga0496104_0103618 | 3300048907 | Unclassified | 2726 |
| 582 | Ga0496105_0013557 | 3300048908 | Bacteria | 6475 |
| 583 | Ga0496106_0108055 | 3300048909 | Unclassified | 2164 |
| 584 | Ga0496106_0242495 | 3300048909 | Bacteria | 1440 |
| 585 | Ga0496106_0338159 | 3300048909 | Bacteria | 1209 |
| 586 | Ga0496107_0015376 | 3300048910 | Bacteria | 5363 |
| 587 | Ga0496107_0088700 | 3300048910 | Bacteria | 2258 |
| 588 | Ga0496107_0134240 | 3300048910 | Bacteria | 1828 |
| 589 | Ga0496108_0051852 | 3300048911 | Bacteria | 3437 |
| 590 | Ga0496108_0193817 | 3300048911 | Bacteria | 1762 |
| 591 | Ga0496108_0242938 | 3300048911 | Bacteria | 1566 |
| 592 | Ga0496108_0320276 | 3300048911 | Unclassified | 1352 |
| 593 | Ga0496109_0149812 | 3300048912 | Bacteria | 2184 |
| 594 | Ga0496109_0284743 | 3300048912 | Bacteria | 1558 |
| 595 | Ga0496109_0412295 | 3300048912 | Bacteria | 1276 |
| 596 | Ga0496110_0074208 | 3300048913 | Bacteria | 3020 |
| 597 | Ga0496110_0106461 | 3300048913 | Bacteria | 2516 |
| 598 | Ga0496111_0018220 | 3300048914 | Bacteria | 4863 |
| 599 | Ga0496111_0260751 | 3300048914 | Bacteria | 1286 |
| 600 | Ga0496112_0123866 | 3300048915 | Bacteria | 2556 |
| 601 | Ga0496113_0111883 | 3300048916 | Bacteria | 2126 |
| 602 | Ga0496113_0187121 | 3300048916 | Bacteria | 1643 |
| 603 | Ga0496114_0076605 | 3300048917 | Bacteria | 2818 |
| 604 | Ga0496115_0009542 | 3300048918 | Bacteria | 7209 |
| 605 | Ga0496115_0119214 | 3300048918 | Unclassified | 2170 |
| 606 | Ga0496116_0002766 | 3300048919 | Bacteria | 18026 |
| 607 | Ga0496116_0083250 | 3300048919 | Bacteria | 1976 |
| 608 | Ga0496117_0017981 | 3300048920 | Bacteria | 5883 |
| 609 | Ga0496118_0110091 | 3300048921 | Bacteria | 1831 |
| 610 | Ga0496121_0002439 | 3300048924 | Bacteria | 28439 |
| 611 | Ga0496121_0044718 | 3300048924 | Bacteria | 3815 |
| 612 | Ga0496122_0004611 | 3300048925 | Bacteria | 16964 |
| 613 | Ga0496123_0002704 | 3300048926 | Bacteria | 21311 |
| 614 | Ga0496124_0139835 | 3300048927 | Bacteria | 1912 |
| 615 | Ga0496125_0085219 | 3300048928 | Bacteria | 2395 |
| 616 | Ga0495682_0017412 | 3300049460 | Bacteria | 2713 |
| 617 | Ga0501032_0045980 | 3300049569 | Bacteria | 2951 |
| 618 | Ga0501032_0111620 | 3300049569 | Bacteria | 1809 |
| 619 | Ga0501033_0000165 | 3300049570 | Bacteria | 63213 |
| 620 | Ga0501034_0018663 | 3300049571 | Bacteria | 7109 |
| 621 | Ga0501034_0615750 | 3300049571 | Bacteria | 990 |
| 622 | Ga0501036_0276376 | 3300049572 | Bacteria | 1406 |
| 623 | Ga0501037_0023650 | 3300049573 | Bacteria | 4543 |
| 624 | Ga0501038_0154089 | 3300049574 | Bacteria | 1872 |
| 625 | Ga0501047_0069235 | 3300049581 | Bacteria | 3398 |
| 626 | Ga0501068_0100682 | 3300049584 | Bacteria | 1791 |
| 627 | Ga0501073_0064106 | 3300049589 | Bacteria | 2562 |
| 628 | Ga0501080_0000678 | 3300049742 | Bacteria | 27197 |
| 629 | Ga0501083_0219998 | 3300049744 | Bacteria | 1237 |
| 630 | Ga0501035_0001055 | 3300049822 | Bacteria | 28892 |
| 631 | Ga0501044_0264268 | 3300049823 | Bacteria | 1658 |
| 632 | nmdc:mga03683_2500_c1 | 3300050489 | Bacteria | 5721 |
| 633 | nmdc:mga03683_87072_c1 | 3300050489 | Bacteria | 1357 |
| 634 | nmdc:mga03n38_38719_c1 | 3300050490 | Bacteria | 2064 |
| 635 | nmdc:mga0yw44_385983_c1 | 3300050492 | Bacteria | 946 |
| 636 | nmdc:mga0k408_168172_c1 | 3300050493 | Bacteria | 1307 |
| 637 | nmdc:mga0k408_287262_c1 | 3300050493 | Bacteria | 982 |
| 638 | nmdc:mga0k408_319333_c1 | 3300050493 | Bacteria | 927 |
| 639 | nmdc:mga07m45_10347_c1 | 3300050496 | Bacteria | 4869 |
| 640 | nmdc:mga07m45_5338_c1 | 3300050496 | Bacteria | 6394 |
| 641 | nmdc:mga07m45_63216_c1 | 3300050496 | Bacteria | 2099 |
| 642 | nmdc:mga07m45_9761_c1 | 3300050496 | Bacteria | 4992 |
| 643 | nmdc:mga05p37_275394_c1 | 3300050507 | Bacteria | 2009 |
| 644 | nmdc:mga09592_148270_c1 | 3300050508 | Bacteria | 2023 |
| 645 | nmdc:mga0qj67_236595_c1 | 3300050509 | Bacteria | 1482 |
| 646 | nmdc:mga0qj67_36735_c1 | 3300050509 | Bacteria | 3835 |
| 647 | nmdc:mga06r32_267873_c1 | 3300050510 | Bacteria | 1696 |
| 648 | nmdc:mga06r32_727143_c1 | 3300050510 | Bacteria | 957 |
| 649 | nmdc:mga08y16_320507_c1 | 3300050511 | Bacteria | 1596 |
| 650 | nmdc:mga08y16_328123_c1 | 3300050511 | Bacteria | 1575 |
| 651 | nmdc:mga0n895_56020_c1 | 3300050512 | Bacteria | 3882 |
| 652 | nmdc:mga0n895_595761_c1 | 3300050512 | Bacteria | 1108 |
| 653 | nmdc:mga0sz30_2078_c1 | 3300050516 | Bacteria | 7150 |
| 654 | Ga0495619_0105215 | 3300053085 | Bacteria | 1924 |
| 655 | Ga0500608_004413 | 3300053122 | Bacteria | 5445 |
| 656 | Ga0500616_0177739 | 3300053153 | Bacteria | 961 |
| 657 | Ga0466962_0063115 | 3300061719 | Bacteria | 1769 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300042438 | Ga0439459_0023475 | Ga0439459_0023475_422_1048 | 193 |
| 2 | 3300006846 | Ga0075430_100296315 | Ga0075430_1002963152 | 223 |
| 3 | 3300042127 | Ga0450890_002097 | Ga0450890_002097_1891_2628 | 230 |
| 4 | 3300042138 | Ga0450903_017704 | Ga0450903_017704_312_1049 | 230 |
| 5 | 3300003794 | Ga0055531_10001478 | Ga0055531_100014782 | 231 |
| 6 | 3300006038 | Ga0075365_10282573 | Ga0075365_102825732 | 231 |
| 7 | 3300006178 | Ga0075367_10251727 | Ga0075367_102517271 | 231 |
| 8 | 3300025303 | Ga0209051_1000025 | Ga0209051_1000025104 | 231 |
| 9 | 3300025304 | Ga0209257_1000039 | Ga0209257_1000039504 | 231 |
| 10 | 3300044673 | Ga0453683_0002378 | Ga0453683_0002378_5729_6466 | 231 |
| 11 | 3300044765 | Ga0466970_0294801 | Ga0466970_0294801_50_787 | 231 |
| 12 | 3300045051 | Ga0451576_0007815 | Ga0451576_0007815_8423_9160 | 231 |
| 13 | 3300006058 | Ga0075432_10015003 | Ga0075432_100150033 | 232 |
| 14 | 3300006177 | Ga0075362_10000626 | Ga0075362_100006268 | 232 |
| 15 | 3300031824 | Ga0307413_10065116 | Ga0307413_100651162 | 232 |
| 16 | 3300049574 | Ga0501038_0154089 | Ga0501038_0154089_228_932 | 233 |
| 17 | iso_pu_bacteria | 2928115317 | 2928118164 | 233 |
| 18 | 3300041404 | Ga0439436_0091158 | Ga0439436_0091158_25_729 | 234 |
| 19 | 3300048907 | Ga0496104_0103618 | Ga0496104_0103618_471_1184 | 235 |
| 20 | 3300006844 | Ga0075428_100204783 | Ga0075428_1002047833 | 236 |
| 21 | 3300006846 | Ga0075430_100139949 | Ga0075430_1001399492 | 236 |
| 22 | 3300006847 | Ga0075431_100005375 | Ga0075431_1000053752 | 236 |
| 23 | 3300050509 | nmdc:mga0qj67_236595_c1 | nmdc:mga0qj67_236595_c1_53_763 | 236 |
| 24 | 3300050510 | nmdc:mga06r32_727143_c1 | nmdc:mga06r32_727143_c1_182_892 | 236 |
| 25 | 3300042134 | Ga0450898_018504 | Ga0450898_018504_482_1195 | 237 |
| 26 | 3300050489 | nmdc:mga03683_87072_c1 | nmdc:mga03683_87072_c1_161_874 | 237 |
| 27 | 3300037471 | Ga0395905_0472423 | Ga0395905_0472423_370_1092 | 238 |
| 28 | 3300037853 | Ga0436364_1510508 | Ga0436364_1510508_232_975 | 238 |
| 29 | iso_pu_bacteria | 2738541307 | 2738881500 | 238 |
| 30 | iso_pu_bacteria | 2954767861 | 2954771609 | 238 |
