F474300

General Info

Members Datasets Scaffolds Average Seq Length
673 523 324 248

Family's Representative Sequence

Representative Sequence 3300009098|Ga0105245_10185233|Ga0105245_101852332
Length 275
Sequence LHLTTCIDVAQRAPRLYTIQRTIEDDMSVAEKSQKKSGGLGETVSVIVQALLLALVIRTLLFQPFSIPSGSMRPTLLEGDYLFVTKWSYGYSRYSLPFGPDLFSGRIWGSEPKRGDVVVFKFPPDPSVDYIKRVVGLPGDKIQMKNGQLFINGAGVPRVKTGQIDNPDITEMPQPIDVYRETLPNGVSYDTLDLNPNSIGDNTREFDVPPGPYFMIGDNRDNSADSRFTVGYVPAENLVGRANLVFFSIAGKASPLEIWKWPSLMRVSRLFHFVN

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
3 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
4 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
5 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
6 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
7 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
8 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
9 2512875024 Mesorhizobium loti R88b Isolate Nodule
10 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
11 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
12 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
13 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
14 2516143018 Ensifer sp. BR816 Isolate Nodule
15 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
16 2534681786 Brucella suis 92/29 Isolate Unclassified
17 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
18 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
19 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
20 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
21 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
22 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
23 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
24 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
25 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
26 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
27 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
28 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
29 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
30 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
31 2643221557 Ensifer sp. Root558 Isolate Unclassified
32 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
33 2643221568 Rhizobium sp. Root564 Isolate Unclassified
34 2643221582 Rhizobium sp. Root651 Isolate Unclassified
35 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
36 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
37 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
38 2643221668 Ensifer sp. Root423 Isolate Unclassified
39 2643221693 Rhizobium sp. Root491 Isolate Unclassified
40 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
41 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
42 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
43 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
44 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
45 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
46 2738543024 Aminobacter sp. AP02 Isolate Unclassified
47 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
48 2751185800 Brucella pituitosa AA2 Isolate Unclassified
49 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
50 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
51 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
52 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
53 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
54 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
55 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
56 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
57 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
58 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
59 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
60 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
61 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
62 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
63 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
64 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
65 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
66 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
67 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
68 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
69 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
70 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
71 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
72 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
73 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
74 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
75 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
76 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
77 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
78 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
79 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
80 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
81 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
82 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
83 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
84 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
85 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
86 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
87 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
88 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
89 2854911287 Brucella lupini LUP21 Isolate Unclassified
90 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
91 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
92 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
93 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
94 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
95 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
96 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
97 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
98 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
99 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
100 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