| 31 | 3300005347 | Ga0070668_100511059 | Ga0070668_1005110592 | 239 |
| 32 | 3300005439 | Ga0070711_100017044 | Ga0070711_1000170442 | 239 |
| 33 | 3300005440 | Ga0070705_100265918 | Ga0070705_1002659182 | 239 |
| 34 | 3300005530 | Ga0070679_100585020 | Ga0070679_1005850202 | 239 |
| 35 | 3300006871 | Ga0075434_100247469 | Ga0075434_1002474692 | 239 |
| 36 | 3300009094 | Ga0111539_10203014 | Ga0111539_102030143 | 239 |
| 37 | 3300025916 | Ga0207663_10009233 | Ga0207663_100092333 | 239 |
| 38 | 3300027907 | Ga0207428_10188209 | Ga0207428_101882092 | 239 |
| 39 | 3300035410 | Ga0373924_0163708 | Ga0373924_0163708_32_757 | 239 |
| 40 | 3300050511 | nmdc:mga08y16_320507_c1 | nmdc:mga08y16_320507_c1_668_1393 | 239 |
| 41 | 3300050512 | nmdc:mga0n895_56020_c1 | nmdc:mga0n895_56020_c1_2725_3450 | 239 |
| 42 | iso_pu_bacteria | 2599185178 | 2599444729 | 239 |
| 43 | iso_pu_bacteria | 2885266251 | 2885266356 | 239 |
| 44 | iso_pu_bacteria | 2928058823 | 2928059864 | 239 |
| 45 | 3300005468 | Ga0070707_100366167 | Ga0070707_1003661672 | 240 |
| 46 | 3300006038 | Ga0075365_10012156 | Ga0075365_100121564 | 240 |
| 47 | 3300009148 | Ga0105243_10189747 | Ga0105243_101897472 | 240 |
| 48 | 3300025922 | Ga0207646_10133980 | Ga0207646_101339803 | 240 |
| 49 | 3300026089 | Ga0207648_10036649 | Ga0207648_100366494 | 240 |
| 50 | 3300028380 | Ga0268265_10167875 | Ga0268265_101678752 | 240 |
| 51 | 3300028380 | Ga0268265_10538108 | Ga0268265_105381082 | 240 |
| 52 | 3300028381 | Ga0268264_10837644 | Ga0268264_108376442 | 240 |
| 53 | 3300031548 | Ga0307408_100504090 | Ga0307408_1005040902 | 240 |
| 54 | 3300031728 | Ga0316578_10229714 | Ga0316578_102297142 | 240 |
| 55 | 3300031911 | Ga0307412_10128185 | Ga0307412_101281852 | 240 |
| 56 | 3300036712 | Ga0316584_0478966 | Ga0316584_0478966_26_763 | 240 |
| 57 | 3300046558 | Ga0495633_0085213 | Ga0495633_0085213_610_1332 | 240 |
| 58 | 3300046684 | Ga0495669_0072193 | Ga0495669_0072193_287_1009 | 240 |
| 59 | iso_pu_bacteria | 2643221603 | 2644029323 | 240 |
| 60 | 3300005445 | Ga0070708_100289792 | Ga0070708_1002897922 | 241 |
| 61 | 3300006881 | Ga0068865_100006103 | Ga0068865_1000061032 | 241 |
| 62 | 3300009551 | Ga0105238_10050991 | Ga0105238_100509914 | 241 |
| 63 | 3300013105 | Ga0157369_10216882 | Ga0157369_102168821 | 241 |
| 64 | 3300013306 | Ga0163162_10138801 | Ga0163162_101388013 | 241 |
| 65 | 3300013306 | Ga0163162_10850727 | Ga0163162_108507272 | 241 |
| 66 | 3300025938 | Ga0207704_10011710 | Ga0207704_100117103 | 241 |
| 67 | 3300025944 | Ga0207661_11040760 | Ga0207661_110407601 | 241 |
| 68 | 3300031730 | Ga0307516_10002755 | Ga0307516_1000275517 | 241 |
| 69 | 3300031911 | Ga0307412_10077763 | Ga0307412_100777633 | 241 |
| 70 | 3300035089 | Ga0373944_0024531 | Ga0373944_0024531_86_811 | 241 |
| 71 | 3300035170 | Ga0373943_0240013 | Ga0373943_0240013_251_976 | 241 |
| 72 | 3300035725 | Ga0373947_0161205 | Ga0373947_0161205_438_1163 | 241 |
| 73 | 3300037068 | Ga0373925_0003358 | Ga0373925_0003358_1009_1734 | 241 |
| 74 | 3300037312 | Ga0395899_0000167 | Ga0395899_0000167_22479_23204 | 241 |
| 75 | 3300037418 | Ga0395900_0000009 | Ga0395900_0000009_383174_383899 | 241 |
| 76 | 3300037466 | Ga0395898_0016157 | Ga0395898_0016157_4503_5228 | 241 |
| 77 | 3300037471 | Ga0395905_0007853 | Ga0395905_0007853_7575_8300 | 241 |
| 78 | 3300037471 | Ga0395905_0014728 | Ga0395905_0014728_1053_1778 | 241 |
| 79 | 3300038443 | Ga0395901_0000014 | Ga0395901_0000014_334380_335105 | 241 |
| 80 | 3300047319 | Ga0495674_0044424 | Ga0495674_0044424_1028_1753 | 241 |
| 81 | 3300049569 | Ga0501032_0111620 | Ga0501032_0111620_51_782 | 241 |
| 82 | 3300049571 | Ga0501034_0018663 | Ga0501034_0018663_791_1522 | 241 |
| 83 | 3300049572 | Ga0501036_0276376 | Ga0501036_0276376_37_774 | 241 |
| 84 | 3300049573 | Ga0501037_0023650 | Ga0501037_0023650_1617_2348 | 241 |
| 85 | 3300049581 | Ga0501047_0069235 | Ga0501047_0069235_1084_1815 | 241 |
| 86 | 3300049584 | Ga0501068_0100682 | Ga0501068_0100682_702_1433 | 241 |
| 87 | 3300049589 | Ga0501073_0064106 | Ga0501073_0064106_1692_2423 | 241 |
| 88 | 3300049742 | Ga0501080_0000678 | Ga0501080_0000678_17565_18296 | 241 |
| 89 | 3300049744 | Ga0501083_0219998 | Ga0501083_0219998_492_1223 | 241 |
| 90 | 3300049823 | Ga0501044_0264268 | Ga0501044_0264268_348_1079 | 241 |
| 91 | iso_pu_bacteria | 2643221665 | 2644362327 | 241 |
| 92 | iso_pu_bacteria | 2738543013 | 2739249395 | 241 |
| 93 | 3300005328 | Ga0070676_10118212 | Ga0070676_101182122 | 242 |
| 94 | 3300005330 | Ga0070690_100001686 | Ga0070690_1000016868 | 242 |
| 95 | 3300005331 | Ga0070670_100361184 | Ga0070670_1003611841 | 242 |
| 96 | 3300005333 | Ga0070677_10060993 | Ga0070677_100609931 | 242 |
| 97 | 3300005335 | Ga0070666_10007800 | Ga0070666_100078003 | 242 |
| 98 | 3300005338 | Ga0068868_100000814 | Ga0068868_1000008143 | 242 |
| 99 | 3300005340 | Ga0070689_100007835 | Ga0070689_1000078356 | 242 |
| 100 | 3300005343 | Ga0070687_100129053 | Ga0070687_1001290532 | 242 |
| 101 | 3300005347 | Ga0070668_100035227 | Ga0070668_1000352273 | 242 |
| 102 | 3300005353 | Ga0070669_100045715 | Ga0070669_1000457152 | 242 |
| 103 | 3300005354 | Ga0070675_100000562 | Ga0070675_1000005627 | 242 |
| 104 | 3300005355 | Ga0070671_100004823 | Ga0070671_1000048237 | 242 |
| 105 | 3300005364 | Ga0070673_100005821 | Ga0070673_1000058216 | 242 |
| 106 | 3300005444 | Ga0070694_100039919 | Ga0070694_1000399194 | 242 |
| 107 | 3300005456 | Ga0070678_100010669 | Ga0070678_1000106694 | 242 |
| 108 | 3300005457 | Ga0070662_100046327 | Ga0070662_1000463272 | 242 |
| 109 | 3300005459 | Ga0068867_100041458 | Ga0068867_1000414582 | 242 |
| 110 | 3300005467 | Ga0070706_100002496 | Ga0070706_1000024964 | 242 |
| 111 | 3300005549 | Ga0070704_100019332 | Ga0070704_1000193325 | 242 |
| 112 | 3300005616 | Ga0068852_100014277 | Ga0068852_1000142776 | 242 |
| 113 | 3300005617 | Ga0068859_100125212 | Ga0068859_1001252122 | 242 |
| 114 | 3300005618 | Ga0068864_100000666 | Ga0068864_10000066615 | 242 |
| 115 | 3300005719 | Ga0068861_100311637 | Ga0068861_1003116372 | 242 |
| 116 | 3300005841 | Ga0068863_100000585 | Ga0068863_1000005857 | 242 |
| 117 | 3300005842 | Ga0068858_100004762 | Ga0068858_1000047626 | 242 |
| 118 | 3300005843 | Ga0068860_100150781 | Ga0068860_1001507813 | 242 |
| 119 | 3300005844 | Ga0068862_100057153 | Ga0068862_1000571532 | 242 |
| 120 | 3300005844 | Ga0068862_100153122 | Ga0068862_1001531222 | 242 |
| 121 | 3300006358 | Ga0068871_100156753 | Ga0068871_1001567531 | 242 |
| 122 | 3300006846 | Ga0075430_100098468 | Ga0075430_1000984682 | 242 |
| 123 | 3300006846 | Ga0075430_100756689 | Ga0075430_1007566891 | 242 |
| 124 | 3300006847 | Ga0075431_100127842 | Ga0075431_1001278422 | 242 |
| 125 | 3300006852 | Ga0075433_10367920 | Ga0075433_103679201 | 242 |
| 126 | 3300006852 | Ga0075433_10633349 | Ga0075433_106333491 | 242 |
| 127 | 3300006931 | Ga0097620_100125211 | Ga0097620_1001252112 | 242 |