101 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
102 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
103 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
104 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
105 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
106 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
107 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
108 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
109 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
110 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
111 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
112 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
113 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
114 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
115 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
116 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
117 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
118 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
119 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
120 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
121 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
122 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
123 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
124 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
125 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
126 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
127 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
128 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
129 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
130 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
131 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
132 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
133 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
134 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
135 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
136 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
137 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
138 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
139 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
140 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
141 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
142 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
143 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
144 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
145 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
146 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
147 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
148 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
149 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
150 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
151 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
152 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
153 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
154 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
155 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
156 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
157 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
158 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
159 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
160 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
161 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
162 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
163 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
164 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
165 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
166 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
167 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
168 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
169 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
170 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
171 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
172 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
173 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
174 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
175 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
176 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
177 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
178 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
179 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
180 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
181 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
182 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
183 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
184 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
185 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
186 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
187 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
188 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
189 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
190 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
191 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
192 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
193 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
194 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
195 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
196 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
197 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
198 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
199 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
200 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
201 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
202 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
203 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
204 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
205 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
206 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
207 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
208 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
209 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
210 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
211 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
212 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
213 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
214 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
215 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
216 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
217 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
218 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
219 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
220 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
221 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
222 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
223 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
224 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
225 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
226 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
227 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
228 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
229 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
230 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
231 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
232 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
233 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
234 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
235 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
236 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
237 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
238 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
239 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
240 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
241 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
242 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
243 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
244 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
245 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
246 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
247 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
248 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
249 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
250 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
251 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
252 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
253 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
254 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
255 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
256 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
257 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
258 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
259 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
260 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
261 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
262 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
263 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
264 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
265 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
266 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
267 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
268 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
269 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
270 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
271 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
272 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
273 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
274 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
275 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
276 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
277 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
278 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
279 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
280 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
281 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
282 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
283 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
284 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
285 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
286 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
287 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
288 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
289 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
290 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
291 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
292 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
293 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
294 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
295 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
296 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
297 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
298 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
299 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
300 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
301 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
302 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
303 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
304 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
305 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
306 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
307 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
308 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
309 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
310 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
311 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
312 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
313 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
314 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
315 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
316 3004167301 Mesorhizobium loti 582 Isolate Unclassified
317 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
318 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
319 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
320 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
321 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
322 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
323 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
324 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
325 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
326 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
327 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
328 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
329 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
330 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
331 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
332 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
333 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
334 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
335 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
336 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
337 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
338 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
339 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
340 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
341 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
342 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
343 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
344 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
345 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
346 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
347 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
348 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
349 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
350 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
351 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
352 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
353 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
354 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
355 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
356 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
357 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
358 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
359 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
360 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
361 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
362 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
363 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
364 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
365 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
366 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
367 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
368 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
369 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
370 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
371 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
372 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
373 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
374 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
375 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
376 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
377 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
378 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
379 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
380 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
381 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
382 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
383 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
384 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
385 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
386 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
387 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
388 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
389 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
390 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
391 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
392 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
393 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
394 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
395 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
396 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
397 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
398 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
399 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
400 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
401 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
402 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
403 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
404 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
405 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
406 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
407 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
408 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
409 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
410 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
411 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
412 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
413 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
414 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
415 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
416 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
417 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
418 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
419 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
420 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
421 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
422 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
423 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
424 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
425 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
426 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
427 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
428 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
429 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
430 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
431 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
432 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
433 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
434 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
435 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
436 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
437 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
438 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
439 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
440 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
441 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
442 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
443 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
444 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
445 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
446 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
447 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
448 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
449 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
450 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
451 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
452 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
453 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
454 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
455 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
456 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
457 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
458 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
459 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
460 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
461 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
462 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
463 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
464 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
465 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
466 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
467 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
468 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
469 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
470 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
471 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
472 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
473 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
474 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
475 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
476 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
477 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
478 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
479 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
480 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
481 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
482 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
483 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
484 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
485 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
486 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
487 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
488 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
489 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
490 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
491 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
492 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
493 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
494 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
495 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
496 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
497 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
498 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
499 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
500 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
501 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
502 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
503 3300059651 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
504 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
505 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
506 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
507 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
508 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
509 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
510 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
511 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
512 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
513 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
514 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
515 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
516 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
517 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
518 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
519 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