| 128 | 3300006931 | Ga0097620_100158505 | Ga0097620_1001585053 | 242 |
| 129 | 3300006948 | Ga0099826_10000019 | Ga0099826_1000001996 | 242 |
| 130 | 3300009098 | Ga0105245_10266984 | Ga0105245_102669842 | 242 |
| 131 | 3300009147 | Ga0114129_10286641 | Ga0114129_102866412 | 242 |
| 132 | 3300009176 | Ga0105242_10402952 | Ga0105242_104029522 | 242 |
| 133 | 3300009177 | Ga0105248_10056296 | Ga0105248_100562961 | 242 |
| 134 | 3300009177 | Ga0105248_10130470 | Ga0105248_101304702 | 242 |
| 135 | 3300009553 | Ga0105249_10039617 | Ga0105249_100396172 | 242 |
| 136 | 3300013297 | Ga0157378_10144762 | Ga0157378_101447623 | 242 |
| 137 | 3300013306 | Ga0163162_10100125 | Ga0163162_101001252 | 242 |
| 138 | 3300013308 | Ga0157375_10025238 | Ga0157375_100252383 | 242 |
| 139 | 3300013308 | Ga0157375_10208598 | Ga0157375_102085982 | 242 |
| 140 | 3300014325 | Ga0163163_10006619 | Ga0163163_100066197 | 242 |
| 141 | 3300014326 | Ga0157380_10851981 | Ga0157380_108519811 | 242 |
| 142 | 3300014968 | Ga0157379_10003595 | Ga0157379_100035954 | 242 |
| 143 | 3300014969 | Ga0157376_10006041 | Ga0157376_100060416 | 242 |
| 144 | 3300025899 | Ga0207642_10019186 | Ga0207642_100191862 | 242 |
| 145 | 3300025907 | Ga0207645_10087978 | Ga0207645_100879782 | 242 |
| 146 | 3300025910 | Ga0207684_10019594 | Ga0207684_100195943 | 242 |
| 147 | 3300025918 | Ga0207662_10067399 | Ga0207662_100673993 | 242 |
| 148 | 3300025923 | Ga0207681_10185837 | Ga0207681_101858371 | 242 |
| 149 | 3300025925 | Ga0207650_10302337 | Ga0207650_103023371 | 242 |
| 150 | 3300025926 | Ga0207659_10001396 | Ga0207659_100013964 | 242 |
| 151 | 3300025931 | Ga0207644_10018092 | Ga0207644_100180925 | 242 |
| 152 | 3300025933 | Ga0207706_10079459 | Ga0207706_100794592 | 242 |
| 153 | 3300025936 | Ga0207670_10011864 | Ga0207670_100118645 | 242 |
| 154 | 3300025937 | Ga0207669_10042458 | Ga0207669_100424582 | 242 |
| 155 | 3300025941 | Ga0207711_10073327 | Ga0207711_100733274 | 242 |
| 156 | 3300025960 | Ga0207651_10009043 | Ga0207651_100090434 | 242 |
| 157 | 3300025961 | Ga0207712_10676406 | Ga0207712_106764061 | 242 |
| 158 | 3300025986 | Ga0207658_10005491 | Ga0207658_100054915 | 242 |
| 159 | 3300026023 | Ga0207677_10001603 | Ga0207677_100016033 | 242 |
| 160 | 3300026035 | Ga0207703_10007388 | Ga0207703_100073884 | 242 |
| 161 | 3300026088 | Ga0207641_10007502 | Ga0207641_100075025 | 242 |
| 162 | 3300026095 | Ga0207676_10005947 | Ga0207676_100059474 | 242 |
| 163 | 3300026118 | Ga0207675_100886005 | Ga0207675_1008860051 | 242 |
| 164 | 3300026121 | Ga0207683_10004171 | Ga0207683_100041716 | 242 |
| 165 | 3300027666 | Ga0209282_1000148 | Ga0209282_100014820 | 242 |
| 166 | 3300027907 | Ga0207428_10061830 | Ga0207428_100618306 | 242 |
| 167 | 3300028379 | Ga0268266_10195415 | Ga0268266_101954152 | 242 |
| 168 | 3300030744 | Ga0316181_1140414 | Ga0316181_11404141 | 242 |
| 169 | 3300031548 | Ga0307408_100315472 | Ga0307408_1003154722 | 242 |
| 170 | 3300031665 | Ga0316575_10106083 | Ga0316575_101060831 | 242 |
| 171 | 3300032004 | Ga0307414_10089167 | Ga0307414_100891671 | 242 |
| 172 | 3300035171 | Ga0373946_0084044 | Ga0373946_0084044_292_1041 | 242 |
| 173 | 3300035398 | Ga0316574_0042028 | Ga0316574_0042028_1251_1979 | 242 |
| 174 | 3300041999 | Ga0439433_0004321 | Ga0439433_0004321_1331_2059 | 242 |
| 175 | 3300042876 | Ga0451577_0117470 | Ga0451577_0117470_1159_1887 | 242 |
| 176 | 3300044656 | Ga0466969_0049815 | Ga0466969_0049815_515_1243 | 242 |
| 177 | 3300046474 | Ga0495605_0002922 | Ga0495605_0002922_4528_5256 | 242 |
| 178 | 3300046500 | Ga0495596_0000184 | Ga0495596_0000184_37229_37957 | 242 |
| 179 | 3300046501 | Ga0495607_0007490 | Ga0495607_0007490_6701_7429 | 242 |
| 180 | 3300046512 | Ga0495610_0000362 | Ga0495610_0000362_481_1209 | 242 |
| 181 | 3300046513 | Ga0495616_0004205 | Ga0495616_0004205_2571_3299 | 242 |
| 182 | 3300046524 | Ga0495648_0021496 | Ga0495648_0021496_1959_2687 | 242 |
| 183 | 3300046537 | Ga0495598_0036444 | Ga0495598_0036444_640_1368 | 242 |
| 184 | 3300046538 | Ga0495609_0007914 | Ga0495609_0007914_555_1283 | 242 |
| 185 | 3300046539 | Ga0495621_0077057 | Ga0495621_0077057_104_832 | 242 |
| 186 | 3300046542 | Ga0495597_0009759 | Ga0495597_0009759_3165_3893 | 242 |
| 187 | 3300046558 | Ga0495633_0137254 | Ga0495633_0137254_140_868 | 242 |
| 188 | 3300046665 | Ga0495661_0002318 | Ga0495661_0002318_2354_3082 | 242 |
| 189 | 3300046683 | Ga0495658_0098803 | Ga0495658_0098803_508_1257 | 242 |
| 190 | 3300046692 | Ga0495671_0002080 | Ga0495671_0002080_4293_5021 | 242 |
| 191 | 3300047320 | Ga0495672_0009637 | Ga0495672_0009637_5560_6288 | 242 |
| 192 | 3300047447 | Ga0495685_007602 | Ga0495685_007602_118_846 | 242 |
| 193 | 3300048909 | Ga0496106_0338159 | Ga0496106_0338159_295_1023 | 242 |
| 194 | 3300048910 | Ga0496107_0088700 | Ga0496107_0088700_970_1698 | 242 |
| 195 | 3300048912 | Ga0496109_0149812 | Ga0496109_0149812_683_1411 | 242 |
| 196 | 3300048912 | Ga0496109_0284743 | Ga0496109_0284743_212_940 | 242 |
| 197 | 3300048914 | Ga0496111_0018220 | Ga0496111_0018220_2692_3420 | 242 |
| 198 | 3300048916 | Ga0496113_0187121 | Ga0496113_0187121_413_1141 | 242 |
| 199 | 3300048919 | Ga0496116_0002766 | Ga0496116_0002766_14219_14947 | 242 |
| 200 | 3300048924 | Ga0496121_0002439 | Ga0496121_0002439_5646_6374 | 242 |
| 201 | 3300048925 | Ga0496122_0004611 | Ga0496122_0004611_5314_6042 | 242 |
| 202 | 3300048926 | Ga0496123_0002704 | Ga0496123_0002704_7392_8120 | 242 |
| 203 | 3300050507 | nmdc:mga05p37_275394_c1 | nmdc:mga05p37_275394_c1_888_1616 | 242 |
| 204 | 3300050509 | nmdc:mga0qj67_36735_c1 | nmdc:mga0qj67_36735_c1_460_1188 | 242 |
| 205 | 3300050510 | nmdc:mga06r32_267873_c1 | nmdc:mga06r32_267873_c1_460_1188 | 242 |
| 206 | 3300050511 | nmdc:mga08y16_328123_c1 | nmdc:mga08y16_328123_c1_703_1497 | 242 |
| 207 | 3300061719 | Ga0466962_0063115 | Ga0466962_0063115_615_1343 | 242 |
| 208 | iso_pu_bacteria | 2643221628 | 2644158982 | 242 |
| 209 | iso_pu_bacteria | 2643221658 | 2644328269 | 242 |
| 210 | iso_pu_bacteria | 2643221672 | 2644400120 | 242 |
| 211 | iso_pu_bacteria | 2885192300 | 2885195144 | 242 |
| 212 | iso_pu_bacteria | 2904449895 | 2904453284 | 242 |
| 213 | iso_pu_bacteria | 2904456579 | 2904459278 | 242 |
| 214 | iso_pu_bacteria | 2929520902 | 2929525324 | 242 |
| 215 | 3300002705 | JGI25156J39149_1003854 | JGI25156J39149_10038544 | 243 |
| 216 | 3300003578 | Ga0006562J51391_1110457 | Ga0006562J51391_11104571 | 243 |
| 217 | 3300003578 | Ga0006562J51391_1110458 | Ga0006562J51391_11104584 | 243 |
| 218 | 3300003751 | Ga0055538_1002515 | Ga0055538_10025152 | 243 |
| 219 | 3300003756 | Ga0055533_1002572 | Ga0055533_10025726 | 243 |
| 220 | 3300003758 | Ga0055532_1000048 | Ga0055532_1000048141 | 243 |
| 221 | 3300003761 | Ga0055535_1000035 | Ga0055535_1000035141 | 243 |
| 222 | 3300003763 | Ga0055529_1000101 | Ga0055529_100010129 | 243 |