520 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
521 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
522 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
523 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 47.55
Metatranscriptomes 0.59
Isolates 51.86

Biome Distribution

Category Percentage (%)
Aerial Root 0.74
Bulb 0
Endosphere 9.66
Nodule 37.3
Rhizoplane 2.67
Rhizosphere 34.03
Stem 0
Stem Tuber 0
Unclassified 15.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10024397 3300001979 Bacteria 2052
2 JGI24739J22299_10007696 3300001989 Bacteria 4029
3 JGI24739J22299_10056678 3300001989 Bacteria 1249
4 JGI24735J21928_10006906 3300002067 Bacteria 3717
5 JGI25156J39149_1007302 3300002705 Bacteria 2921
6 JGI25157J39369_1001413 3300002741 Bacteria 9155
7 JGI25165J46597_1000028 3300003214 Bacteria 325146
8 Ga0055542_1001586 3300003762 Bacteria 10546
9 Ga0055542_1001800 3300003762 Bacteria 8882
10 Ga0055529_1006399 3300003763 Bacteria 1650
11 Ga0055524_1001301 3300003775 Bacteria 14618
12 Ga0058692_1001670 3300003856 Bacteria 7967
13 Ga0058692_1002906 3300003856 Bacteria 5540
14 Ga0070680_100500933 3300005336 Bacteria 1039
15 Ga0070660_100160827 3300005339 Bacteria 1809
16 Ga0070674_100117929 3300005356 Bacteria 1960
17 Ga0070659_100123624 3300005366 Bacteria 2098
18 Ga0070663_100080493 3300005455 Bacteria 2392
19 Ga0068867_100703974 3300005459 Bacteria 892
20 Ga0068853_100111880 3300005539 Bacteria 2426
21 Ga0070665_100025048 3300005548 Bacteria 6014
22 Ga0070665_100073810 3300005548 Bacteria 3417
23 Ga0068855_100422595 3300005563 Bacteria 1458
24 Ga0068855_100567794 3300005563 Bacteria 1226
25 Ga0068856_100118758 3300005614 Bacteria 2645
26 Ga0068852_100104729 3300005616 Bacteria 2561
27 Ga0081455_10057792 3300005937 Bacteria 3286
28 Ga0081540_1007848 3300005983 Bacteria 7544
29 Ga0081539_10008531 3300005985 Bacteria 8886
30 Ga0075365_10001916 3300006038 Bacteria 9809
31 Ga0075365_10036833 3300006038 Bacteria 3172
32 Ga0075365_10077682 3300006038 Bacteria 2243
33 Ga0075368_10007335 3300006042 Bacteria 3888
34 Ga0075368_10034699 3300006042 Bacteria 1966
35 Ga0075363_100066015 3300006048 Bacteria 1957
36 Ga0075363_100076185 3300006048 Bacteria 1828
37 Ga0075364_10000626 3300006051 Bacteria 18199
38 Ga0075364_10019200 3300006051 Bacteria 4289
39 Ga0075364_10078825 3300006051 Bacteria 2176
40 Ga0075362_10018882 3300006177 Bacteria 2860
41 Ga0075362_10081216 3300006177 Bacteria 1494
42 Ga0075367_10020251 3300006178 Bacteria 3701
43 Ga0075367_10025683 3300006178 Bacteria 3333
44 Ga0075369_10008812 3300006186 Bacteria 3896
45 Ga0075369_10039311 3300006186 Bacteria 2020
46 Ga0075369_10058278 3300006186 Bacteria 1681
47 Ga0075366_10007799 3300006195 Bacteria 5925
48 Ga0075370_10126902 3300006353 Bacteria 1487
49 Ga0075370_10322935 3300006353 Bacteria 920
50 Ga0075428_100349449 3300006844 Bacteria 1587
51 Ga0099826_10000859 3300006948 Bacteria 16488
52 Ga0105240_10426516 3300009093 Bacteria 1489
53 Ga0105245_10185233 3300009098 Bacteria 1991
54 Ga0105245_10635334 3300009098 Bacteria 1097
55 Ga0105243_10054588 3300009148 Bacteria 3173
56 Ga0105241_10152799 3300009174 Bacteria 1890
57 Ga0105237_10041428 3300009545 Bacteria 4644
58 Ga0105237_10596786 3300009545 Bacteria 1111
59 Ga0105238_10013813 3300009551 Bacteria 8163
60 Ga0105238_10396215 3300009551 Bacteria 1373
61 Ga0105239_10038611 3300010375 Bacteria 5234
62 Ga0105246_10289255 3300011119 Bacteria 1318
63 Ga0105246_10412181 3300011119 Bacteria 1125
64 Ga0157373_10003685 3300013100 Bacteria 11585
65 Ga0157371_10000380 3300013102 Bacteria 55836
66 Ga0157371_10030075 3300013102 Bacteria 3920
67 Ga0157370_10000748 3300013104 Bacteria 40596
68 Ga0157370_10087023 3300013104 Bacteria 2935
69 Ga0157369_10160761 3300013105 Bacteria 2371
70 Ga0157378_10103604 3300013297 Bacteria 2600
71 Ga0163162_10350234 3300013306 Bacteria 1610
72 Ga0157372_10245231 3300013307 Bacteria 2079
73 Ga0157372_10578995 3300013307 Bacteria 1308
74 Ga0157379_10404349 3300014968 Bacteria 1255
75 Ga0182006_1028288 3300015261 Bacteria 2280
76 Ga0214544_1000008 3300021320 Bacteria 326027
77 Ga0214542_1005858 3300021321 Bacteria 23010
78 Ga0214543_1005579 3300021327 Bacteria 23010
79 Ga0209646_1011669 3300025246 Bacteria 1357
80 Ga0209026_1000215 3300025250 Bacteria 80382
81 Ga0209148_1000056 3300025254 Bacteria 363380
82 Ga0209759_1000478 3300025256 Bacteria 44559
83 Ga0209233_1000087 3300025261 Bacteria 325225
84 Ga0209455_1000137 3300025272 Bacteria 142099
85 Ga0209025_1000074 3300025294 Bacteria 277445
86 Ga0209025_1000080 3300025294 Bacteria 267244
87 Ga0209758_1008307 3300025297 Bacteria 6773
88 Ga0207705_10054760 3300025909 Bacteria 2875
89 Ga0207654_10077613 3300025911 Bacteria 1991
90 Ga0207695_10072649 3300025913 Bacteria 3508
91 Ga0207657_10159904 3300025919 Bacteria 1830
92 Ga0207690_10269734 3300025932 Bacteria 1322
93 Ga0207709_10031697 3300025935 Bacteria 3090
94 Ga0207669_10350418 3300025937 Bacteria 1140
95 Ga0207640_10171338 3300025981 Bacteria 1618
96 Ga0207639_10028627 3300026041 Bacteria 4070
97 Ga0207678_10052608 3300026067 Bacteria 3512
98 Ga0207678_10104408 3300026067 Bacteria 2418
99 Ga0207678_10183794 3300026067 Bacteria 1785
100 Ga0207648_10058392 3300026089 Bacteria 3364
101 Ga0207674_10124910 3300026116 Bacteria 2539
102 Ga0207683_10163516 3300026121 Bacteria 2013
103 Ga0207698_10197886 3300026142 Bacteria 1797
104 Ga0207698_10335091 3300026142 Bacteria 1423
105 Ga0209371_1000021 3300027312 Bacteria 555864
106 Ga0209371_1003040 3300027312 Bacteria 8632
107 Ga0209282_1000483 3300027666 Bacteria 19392
108 Ga0209813_10005510 3300027866 Bacteria 3075
109 Ga0268266_10010946 3300028379 Bacteria 7896
110 Ga0268266_10022089 3300028379 Bacteria 5424
111 Ga0268266_10084145 3300028379 Bacteria 2778
112 Ga0268264_10473565 3300028381 Bacteria 1217
113 Ga0268256_1000020 3300030500 Bacteria 557873
114 Ga0268256_1006707 3300030500 Bacteria 4234
115 Ga0316181_1167977 3300030744 Bacteria 2558
116 Ga0307408_100490478 3300031548 Bacteria 1074
117 Ga0307510_10299852 3300033180 Bacteria 1070
118 Ga0395899_0000059 3300037312 Bacteria 213004
119 Ga0395899_0058938 3300037312 Bacteria 2831
120 Ga0395900_0000017 3300037418 Bacteria 369602
121 Ga0395900_0041650 3300037418 Bacteria 4734
122 Ga0395900_0396415 3300037418 Bacteria 1345
123 Ga0395898_0000030 3300037466 Bacteria 369577
124 Ga0395905_0000056 3300037471 Bacteria 209230
125 Ga0395905_0038783 3300037471 Bacteria 4468
126 Ga0395905_0117305 3300037471 Bacteria 2501
127 Ga0395905_0341531 3300037471 Bacteria 1388
128 Ga0395901_0000015 3300038443 Bacteria 373388
129 Ga0395901_0021337 3300038443 Bacteria 6635
130 Ga0395901_0073601 3300038443 Bacteria 3563
131 Ga0395901_0125454 3300038443 Bacteria 2698
132 Ga0395901_0306309 3300038443 Bacteria 1646
133 Ga0395901_0424660 3300038443 Bacteria 1363
134 Ga0395901_0475378 3300038443 Bacteria 1275
135 Ga0439436_0004198 3300041404 Bacteria 4414
136 Ga0451793_0783434 3300041452 Bacteria 1177
137 Ga0451802_2155873 3300041460 Bacteria 1323
138 Ga0439448_0035944 3300042005 Bacteria 1588
139 Ga0466972_0015562 3300044658 Bacteria 3802
140 Ga0466960_0043832 3300044901 Bacteria 2130
141 Ga0466967_0193794 3300045976 Bacteria 1922
142 Ga0495638_0008182 3300046460 Bacteria 7435
143 Ga0495606_0167840 3300046507 Bacteria 1276
144 Ga0495631_0127337 3300046518 Bacteria 1095
145 Ga0495643_0036263 3300046522 Bacteria 2710
146 Ga0495643_0120812 3300046522 Bacteria 1324
147 Ga0495654_0000198 3300046530 Bacteria 58451
148 Ga0495625_0114672 3300046660 Bacteria 1839
149 Ga0495588_0023685 3300046674 Bacteria 3042
150 Ga0495671_0010893 3300046692 Bacteria 5024
151 Ga0495672_0125404 3300047320 Bacteria 1359
152 Ga0496102_0567500 3300048905 Bacteria 1058
153 Ga0496103_0223829 3300048906 Bacteria 1210
154 Ga0496105_0142711 3300048908 Bacteria 1971
155 Ga0496108_0319092 3300048911 Bacteria 1355
156 Ga0496110_0520804 3300048913 Bacteria 1082
157 Ga0496112_0124980 3300048915 Bacteria 2543
158 Ga0496113_0014660 3300048916 Bacteria 5357
159 Ga0496113_0439565 3300048916 Bacteria 1048
160 Ga0496115_0238607 3300048918 Bacteria 1499
161 Ga0496116_0000036 3300048919 Bacteria 388508
162 Ga0496116_0030524 3300048919 Bacteria 3870
163 Ga0496117_0000002 3300048920 Bacteria 2483758
164 Ga0496117_0077827 3300048920 Bacteria 2193
165 Ga0496117_0121961 3300048920 Bacteria 1599
166 Ga0496118_0000214 3300048921 Bacteria 100898
167 Ga0496119_0007236 3300048922 Bacteria 10047
168 Ga0496119_0025883 3300048922 Bacteria 4085
169 Ga0496119_0027287 3300048922 Bacteria 3929
170 Ga0496120_0000125 3300048923 Bacteria 128983
171 Ga0496120_0000860 3300048923 Bacteria 42971
172 Ga0496120_0125140 3300048923 Bacteria 1324
173 Ga0496120_0137784 3300048923 Bacteria 1242
174 Ga0496121_0389861 3300048924 Bacteria 916
175 Ga0496122_0000001 3300048925 Bacteria 1827766
176 Ga0496122_0014863 3300048925 Bacteria 7496
177 Ga0496122_0059237 3300048925 Bacteria 2827
178 Ga0496122_0071209 3300048925 Bacteria 2479
179 Ga0496123_0000001 3300048926 Bacteria 1831497
180 Ga0496123_0012003 3300048926 Bacteria 7431
181 Ga0496123_0071533 3300048926 Bacteria 2163
182 Ga0496124_0004429 3300048927 Bacteria 16380
183 Ga0496124_0417945 3300048927 Bacteria 925
184 Ga0496125_0051318 3300048928 Bacteria 3403
185 Ga0496125_0081890 3300048928 Bacteria 2463
186 Ga0496125_0124954 3300048928 Bacteria 1825
187 Ga0496125_0130759 3300048928 Bacteria 1768
188 Ga0496126_0000156 3300048929 Bacteria 158537
189 Ga0496126_0170342 3300048929 Bacteria 1855
190 Ga0496126_0203838 3300048929 Bacteria 1668
191 Ga0501031_0000001 3300049568 Bacteria 219461
192 Ga0501031_0011627 3300049568 Bacteria 5742
193 Ga0501031_0096366 3300049568 Bacteria 1931
194 Ga0501032_0000003 3300049569 Bacteria 317700
195 Ga0501032_0000119 3300049569 Bacteria 65020
196 Ga0501032_0006944 3300049569 Bacteria 8297
197 Ga0501032_0025563 3300049569 Bacteria 4069
198 Ga0501032_0050092 3300049569 Bacteria 2816
199 Ga0501032_0254795 3300049569 Bacteria 1139
200 Ga0501033_0000150 3300049570 Bacteria 67069
201 Ga0501033_0000296 3300049570 Bacteria 47834
202 Ga0501033_0000426 3300049570 Bacteria 40278
203 Ga0501033_0013116 3300049570 Bacteria 6315
204 Ga0501033_0014062 3300049570 Bacteria 6087
205 Ga0501033_0044067 3300049570 Bacteria 3321
206 Ga0501034_0000005 3300049571 Bacteria 367512
207 Ga0501034_0001333 3300049571 Bacteria 33330
208 Ga0501034_0004261 3300049571 Bacteria 15956
209 Ga0501034_0008254 3300049571 Bacteria 11023
210 Ga0501034_0030790 3300049571 Bacteria 5453
211 Ga0501034_0043004 3300049571 Bacteria 4573
212 Ga0501034_0192351 3300049571 Bacteria 2002
213 Ga0501034_0272630 3300049571 Bacteria 1633
214 Ga0501034_0301449 3300049571 Bacteria 1539
215 Ga0501034_0480812 3300049571 Bacteria 1157
216 Ga0501036_0000018 3300049572 Bacteria 121185
217 Ga0501036_0004059 3300049572 Bacteria 11774
218 Ga0501036_0138737 3300049572 Bacteria 2052
219 Ga0501036_0195033 3300049572 Bacteria 1704
220 Ga0501036_0222151 3300049572 Bacteria 1586
221 Ga0501037_0000005 3300049573 Bacteria 219461
222 Ga0501037_0000077 3300049573 Bacteria 91081
223 Ga0501037_0003050 3300049573 Bacteria 12158
224 Ga0501038_0000001 3300049574 Bacteria 375481
225 Ga0501038_0000046 3300049574 Bacteria 106465
226 Ga0501038_0134499 3300049574 Bacteria 2027
227 Ga0501039_0000015 3300049575 Bacteria 219470
228 Ga0501039_0000298 3300049575 Bacteria 35255
229 Ga0501039_0043342 3300049575 Bacteria 3476
230 Ga0501040_0004884 3300049576 Bacteria 8676
231 Ga0501040_0093454 3300049576 Bacteria 2092
232 Ga0501042_0082550 3300049578 Bacteria 2304
233 Ga0501043_0000104 3300049579 Bacteria 78808
234 Ga0501043_0000315 3300049579 Bacteria 43857
235 Ga0501043_0000735 3300049579 Bacteria 29015
236 Ga0501043_0082486 3300049579 Bacteria 2527
237 Ga0501043_0200601 3300049579 Bacteria 1548
238 Ga0501043_0314902 3300049579 Bacteria 1194
239 Ga0501043_0414713 3300049579 Bacteria 1016
240 Ga0501046_0033522 3300049580 Bacteria 4148
241 Ga0501046_0056692 3300049580 Bacteria 3074
242 Ga0501047_0000941 3300049581 Bacteria 29463
243 Ga0501047_0049088 3300049581 Bacteria 4075
244 Ga0501047_0050194 3300049581 Bacteria 4029
245 Ga0501047_0056297 3300049581 Bacteria 3802
246 Ga0501047_0097123 3300049581 Bacteria 2824
247 Ga0501047_0105327 3300049581 Bacteria 2701