| 223 | 3300005327 | Ga0070658_10154081 | Ga0070658_101540813 | 243 |
| 224 | 3300005328 | Ga0070676_10054380 | Ga0070676_100543802 | 243 |
| 225 | 3300005329 | Ga0070683_100095147 | Ga0070683_1000951472 | 243 |
| 226 | 3300005329 | Ga0070683_100423180 | Ga0070683_1004231801 | 243 |
| 227 | 3300005330 | Ga0070690_100017056 | Ga0070690_1000170562 | 243 |
| 228 | 3300005333 | Ga0070677_10025396 | Ga0070677_100253962 | 243 |
| 229 | 3300005333 | Ga0070677_10086340 | Ga0070677_100863401 | 243 |
| 230 | 3300005334 | Ga0068869_100088813 | Ga0068869_1000888132 | 243 |
| 231 | 3300005338 | Ga0068868_100030698 | Ga0068868_1000306983 | 243 |
| 232 | 3300005338 | Ga0068868_100084956 | Ga0068868_1000849562 | 243 |
| 233 | 3300005343 | Ga0070687_100000820 | Ga0070687_1000008208 | 243 |
| 234 | 3300005344 | Ga0070661_100120983 | Ga0070661_1001209832 | 243 |
| 235 | 3300005347 | Ga0070668_100001217 | Ga0070668_1000012178 | 243 |
| 236 | 3300005354 | Ga0070675_100050345 | Ga0070675_1000503451 | 243 |
| 237 | 3300005355 | Ga0070671_100054225 | Ga0070671_1000542253 | 243 |
| 238 | 3300005356 | Ga0070674_100117807 | Ga0070674_1001178071 | 243 |
| 239 | 3300005364 | Ga0070673_100434680 | Ga0070673_1004346801 | 243 |
| 240 | 3300005367 | Ga0070667_100017861 | Ga0070667_1000178615 | 243 |
| 241 | 3300005439 | Ga0070711_100318674 | Ga0070711_1003186742 | 243 |
| 242 | 3300005459 | Ga0068867_100004609 | Ga0068867_1000046095 | 243 |
| 243 | 3300005535 | Ga0070684_100224165 | Ga0070684_1002241652 | 243 |
| 244 | 3300005539 | Ga0068853_100033865 | Ga0068853_1000338652 | 243 |
| 245 | 3300005539 | Ga0068853_100047135 | Ga0068853_1000471353 | 243 |
| 246 | 3300005543 | Ga0070672_100056157 | Ga0070672_1000561572 | 243 |
| 247 | 3300005563 | Ga0068855_100043550 | Ga0068855_1000435505 | 243 |
| 248 | 3300005577 | Ga0068857_100106310 | Ga0068857_1001063102 | 243 |
| 249 | 3300005577 | Ga0068857_100478428 | Ga0068857_1004784282 | 243 |
| 250 | 3300005578 | Ga0068854_100000396 | Ga0068854_1000003967 | 243 |
| 251 | 3300005578 | Ga0068854_100067625 | Ga0068854_1000676253 | 243 |
| 252 | 3300005614 | Ga0068856_100044068 | Ga0068856_1000440683 | 243 |
| 253 | 3300005616 | Ga0068852_100078523 | Ga0068852_1000785233 | 243 |
| 254 | 3300005616 | Ga0068852_100242421 | Ga0068852_1002424212 | 243 |
| 255 | 3300005617 | Ga0068859_100045863 | Ga0068859_1000458633 | 243 |
| 256 | 3300005617 | Ga0068859_100184011 | Ga0068859_1001840113 | 243 |
| 257 | 3300005618 | Ga0068864_100070863 | Ga0068864_1000708633 | 243 |
| 258 | 3300005618 | Ga0068864_100248842 | Ga0068864_1002488422 | 243 |
| 259 | 3300005618 | Ga0068864_100414273 | Ga0068864_1004142732 | 243 |
| 260 | 3300005834 | Ga0068851_10027581 | Ga0068851_100275813 | 243 |
| 261 | 3300005834 | Ga0068851_10073293 | Ga0068851_100732932 | 243 |
| 262 | 3300005834 | Ga0068851_10180623 | Ga0068851_101806232 | 243 |
| 263 | 3300005840 | Ga0068870_10181875 | Ga0068870_101818752 | 243 |
| 264 | 3300005841 | Ga0068863_100009834 | Ga0068863_1000098348 | 243 |
| 265 | 3300005842 | Ga0068858_100007104 | Ga0068858_1000071049 | 243 |
| 266 | 3300005843 | Ga0068860_100002804 | Ga0068860_1000028042 | 243 |
| 267 | 3300005844 | Ga0068862_100030063 | Ga0068862_1000300632 | 243 |
| 268 | 3300006038 | Ga0075365_10037769 | Ga0075365_100377693 | 243 |
| 269 | 3300006195 | Ga0075366_10158104 | Ga0075366_101581042 | 243 |
| 270 | 3300006237 | Ga0097621_100018619 | Ga0097621_1000186196 | 243 |
| 271 | 3300006358 | Ga0068871_100115888 | Ga0068871_1001158882 | 243 |
| 272 | 3300006871 | Ga0075434_100112835 | Ga0075434_1001128352 | 243 |
| 273 | 3300006871 | Ga0075434_100972424 | Ga0075434_1009724241 | 243 |
| 274 | 3300006931 | Ga0097620_100045862 | Ga0097620_1000458623 | 243 |
| 275 | 3300006931 | Ga0097620_100184001 | Ga0097620_1001840013 | 243 |
| 276 | 3300009093 | Ga0105240_10190147 | Ga0105240_101901473 | 243 |
| 277 | 3300009093 | Ga0105240_10310580 | Ga0105240_103105802 | 243 |
| 278 | 3300009093 | Ga0105240_10440467 | Ga0105240_104404672 | 243 |
| 279 | 3300009174 | Ga0105241_10230179 | Ga0105241_102301792 | 243 |
| 280 | 3300009176 | Ga0105242_10058464 | Ga0105242_100584643 | 243 |
| 281 | 3300009177 | Ga0105248_10106475 | Ga0105248_101064753 | 243 |
| 282 | 3300009551 | Ga0105238_10173478 | Ga0105238_101734783 | 243 |
| 283 | 3300009551 | Ga0105238_10204266 | Ga0105238_102042662 | 243 |
| 284 | 3300009553 | Ga0105249_10029758 | Ga0105249_100297584 | 243 |
| 285 | 3300010375 | Ga0105239_10296013 | Ga0105239_102960132 | 243 |
| 286 | 3300013100 | Ga0157373_10010780 | Ga0157373_100107806 | 243 |
| 287 | 3300013100 | Ga0157373_10067909 | Ga0157373_100679093 | 243 |
| 288 | 3300013105 | Ga0157369_10004358 | Ga0157369_100043583 | 243 |
| 289 | 3300013105 | Ga0157369_10022415 | Ga0157369_100224156 | 243 |
| 290 | 3300013296 | Ga0157374_10100543 | Ga0157374_101005433 | 243 |
| 291 | 3300013296 | Ga0157374_10126901 | Ga0157374_101269013 | 243 |
| 292 | 3300013306 | Ga0163162_10005819 | Ga0163162_100058194 | 243 |
| 293 | 3300013306 | Ga0163162_10121194 | Ga0163162_101211943 | 243 |
| 294 | 3300013307 | Ga0157372_10029194 | Ga0157372_100291945 | 243 |
| 295 | 3300013307 | Ga0157372_10166503 | Ga0157372_101665033 | 243 |
| 296 | 3300013308 | Ga0157375_10007620 | Ga0157375_100076208 | 243 |
| 297 | 3300014968 | Ga0157379_10046697 | Ga0157379_100466971 | 243 |
| 298 | 3300014968 | Ga0157379_10082433 | Ga0157379_100824333 | 243 |
| 299 | 3300014969 | Ga0157376_10092389 | Ga0157376_100923893 | 243 |
| 300 | 3300015261 | Ga0182006_1016779 | Ga0182006_10167791 | 243 |
| 301 | 3300020077 | Ga0206351_10377698 | Ga0206351_103776984 | 243 |
| 302 | 3300021384 | Ga0213876_10024079 | Ga0213876_100240792 | 243 |
| 303 | 3300021384 | Ga0213876_10126376 | Ga0213876_101263762 | 243 |
| 304 | 3300025224 | Ga0209784_101654 | Ga0209784_1016543 | 243 |
| 305 | 3300025225 | Ga0209566_103076 | Ga0209566_1030763 | 243 |
| 306 | 3300025226 | Ga0209674_103712 | Ga0209674_1037123 | 243 |
| 307 | 3300025228 | Ga0209672_100127 | Ga0209672_10012752 | 243 |
| 308 | 3300025229 | Ga0209147_100008 | Ga0209147_100008159 | 243 |
| 309 | 3300025230 | Ga0209563_102375 | Ga0209563_1023757 | 243 |
| 310 | 3300025230 | Ga0209563_105100 | Ga0209563_1051002 | 243 |
| 311 | 3300025242 | Ga0209258_100013 | Ga0209258_100013159 | 243 |
| 312 | 3300025254 | Ga0209148_1015709 | Ga0209148_10157092 | 243 |
| 313 | 3300025256 | Ga0209759_1004529 | Ga0209759_10045296 | 243 |
| 314 | 3300025272 | Ga0209455_1000042 | Ga0209455_1000042159 | 243 |
| 315 | 3300025901 | Ga0207688_10029592 | Ga0207688_100295922 | 243 |
| 316 | 3300025907 | Ga0207645_10047006 | Ga0207645_100470063 | 243 |
| 317 | 3300025907 | Ga0207645_10053872 | Ga0207645_100538722 | 243 |
| 318 | 3300025908 | Ga0207643_10427526 | Ga0207643_104275261 | 243 |
| 319 | 3300025909 | Ga0207705_10110955 | Ga0207705_101109553 | 243 |
| 320 | 3300025909 | Ga0207705_10272171 | Ga0207705_102721712 | 243 |
| 321 | 3300025913 | Ga0207695_10000739 | Ga0207695_1000073956 | 243 |
| 322 | 3300025913 | Ga0207695_10366422 | Ga0207695_103664221 | 243 |
| 323 | 3300025918 | Ga0207662_10001818 | Ga0207662_100018188 | 243 |
| 324 | 3300025919 | Ga0207657_10041050 | Ga0207657_100410505 | 243 |
| 325 | 3300025920 | Ga0207649_10078094 | Ga0207649_100780943 | 243 |
| 326 | 3300025924 | Ga0207694_10116619 | Ga0207694_101166193 | 243 |
| 327 | 3300025925 | Ga0207650_10000856 | Ga0207650_1000085611 | 243 |
| 328 | 3300025925 | Ga0207650_10532929 | Ga0207650_105329291 | 243 |
| 329 | 3300025926 | Ga0207659_10094953 | Ga0207659_100949533 | 243 |
| 330 | 3300025926 | Ga0207659_10117768 | Ga0207659_101177682 | 243 |
| 331 | 3300025931 | Ga0207644_10086595 | Ga0207644_100865953 | 243 |
| 332 | 3300025931 | Ga0207644_10209862 | Ga0207644_102098622 | 243 |
| 333 | 3300025932 | Ga0207690_10052886 | Ga0207690_100528862 | 243 |
| 334 | 3300025932 | Ga0207690_10152525 | Ga0207690_101525252 | 243 |
| 335 | 3300025934 | Ga0207686_10008279 | Ga0207686_100082795 | 243 |
| 336 | 3300025935 | Ga0207709_10127833 | Ga0207709_101278332 | 243 |
| 337 | 3300025939 | Ga0207665_10169566 | Ga0207665_101695661 | 243 |
| 338 | 3300025940 | Ga0207691_10133300 | Ga0207691_101333002 | 243 |
| 339 | 3300025941 | Ga0207711_10040669 | Ga0207711_100406693 | 243 |
| 340 | 3300025942 | Ga0207689_10001177 | Ga0207689_100011775 | 243 |
| 341 | 3300025942 | Ga0207689_10005845 | Ga0207689_100058453 | 243 |
| 342 | 3300025949 | Ga0207667_10123620 | Ga0207667_101236203 | 243 |
| 343 | 3300025960 | Ga0207651_10064944 | Ga0207651_100649442 | 243 |
| 344 | 3300025960 | Ga0207651_10205883 | Ga0207651_102058832 | 243 |
| 345 | 3300025972 | Ga0207668_10011422 | Ga0207668_100114224 | 243 |
| 346 | 3300025981 | Ga0207640_10000058 | Ga0207640_1000005823 | 243 |
| 347 | 3300025981 | Ga0207640_10038517 | Ga0207640_100385172 | 243 |
| 348 | 3300025986 | Ga0207658_10005206 | Ga0207658_100052068 | 243 |
| 349 | 3300026035 | Ga0207703_10001832 | Ga0207703_100018324 | 243 |
| 350 | 3300026041 | Ga0207639_10036440 | Ga0207639_100364403 | 243 |
| 351 | 3300026041 | Ga0207639_10113223 | Ga0207639_101132232 | 243 |
| 352 | 3300026067 | Ga0207678_10013824 | Ga0207678_100138246 | 243 |
| 353 | 3300026075 | Ga0207708_10009773 | Ga0207708_100097735 | 243 |
| 354 | 3300026088 | Ga0207641_10004752 | Ga0207641_100047528 | 243 |
| 355 | 3300026088 | Ga0207641_10054157 | Ga0207641_100541573 | 243 |
| 356 | 3300026089 | Ga0207648_10008479 | Ga0207648_100084792 | 243 |
| 357 | 3300026095 | Ga0207676_10064545 | Ga0207676_100645453 | 243 |
| 358 | 3300026095 | Ga0207676_10067325 | Ga0207676_100673252 | 243 |
| 359 | 3300026116 | Ga0207674_10013420 | Ga0207674_100134208 | 243 |
| 360 | 3300026116 | Ga0207674_10098923 | Ga0207674_100989233 | 243 |
| 361 | 3300026118 | Ga0207675_100017493 | Ga0207675_1000174932 | 243 |
| 362 | 3300026121 | Ga0207683_10034448 | Ga0207683_100344483 | 243 |
| 363 | 3300026142 | Ga0207698_10015788 | Ga0207698_100157884 | 243 |
| 364 | 3300026142 | Ga0207698_10022489 | Ga0207698_100224894 | 243 |
| 365 | 3300026142 | Ga0207698_10171911 | Ga0207698_101719112 | 243 |
| 366 | 3300028380 | Ga0268265_10028549 | Ga0268265_100285493 | 243 |
| 367 | 3300028381 | Ga0268264_10032047 | Ga0268264_100320473 | 243 |
| 368 | 3300035695 | Ga0373927_0111346 | Ga0373927_0111346_432_1169 | 243 |
| 369 | 3300036401 | Ga0373937_0781581 | Ga0373937_0781581_128_859 | 243 |
| 370 | 3300037068 | Ga0373925_0005178 | Ga0373925_0005178_2096_2833 | 243 |
| 371 | 3300037312 | Ga0395899_0202396 | Ga0395899_0202396_232_969 | 243 |
| 372 | 3300037418 | Ga0395900_0004085 | Ga0395900_0004085_2053_2787 | 243 |
| 373 | 3300037418 | Ga0395900_0033996 | Ga0395900_0033996_4170_4907 | 243 |
| 374 | 3300037471 | Ga0395905_0109667 | Ga0395905_0109667_27_764 | 243 |
| 375 | 3300037471 | Ga0395905_0273363 | Ga0395905_0273363_726_1463 | 243 |
| 376 | 3300038443 | Ga0395901_0090234 | Ga0395901_0090234_1060_1797 | 243 |
| 377 | 3300039437 | Ga0436365_0045417 | Ga0436365_0045417_479_1225 | 243 |
| 378 | 3300039437 | Ga0436365_1112386 | Ga0436365_1112386_368_1099 | 243 |
| 379 | 3300045976 | Ga0466967_0080851 | Ga0466967_0080851_1108_1845 | 243 |
| 380 | 3300046472 | Ga0495580_0000052 | Ga0495580_0000052_47782_48519 | 243 |
| 381 | 3300046472 | Ga0495580_0219698 | Ga0495580_0219698_470_1201 | 243 |
| 382 | 3300047471 | Ga0495684_0114960 | Ga0495684_0114960_333_1064 | 243 |
| 383 | 3300048903 | Ga0496100_0552865 | Ga0496100_0552865_143_874 | 243 |
| 384 | 3300048904 | Ga0496101_0471835 | Ga0496101_0471835_243_974 | 243 |
| 385 | 3300048905 | Ga0496102_0075001 | Ga0496102_0075001_1369_2100 | 243 |
| 386 | 3300048905 | Ga0496102_0300799 | Ga0496102_0300799_613_1359 | 243 |
| 387 | 3300048909 | Ga0496106_0108055 | Ga0496106_0108055_553_1299 | 243 |
| 388 | 3300048910 | Ga0496107_0134240 | Ga0496107_0134240_966_1697 | 243 |
| 389 | 3300048911 | Ga0496108_0051852 | Ga0496108_0051852_734_1465 | 243 |
| 390 | 3300048911 | Ga0496108_0242938 | Ga0496108_0242938_95_826 | 243 |
| 391 | 3300048911 | Ga0496108_0320276 | Ga0496108_0320276_115_861 | 243 |
| 392 | 3300048913 | Ga0496110_0106461 | Ga0496110_0106461_1155_1886 | 243 |
| 393 | 3300048914 | Ga0496111_0260751 | Ga0496111_0260751_220_951 | 243 |
| 394 | 3300048915 | Ga0496112_0123866 | Ga0496112_0123866_648_1379 | 243 |
| 395 | 3300048916 | Ga0496113_0111883 | Ga0496113_0111883_340_1071 | 243 |
| 396 | 3300048918 | Ga0496115_0009542 | Ga0496115_0009542_4017_4748 | 243 |
| 397 | 3300048918 | Ga0496115_0119214 | Ga0496115_0119214_244_990 | 243 |
| 398 | 3300049569 | Ga0501032_0045980 | Ga0501032_0045980_914_1651 | 243 |
| 399 | 3300049570 | Ga0501033_0000165 | Ga0501033_0000165_32372_33109 | 243 |
| 400 | 3300049822 | Ga0501035_0001055 | Ga0501035_0001055_26722_27459 | 243 |
| 401 | 3300050492 | nmdc:mga0yw44_385983_c1 | nmdc:mga0yw44_385983_c1_57_797 | 243 |
| 402 | 3300050512 | nmdc:mga0n895_595761_c1 | nmdc:mga0n895_595761_c1_82_813 | 243 |
| 403 | 3300053085 | Ga0495619_0105215 | Ga0495619_0105215_887_1618 | 243 |
| 404 | 3300005338 | Ga0068868_100387269 | Ga0068868_1003872691 | 244 |
| 405 | 3300005345 | Ga0070692_10329626 | Ga0070692_103296261 | 244 |
| 406 | 3300005459 | Ga0068867_100102432 | Ga0068867_1001024322 | 244 |
| 407 | 3300005543 | Ga0070672_100045895 | Ga0070672_1000458953 | 244 |
| 408 | 3300005548 | Ga0070665_100364412 | Ga0070665_1003644122 | 244 |
| 409 | 3300005578 | Ga0068854_100067736 | Ga0068854_1000677363 | 244 |
| 410 | 3300025315 | Ga0207697_10024529 | Ga0207697_100245292 | 244 |
| 411 | 3300025923 | Ga0207681_10131700 | Ga0207681_101317002 | 244 |
| 412 | 3300025925 | Ga0207650_10043175 | Ga0207650_100431753 | 244 |
| 413 | 3300025933 | Ga0207706_10157950 | Ga0207706_101579502 | 244 |
| 414 | 3300025940 | Ga0207691_10156980 | Ga0207691_101569802 | 244 |