248 Ga0501047_0142117 3300049581 Bacteria 2278
249 Ga0501047_0295334 3300049581 Bacteria 1464
250 Ga0501048_0212788 3300049582 Bacteria 1371
251 Ga0501067_0061970 3300049583 Bacteria 2071
252 Ga0501068_0012912 3300049584 Bacteria 4746
253 Ga0501069_0000016 3300049585 Bacteria 142565
254 Ga0501070_0000048 3300049586 Bacteria 105951
255 Ga0501070_0000812 3300049586 Bacteria 28368
256 Ga0501070_0012428 3300049586 Bacteria 7181
257 Ga0501070_0031557 3300049586 Bacteria 4438
258 Ga0501070_0041902 3300049586 Bacteria 3812
259 Ga0501070_0086141 3300049586 Bacteria 2601
260 Ga0501073_0074751 3300049589 Bacteria 2359
261 Ga0501073_0221117 3300049589 Bacteria 1308
262 Ga0501074_0000001 3300049590 Bacteria 123588
263 Ga0501074_0303838 3300049590 Bacteria 1133
264 Ga0501080_0000270 3300049742 Bacteria 39305
265 Ga0501080_0001902 3300049742 Bacteria 17987
266 Ga0501080_0017786 3300049742 Bacteria 6579
267 Ga0501081_0221310 3300049743 Bacteria 1377
268 Ga0501081_0335701 3300049743 Bacteria 1112
269 Ga0501083_0000069 3300049744 Bacteria 68635
270 Ga0501083_0109348 3300049744 Bacteria 1818
271 Ga0501035_0000008 3300049822 Bacteria 313425
272 Ga0501035_0000048 3300049822 Bacteria 146466
273 Ga0501035_0000694 3300049822 Bacteria 36664
274 Ga0501035_0005330 3300049822 Bacteria 12166
275 Ga0501035_0022535 3300049822 Bacteria 5785
276 Ga0501035_0041338 3300049822 Bacteria 4163
277 Ga0501035_0075570 3300049822 Bacteria 2979
278 Ga0501035_0081056 3300049822 Bacteria 2864
279 Ga0501035_0109686 3300049822 Bacteria 2419
280 Ga0501044_0000001 3300049823 Bacteria 418087
281 Ga0501044_0000003 3300049823 Bacteria 345647
282 Ga0501044_0020239 3300049823 Bacteria 7102
283 Ga0501044_0023415 3300049823 Bacteria 6568
284 Ga0501044_0102479 3300049823 Bacteria 2878
285 Ga0501044_0308623 3300049823 Bacteria 1509
286 Ga0501045_0089971 3300049824 Bacteria 2268
287 Ga0501045_0124294 3300049824 Bacteria 1916
288 nmdc:mga03683_116677_c1 3300050489 Bacteria 1184
289 nmdc:mga03683_29170_c1 3300050489 Bacteria 2198
290 nmdc:mga03n38_31037_c1 3300050490 Bacteria 2252
291 nmdc:mga03n38_801_c1 3300050490 Bacteria 8368
292 nmdc:mga00v17_257197_c1 3300050491 Bacteria 1132
293 nmdc:mga00v17_530_c1 3300050491 Bacteria 21410
294 nmdc:mga00v17_7046_c1 3300050491 Bacteria 5988
295 nmdc:mga0yw44_10672_c1 3300050492 Bacteria 4703
296 nmdc:mga0yw44_207090_c1 3300050492 Bacteria 1297
297 nmdc:mga0yw44_27316_c1 3300050492 Bacteria 3268
298 nmdc:mga0yw44_283763_c1 3300050492 Bacteria 1107
299 nmdc:mga0yw44_9629_c1 3300050492 Bacteria 4900
300 nmdc:mga0k408_107889_c1 3300050493 Bacteria 1645
301 nmdc:mga06z11_170363_c1 3300050494 Bacteria 1250
302 nmdc:mga06z11_17652_c1 3300050494 Bacteria 3244
303 nmdc:mga04h51_12015_c1 3300050495 Bacteria 2420
304 nmdc:mga0sz30_150_c1 3300050516 Bacteria 25823
305 nmdc:mga0sz30_3710_c1 3300050516 Bacteria 5507
306 Ga0500610_0027936 3300053079 Bacteria 2838
307 Ga0500643_022824 3300053087 Bacteria 2008
308 Ga0500572_018131 3300053111 Bacteria 1818
309 Ga0500561_0000418 3300053137 Bacteria 6989
310 Ga0500568_0001123 3300053139 Bacteria 17968
311 Ga0500604_0075843 3300053151 Bacteria 1079
312 Ga0500616_0009072 3300053153 Bacteria 6086
313 Ga0500616_0032376 3300053153 Bacteria 2859
314 Ga0500620_000138 3300053155 Bacteria 14680
315 Ga0500620_121084 3300053155 Bacteria 917
316 Ga0500624_003228 3300053157 Bacteria 2146
317 Ga0500636_0000004 3300053177 Bacteria 202392
318 Ga0500636_0008398 3300053177 Bacteria 5989
319 Ga0500611_073929 3300053727 Bacteria 836
320 Ga0500609_012972 3300053731 Bacteria 1128
321 Ga0587088_002861 3300059508 Bacteria 2025
322 Ga0587106_008143 3300059605 Bacteria 1295
323 Ga0587068_041347 3300059641 Bacteria 835
324 Ga0587105_003309 3300059651 Bacteria 974

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053177 Ga0500636_0008398 Ga0500636_0008398_5347_5964 204
2 iso_pu_bacteria 2869169390 2869169607 222
3 iso_pu_bacteria 2922130491 2922130764 235
4 3300047320 Ga0495672_0125404 Ga0495672_0125404_11_721 236
5 iso_pu_bacteria 2894817345 2894819553 239
6 3300050491 nmdc:mga00v17_257197_c1 nmdc:mga00v17_257197_c1_51_833 240
7 3300005548 Ga0070665_100073810 Ga0070665_1000738103 241
8 3300028379 Ga0268266_10022089 Ga0268266_100220893 241
9 3300037312 Ga0395899_0000059 Ga0395899_0000059_192842_193606 241
10 3300037418 Ga0395900_0000017 Ga0395900_0000017_192842_193606 241
11 3300037466 Ga0395898_0000030 Ga0395898_0000030_192817_193581 241
12 3300037471 Ga0395905_0000056 Ga0395905_0000056_15625_16389 241
13 3300038443 Ga0395901_0000015 Ga0395901_0000015_175997_176761 241
14 3300049568 Ga0501031_0011627 Ga0501031_0011627_3659_4408 241
15 3300049569 Ga0501032_0000119 Ga0501032_0000119_34792_35541 241
16 3300049570 Ga0501033_0000426 Ga0501033_0000426_10450_11199 241
17 3300049570 Ga0501033_0013116 Ga0501033_0013116_3079_3828 241
18 3300049571 Ga0501034_0001333 Ga0501034_0001333_3102_3851 241
19 3300049571 Ga0501034_0272630 Ga0501034_0272630_233_982 241
20 3300049572 Ga0501036_0004059 Ga0501036_0004059_10449_11198 241
21 3300049573 Ga0501037_0003050 Ga0501037_0003050_10824_11573 241
22 3300049574 Ga0501038_0000046 Ga0501038_0000046_6989_7738 241
23 3300049575 Ga0501039_0000298 Ga0501039_0000298_1785_2534 241
24 3300049578 Ga0501042_0082550 Ga0501042_0082550_1390_2139 241
25 3300049579 Ga0501043_0000315 Ga0501043_0000315_10387_11136 241
26 3300049580 Ga0501046_0056692 Ga0501046_0056692_552_1301 241
27 3300049581 Ga0501047_0056297 Ga0501047_0056297_2840_3589 241
28 3300049581 Ga0501047_0105327 Ga0501047_0105327_1400_2149 241
29 3300049586 Ga0501070_0000812 Ga0501070_0000812_22021_22770 241
30 3300049742 Ga0501080_0001902 Ga0501080_0001902_7695_8444 241
31 3300049822 Ga0501035_0000694 Ga0501035_0000694_25567_26316 241
32 3300049822 Ga0501035_0005330 Ga0501035_0005330_5129_5878 241
33 3300049823 Ga0501044_0020239 Ga0501044_0020239_5255_6004 241
34 3300049823 Ga0501044_0102479 Ga0501044_0102479_1961_2710 241
35 iso_pu_bacteria 8004300914 8004303800 242
36 iso_pu_bacteria 2513237305 2514419124 243
37 iso_pu_bacteria 2516143018 2516208830 243
38 iso_pu_bacteria 2523231067 2523