| 415 | 3300026023 | Ga0207677_10014282 | Ga0207677_100142822 | 244 |
| 416 | 3300026067 | Ga0207678_10135116 | Ga0207678_101351162 | 244 |
| 417 | 3300026116 | Ga0207674_10711878 | Ga0207674_107118781 | 244 |
| 418 | 3300031548 | Ga0307408_100611555 | Ga0307408_1006115551 | 244 |
| 419 | iso_pu_bacteria | 2928515477 | 2928517792 | 244 |
| 420 | 3300005338 | Ga0068868_100052343 | Ga0068868_1000523434 | 245 |
| 421 | 3300005458 | Ga0070681_10693433 | Ga0070681_106934331 | 245 |
| 422 | 3300005983 | Ga0081540_1001565 | Ga0081540_100156515 | 245 |
| 423 | 3300010375 | Ga0105239_10053753 | Ga0105239_100537534 | 245 |
| 424 | 3300014497 | Ga0182008_10000669 | Ga0182008_1000066919 | 245 |
| 425 | 3300025256 | Ga0209759_1001412 | Ga0209759_10014123 | 245 |
| 426 | 3300026023 | Ga0207677_10115678 | Ga0207677_101156782 | 245 |
| 427 | 3300031616 | Ga0307508_10000540 | Ga0307508_100005409 | 245 |
| 428 | 3300033180 | Ga0307510_10202538 | Ga0307510_102025382 | 245 |
| 429 | 3300039437 | Ga0436365_0010849 | Ga0436365_0010849_28_768 | 245 |
| 430 | 3300046452 | Ga0495617_000173 | Ga0495617_000173_27426_28163 | 245 |
| 431 | 3300046512 | Ga0495610_0065701 | Ga0495610_0065701_499_1236 | 245 |
| 432 | 3300046519 | Ga0495632_0005145 | Ga0495632_0005145_3824_4561 | 245 |
| 433 | 3300046694 | Ga0495649_0001610 | Ga0495649_0001610_9737_10474 | 245 |
| 434 | 3300046810 | Ga0495660_0014552 | Ga0495660_0014552_1715_2452 | 245 |
| 435 | 3300047443 | Ga0495687_018609 | Ga0495687_018609_307_1044 | 245 |
| 436 | 3300047443 | Ga0495687_075566 | Ga0495687_075566_295_1032 | 245 |
| 437 | 3300047472 | Ga0495686_0000966 | Ga0495686_0000966_29394_30134 | 245 |
| 438 | 3300048091 | Ga0495626_0041260 | Ga0495626_0041260_629_1366 | 245 |
| 439 | 3300049460 | Ga0495682_0017412 | Ga0495682_0017412_1868_2605 | 245 |
| 440 | 3300001989 | JGI24739J22299_10019621 | JGI24739J22299_100196213 | 246 |
| 441 | 3300003187 | JGI25151J46595_10000732 | JGI25151J46595_1000073219 | 246 |
| 442 | 3300003578 | Ga0006562J51391_1113999 | Ga0006562J51391_11139992 | 246 |
| 443 | 3300003578 | Ga0006562J51391_1114001 | Ga0006562J51391_11140012 | 246 |
| 444 | 3300003771 | Ga0055526_1009224 | Ga0055526_10092242 | 246 |
| 445 | 3300003773 | Ga0055537_1000211 | Ga0055537_100021118 | 246 |
| 446 | 3300003773 | Ga0055537_1001221 | Ga0055537_10012217 | 246 |
| 447 | 3300003775 | Ga0055524_1001351 | Ga0055524_10013518 | 246 |
| 448 | 3300003781 | Ga0055536_1001127 | Ga0055536_100112716 | 246 |
| 449 | 3300003784 | Ga0055534_1000210 | Ga0055534_100021019 | 246 |
| 450 | 3300003790 | Ga0055528_1000852 | Ga0055528_10008527 | 246 |
| 451 | 3300003790 | Ga0055528_1033087 | Ga0055528_10330872 | 246 |
| 452 | 3300003791 | Ga0055530_10012071 | Ga0055530_100120714 | 246 |
| 453 | 3300003792 | Ga0055540_1000142 | Ga0055540_100014256 | 246 |
| 454 | 3300003792 | Ga0055540_1000440 | Ga0055540_100044025 | 246 |
| 455 | 3300003794 | Ga0055531_10000424 | Ga0055531_1000042419 | 246 |
| 456 | 3300005288 | Ga0065714_10002999 | Ga0065714_1000299914 | 246 |
| 457 | 3300005327 | Ga0070658_10157981 | Ga0070658_101579812 | 246 |
| 458 | 3300005328 | Ga0070676_10008256 | Ga0070676_100082564 | 246 |
| 459 | 3300005328 | Ga0070676_10035874 | Ga0070676_100358742 | 246 |
| 460 | 3300005334 | Ga0068869_100135729 | Ga0068869_1001357291 | 246 |
| 461 | 3300005335 | Ga0070666_10532240 | Ga0070666_105322401 | 246 |
| 462 | 3300005338 | Ga0068868_100033575 | Ga0068868_1000335752 | 246 |
| 463 | 3300005344 | Ga0070661_100526060 | Ga0070661_1005260601 | 246 |
| 464 | 3300005364 | Ga0070673_100033026 | Ga0070673_1000330263 | 246 |
| 465 | 3300005364 | Ga0070673_100845287 | Ga0070673_1008452871 | 246 |
| 466 | 3300005366 | Ga0070659_100062096 | Ga0070659_1000620963 | 246 |
| 467 | 3300005367 | Ga0070667_100064340 | Ga0070667_1000643402 | 246 |
| 468 | 3300005445 | Ga0070708_100023257 | Ga0070708_1000232573 | 246 |
| 469 | 3300005457 | Ga0070662_100019528 | Ga0070662_1000195282 | 246 |
| 470 | 3300005457 | Ga0070662_100069781 | Ga0070662_1000697813 | 246 |
| 471 | 3300005539 | Ga0068853_100181082 | Ga0068853_1001810822 | 246 |
| 472 | 3300005543 | Ga0070672_100012578 | Ga0070672_1000125785 | 246 |
| 473 | 3300005543 | Ga0070672_100061128 | Ga0070672_1000611282 | 246 |
| 474 | 3300005545 | Ga0070695_100164525 | Ga0070695_1001645253 | 246 |
| 475 | 3300005564 | Ga0070664_100047384 | Ga0070664_1000473842 | 246 |
| 476 | 3300005564 | Ga0070664_100364151 | Ga0070664_1003641512 | 246 |
| 477 | 3300005577 | Ga0068857_100118879 | Ga0068857_1001188792 | 246 |
| 478 | 3300005577 | Ga0068857_100181224 | Ga0068857_1001812242 | 246 |
| 479 | 3300005841 | Ga0068863_100523186 | Ga0068863_1005231862 | 246 |
| 480 | 3300005843 | Ga0068860_100681797 | Ga0068860_1006817971 | 246 |
| 481 | 3300006048 | Ga0075363_100236535 | Ga0075363_1002365351 | 246 |
| 482 | 3300006177 | Ga0075362_10020852 | Ga0075362_100208522 | 246 |
| 483 | 3300006177 | Ga0075362_10037317 | Ga0075362_100373172 | 246 |
| 484 | 3300006186 | Ga0075369_10017548 | Ga0075369_100175482 | 246 |
| 485 | 3300006195 | Ga0075366_10005412 | Ga0075366_100054129 | 246 |
| 486 | 3300006353 | Ga0075370_10001410 | Ga0075370_1000141011 | 246 |
| 487 | 3300006353 | Ga0075370_10003126 | Ga0075370_100031261 | 246 |
| 488 | 3300006353 | Ga0075370_10003497 | Ga0075370_100034978 | 246 |
| 489 | 3300006353 | Ga0075370_10049456 | Ga0075370_100494563 | 246 |
| 490 | 3300006358 | Ga0068871_100335788 | Ga0068871_1003357882 | 246 |
| 491 | 3300006358 | Ga0068871_100433289 | Ga0068871_1004332891 | 246 |
| 492 | 3300006846 | Ga0075430_100062615 | Ga0075430_1000626152 | 246 |
| 493 | 3300006880 | Ga0075429_100097936 | Ga0075429_1000979363 | 246 |
| 494 | 3300006881 | Ga0068865_100077319 | Ga0068865_1000773193 | 246 |
| 495 | 3300006881 | Ga0068865_100170487 | Ga0068865_1001704872 | 246 |
| 496 | 3300006881 | Ga0068865_100228416 | Ga0068865_1002284162 | 246 |
| 497 | 3300006948 | Ga0099826_10000124 | Ga0099826_1000012424 | 246 |
| 498 | 3300006948 | Ga0099826_10111361 | Ga0099826_101113612 | 246 |
| 499 | 3300009036 | Ga0105244_10003295 | Ga0105244_1000329514 | 246 |
| 500 | 3300009036 | Ga0105244_10102435 | Ga0105244_101024351 | 246 |
| 501 | 3300009092 | Ga0105250_10030527 | Ga0105250_100305271 | 246 |
| 502 | 3300009093 | Ga0105240_10919149 | Ga0105240_109191491 | 246 |
| 503 | 3300009098 | Ga0105245_10155162 | Ga0105245_101551622 | 246 |
| 504 | 3300009098 | Ga0105245_10183341 | Ga0105245_101833412 | 246 |
| 505 | 3300009148 | Ga0105243_10003586 | Ga0105243_1000358611 | 246 |
| 506 | 3300009148 | Ga0105243_10063029 | Ga0105243_100630292 | 246 |
| 507 | 3300009148 | Ga0105243_10491158 | Ga0105243_104911582 | 246 |
| 508 | 3300009148 | Ga0105243_10628500 | Ga0105243_106285002 | 246 |
| 509 | 3300009174 | Ga0105241_10147033 | Ga0105241_101470332 | 246 |
| 510 | 3300009551 | Ga0105238_10169153 | Ga0105238_101691532 | 246 |
| 511 | 3300009553 | Ga0105249_10018226 | Ga0105249_100182269 | 246 |
| 512 | 3300010375 | Ga0105239_10425490 | Ga0105239_104254902 | 246 |
| 513 | 3300011119 | Ga0105246_10076816 | Ga0105246_100768163 | 246 |
| 514 | 3300011119 | Ga0105246_10672405 | Ga0105246_106724051 | 246 |
| 515 | 3300013100 | Ga0157373_10008499 | Ga0157373_100084996 | 246 |
| 516 | 3300013102 | Ga0157371_10002198 | Ga0157371_100021988 | 246 |
| 517 | 3300013306 | Ga0163162_10059527 | Ga0163162_100595273 | 246 |
| 518 | 3300014326 | Ga0157380_10581210 | Ga0157380_105812102 | 246 |
| 519 | 3300014497 | Ga0182008_10011327 | Ga0182008_100113274 | 246 |
| 520 | 3300014497 | Ga0182008_10011982 | Ga0182008_100119824 | 246 |
| 521 | 3300014745 | Ga0157377_10139293 | Ga0157377_101392932 | 246 |
| 522 | 3300015261 | Ga0182006_1003951 | Ga0182006_10039515 | 246 |
| 523 | 3300015261 | Ga0182006_1006971 | Ga0182006_10069716 | 246 |
| 524 | 3300015261 | Ga0182006_1009607 | Ga0182006_10096073 | 246 |
| 525 | 3300015262 | Ga0182007_10003759 | Ga0182007_100037595 | 246 |
| 526 | 3300015262 | Ga0182007_10015387 | Ga0182007_100153873 | 246 |
| 527 | 3300017792 | Ga0163161_10005078 | Ga0163161_100050786 | 246 |
| 528 | 3300017792 | Ga0163161_10056146 | Ga0163161_100561464 | 246 |
| 529 | 3300025263 | Ga0209565_1000039 | Ga0209565_1000039141 | 246 |
| 530 | 3300025263 | Ga0209565_1000077 | Ga0209565_100007727 | 246 |
| 531 | 3300025273 | Ga0209673_1000146 | Ga0209673_1000146123 | 246 |
| 532 | 3300025273 | Ga0209673_1024153 | Ga0209673_10241532 | 246 |
| 533 | 3300025291 | Ga0209675_1000030 | Ga0209675_1000030141 | 246 |
| 534 | 3300025291 | Ga0209675_1002647 | Ga0209675_10026473 | 246 |
| 535 | 3300025292 | Ga0209676_1000152 | Ga0209676_1000152137 | 246 |
| 536 | 3300025292 | Ga0209676_1013324 | Ga0209676_10133243 | 246 |
| 537 | 3300025294 | Ga0209025_1000231 | Ga0209025_1000231100 | 246 |
| 538 | 3300025295 | Ga0209564_1000080 | Ga0209564_1000080152 | 246 |
| 539 | 3300025295 | Ga0209564_1000274 | Ga0209564_100027427 | 246 |
| 540 | 3300025295 | Ga0209564_1031142 | Ga0209564_10311422 | 246 |
| 541 | 3300025297 | Ga0209758_1042613 | Ga0209758_10426132 | 246 |
| 542 | 3300025298 | Ga0209050_1000210 | Ga0209050_100021029 | 246 |
| 543 | 3300025299 | Ga0209256_1000119 | Ga0209256_100011927 | 246 |
| 544 | 3300025303 | Ga0209051_1000074 | Ga0209051_100007428 | 246 |
| 545 | 3300025303 | Ga0209051_1000161 | Ga0209051_100016117 | 246 |
| 546 | 3300025304 | Ga0209257_1000072 | Ga0209257_100007229 | 246 |
| 547 | 3300025315 | Ga0207697_10036058 | Ga0207697_100360582 | 246 |
| 548 | 3300025728 | Ga0207655_1001284 | Ga0207655_100128431 | 246 |
| 549 | 3300025728 | Ga0207655_1015387 | Ga0207655_10153873 | 246 |
| 550 | 3300025728 | Ga0207655_1015752 | Ga0207655_10157521 | 246 |
| 551 | 3300025907 | Ga0207645_10002245 | Ga0207645_100022454 | 246 |
| 552 | 3300025907 | Ga0207645_10043273 | Ga0207645_100432733 | 246 |
| 553 | 3300025908 | Ga0207643_10036455 | Ga0207643_100364553 | 246 |
| 554 | 3300025911 | Ga0207654_10188462 | Ga0207654_101884621 | 246 |
| 555 | 3300025926 | Ga0207659_10484234 | Ga0207659_104842342 | 246 |
| 556 | 3300025927 | Ga0207687_10125912 | Ga0207687_101259122 | 246 |
| 557 | 3300025927 | Ga0207687_10728662 | Ga0207687_107286621 | 246 |
| 558 | 3300025931 | Ga0207644_10030603 | Ga0207644_100306032 | 246 |
| 559 | 3300025931 | Ga0207644_10257453 | Ga0207644_102574531 | 246 |
| 560 | 3300025933 | Ga0207706_10006621 | Ga0207706_100066218 | 246 |
| 561 | 3300025933 | Ga0207706_10102599 | Ga0207706_101025993 | 246 |
| 562 | 3300025935 | Ga0207709_10003293 | Ga0207709_1000329310 | 246 |
| 563 | 3300025935 | Ga0207709_10154628 | Ga0207709_101546282 | 246 |
| 564 | 3300025935 | Ga0207709_10491146 | Ga0207709_104911461 | 246 |
| 565 | 3300025938 | Ga0207704_10608494 | Ga0207704_106084942 | 246 |
| 566 | 3300025940 | Ga0207691_10042905 | Ga0207691_100429054 | 246 |
| 567 | 3300025940 | Ga0207691_10110267 | Ga0207691_101102672 | 246 |
| 568 | 3300025945 | Ga0207679_10007872 | Ga0207679_100078723 | 246 |
| 569 | 3300025945 | Ga0207679_10351562 | Ga0207679_103515622 | 246 |
| 570 | 3300025960 | Ga0207651_10024787 | Ga0207651_100247872 | 246 |
| 571 | 3300025960 | Ga0207651_10256796 | Ga0207651_102567961 | 246 |
| 572 | 3300025986 | Ga0207658_10093633 | Ga0207658_100936333 | 246 |
| 573 | 3300026041 | Ga0207639_10142888 | Ga0207639_101428882 | 246 |
| 574 | 3300026088 | Ga0207641_10480487 | Ga0207641_104804872 | 246 |
| 575 | 3300026089 | Ga0207648_10009736 | Ga0207648_100097362 | 246 |
| 576 | 3300026116 | Ga0207674_10037026 | Ga0207674_100370266 | 246 |
| 577 | 3300026116 | Ga0207674_10221007 | Ga0207674_102210072 | 246 |
| 578 | 3300026116 | Ga0207674_10242196 | Ga0207674_102421962 | 246 |
| 579 | 3300026118 | Ga0207675_100069363 | Ga0207675_1000693631 | 246 |
| 580 | 3300026121 | Ga0207683_10046071 | Ga0207683_100460713 | 246 |
| 581 | 3300026121 | Ga0207683_10348811 | Ga0207683_103488112 | 246 |
| 582 | 3300027666 | Ga0209282_1000271 | Ga0209282_10002714 | 246 |
| 583 | 3300027666 | Ga0209282_1092749 | Ga0209282_10927492 | 246 |
| 584 | 3300028381 | Ga0268264_10644293 | Ga0268264_106442931 | 246 |
| 585 | 3300031238 | Ga0265332_10000014 | Ga0265332_10000014150 | 246 |
| 586 | 3300031239 | Ga0265328_10034067 | Ga0265328_100340672 | 246 |
| 587 | 3300031251 | Ga0265327_10026190 | Ga0265327_100261904 | 246 |
| 588 | 3300031548 | Ga0307408_100025535 | Ga0307408_1000255354 | 246 |
| 589 | 3300031548 | Ga0307408_100067122 | Ga0307408_1000671222 | 246 |
| 590 | 3300031548 | Ga0307408_100239453 | Ga0307408_1002394532 | 246 |
| 591 | 3300031548 | Ga0307408_100638469 | Ga0307408_1006384692 | 246 |
| 592 | 3300031731 | Ga0307405_10087738 | Ga0307405_100877381 | 246 |
| 593 | 3300031824 | Ga0307413_10049566 | Ga0307413_100495663 | 246 |
| 594 | 3300031852 | Ga0307410_10046909 | Ga0307410_100469093 | 246 |
| 595 | 3300031901 | Ga0307406_10086285 | Ga0307406_100862852 | 246 |
| 596 | 3300031903 | Ga0307407_10336374 | Ga0307407_103363742 | 246 |
| 597 | 3300031911 | Ga0307412_10129338 | Ga0307412_101293382 | 246 |
| 598 | 3300031911 | Ga0307412_10191498 | Ga0307412_101914982 | 246 |
| 599 | 3300031995 | Ga0307409_100073132 | Ga0307409_1000731322 | 246 |
| 600 | 3300031995 | Ga0307409_100261529 | Ga0307409_1002615291 | 246 |
| 601 | 3300032002 | Ga0307416_100129803 | Ga0307416_1001298032 | 246 |
| 602 | 3300032002 | Ga0307416_100627346 | Ga0307416_1006273462 | 246 |
| 603 | 3300032004 | Ga0307414_10030580 | Ga0307414_100305804 | 246 |
| 604 | 3300032005 | Ga0307411_10084373 | Ga0307411_100843732 | 246 |
| 605 | 3300037068 | Ga0373925_0147075 | Ga0373925_0147075_898_1638 | 246 |
| 606 | 3300037466 | Ga0395898_0527700 | Ga0395898_0527700_198_1013 | 246 |
| 607 | 3300037471 | Ga0395905_0000954 | Ga0395905_0000954_33362_34102 | 246 |
| 608 | 3300038443 | Ga0395901_0081149 | Ga0395901_0081149_726_1541 | 246 |
| 609 | 3300041406 | Ga0439439_0021499 | Ga0439439_0021499_823_1563 | 246 |
| 610 | 3300041407 | Ga0439447_017483 | Ga0439447_017483_139_879 | 246 |
| 611 | 3300041410 | Ga0439461_0008914 | Ga0439461_0008914_905_1645 | 246 |
| 612 | 3300041411 | Ga0439466_0013462 | Ga0439466_0013462_1971_2711 | 246 |
| 613 | 3300041413 | Ga0439465_0002620 | Ga0439465_0002620_3483_4223 | 246 |
| 614 | 3300041997 | Ga0439431_0009625 | Ga0439431_0009625_1134_1874 | 246 |
| 615 | 3300042002 | Ga0439442_014798 | Ga0439442_014798_396_1136 | 246 |
| 616 | 3300042006 | Ga0439432_005849 | Ga0439432_005849_629_1369 | 246 |
| 617 | 3300042006 | Ga0439432_014181 | Ga0439432_014181_786_1526 | 246 |
| 618 | 3300042007 | Ga0439449_0000247 | Ga0439449_0000247_13789_14529 | 246 |
| 619 | 3300042007 | Ga0439449_0005204 | Ga0439449_0005204_1438_2178 | 246 |
| 620 | 3300042007 | Ga0439449_0017901 | Ga0439449_0017901_1879_2619 | 246 |
| 621 | 3300042010 | Ga0439452_009766 | Ga0439452_009766_636_1376 | 246 |
| 622 | 3300042014 | Ga0439457_017767 | Ga0439457_017767_76_816 | 246 |
| 623 | 3300042015 | Ga0439462_0008533 | Ga0439462_0008533_1279_2019 | 246 |
| 624 | 3300042015 | Ga0439462_0021195 | Ga0439462_0021195_941_1681 | 246 |
| 625 | 3300042015 | Ga0439462_0086393 | Ga0439462_0086393_18_758 | 246 |
| 626 | 3300042122 | Ga0450920_024778 | Ga0450920_024778_323_1063 | 246 |
| 627 | 3300042133 | Ga0450896_022952 | Ga0450896_022952_97_837 | 246 |
| 628 | 3300042156 | Ga0439446_0038133 | Ga0439446_0038133_618_1358 | 246 |
| 629 | 3300042435 | Ga0439434_0022567 | Ga0439434_0022567_177_917 | 246 |
| 630 | 3300042531 | Ga0450918_001959 | Ga0450918_001959_2364_3104 | 246 |
| 631 | 3300045051 | Ga0451576_0705789 | Ga0451576_0705789_59_799 | 246 |
| 632 | 3300046459 | Ga0495629_0207622 | Ga0495629_0207622_378_1118 | 246 |
| 633 | 3300046474 | Ga0495605_0000191 | Ga0495605_0000191_73954_74694 | 246 |
| 634 | 3300046615 | Ga0495656_0012345 | Ga0495656_0012345_1932_2672 | 246 |
| 635 | 3300046615 | Ga0495656_0042534 | Ga0495656_0042534_541_1281 | 246 |
| 636 | 3300046660 | Ga0495625_0000224 | Ga0495625_0000224_32532_33272 | 246 |
| 637 | 3300046660 | Ga0495625_0033145 | Ga0495625_0033145_1439_2206 | 246 |
| 638 | 3300046664 | Ga0495659_0120422 | Ga0495659_0120422_42_782 | 246 |
| 639 | 3300046678 | Ga0495599_0219509 | Ga0495599_0219509_178_918 | 246 |
| 640 | 3300047315 | Ga0495581_0267370 | Ga0495581_0267370_175_915 | 246 |
| 641 | 3300047443 | Ga0495687_000196 | Ga0495687_000196_49897_50649 | 246 |
| 642 | 3300048089 | Ga0495614_0079503 | Ga0495614_0079503_82_822 | 246 |
| 643 | 3300048903 | Ga0496100_0161959 | Ga0496100_0161959_181_921 | 246 |
| 644 | 3300048904 | Ga0496101_0000635 | Ga0496101_0000635_241_981 | 246 |
| 645 | 3300048905 | Ga0496102_0005808 | Ga0496102_0005808_856_1596 | 246 |
| 646 | 3300048906 | Ga0496103_0190326 | Ga0496103_0190326_25_765 | 246 |
| 647 | 3300048907 | Ga0496104_0024424 | Ga0496104_0024424_1580_2320 | 246 |
| 648 | 3300048908 | Ga0496105_0013557 | Ga0496105_0013557_2629_3369 | 246 |
| 649 | 3300048909 | Ga0496106_0242495 | Ga0496106_0242495_450_1190 | 246 |
| 650 | 3300048910 | Ga0496107_0015376 | Ga0496107_0015376_2360_3100 | 246 |
| 651 | 3300048911 | Ga0496108_0193817 | Ga0496108_0193817_96_836 | 246 |
| 652 | 3300048912 | Ga0496109_0412295 | Ga0496109_0412295_503_1243 | 246 |
| 653 | 3300048913 | Ga0496110_0074208 | Ga0496110_0074208_104_844 | 246 |
| 654 | 3300048917 | Ga0496114_0076605 | Ga0496114_0076605_1306_2046 | 246 |
| 655 | 3300048919 | Ga0496116_0083250 | Ga0496116_0083250_578_1318 | 246 |
| 656 | 3300048920 | Ga0496117_0017981 | Ga0496117_0017981_5027_5767 | 246 |
| 657 | 3300048921 | Ga0496118_0110091 | Ga0496118_0110091_1039_1779 | 246 |
| 658 | 3300048924 | Ga0496121_0044718 | Ga0496121_0044718_309_1049 | 246 |
| 659 | 3300048927 | Ga0496124_0139835 | Ga0496124_0139835_203_943 | 246 |
| 660 | 3300048928 | Ga0496125_0085219 | Ga0496125_0085219_147_887 | 246 |
| 661 | 3300049571 | Ga0501034_0615750 | Ga0501034_0615750_178_924 | 246 |
| 662 | 3300050489 | nmdc:mga03683_2500_c1 | nmdc:mga03683_2500_c1_3906_4646 | 246 |
| 663 | 3300050490 | nmdc:mga03n38_38719_c1 | nmdc:mga03n38_38719_c1_342_1082 | 246 |
| 664 | 3300050493 | nmdc:mga0k408_168172_c1 | nmdc:mga0k408_168172_c1_91_831 | 246 |
| 665 | 3300050493 | nmdc:mga0k408_287262_c1 | nmdc:mga0k408_287262_c1_199_942 | 246 |
| 666 | 3300050493 | nmdc:mga0k408_319333_c1 | nmdc:mga0k408_319333_c1_171_911 | 246 |
| 667 | 3300050496 | nmdc:mga07m45_10347_c1 | nmdc:mga07m45_10347_c1_3599_4339 | 246 |
| 668 | 3300050496 | nmdc:mga07m45_5338_c1 | nmdc:mga07m45_5338_c1_2165_2905 | 246 |
| 669 | 3300050496 | nmdc:mga07m45_63216_c1 | nmdc:mga07m45_63216_c1_113_853 | 246 |
| 670 | 3300050496 | nmdc:mga07m45_9761_c1 | nmdc:mga07m45_9761_c1_892_1635 | 246 |
| 671 | 3300050508 | nmdc:mga09592_148270_c1 | nmdc:mga09592_148270_c1_235_975 | 246 |
| 672 | 3300050516 | nmdc:mga0sz30_2078_c1 | nmdc:mga0sz30_2078_c1_2163_2903 | 246 |
| 673 | 3300053122 | Ga0500608_004413 | Ga0500608_004413_1838_2578 | 246 |
| 674 | 3300053153 | Ga0500616_0177739 | Ga0500616_0177739_115_855 | 246 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3h7a-assembly1.cif.gz_D | crystal structure of short-chain dehydrogenase from rhodopseudomonas palustris | 0.9494 | 6 | 242 |
| 3h7a-assembly1.cif.gz_D | crystal structure of short-chain dehydrogenase from rhodopseudomonas palustris | 0.945 | 6 | 242 |
| 1gz6-assembly1.cif.gz_B | (3r)-hydroxyacyl-coa dehydrogenase fragment of rat peroxisomal multifunctional enzyme type 2 | 0.9285 | 10 | 221 |
| 3tfo-assembly1.cif.gz_C | crystal structure of a putative 3-oxoacyl-(acyl-carrier-protein) reductase from sinorhizobium meliloti | 0.9186 | 10 | 241 |
| 3rkr-assembly1.cif.gz_A-2 | crystal structure of a metagenomic short-chain oxidoreductase (sdr) in complex with nadp | 0.9127 | 7 | 244 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3h7aB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9449 | 6 | 242 | 3.40.50.720 |
| 3h7aB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9406 | 6 | 242 | 3.40.50.720 |
| af_Q54Q52_3_240_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9163 | 10 | 246 | 3.40.50.720 |
| af_Q2QLP7_18_222_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9131 | 10 | 186 | 3.40.50.720 |
| 3rkrA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9127 | 7 | 244 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0S8B7B9-F1-model_v4 | Glucose 1-dehydrogenase | 0.9747 | 25 | 246 |
|
| AF-A0A7V7WY37-F1-model_v4 | SDR family oxidoreductase | 0.9743 | 9 | 246 |
|
| AF-Q1LFL2-F1-model_v4 | Short-chain dehydrogenase/reductase SDR | 0.9722 | 7 | 246 |
|
| AF-V2IPS4-F1-model_v4 | Short-chain dehydrogenase | 0.9713 | 5 | 246 |
|
| AF-A0A2R6XL40-F1-model_v4 | Short-chain dehydrogenase/reductase SDR | 0.9701 | 9 | 246 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar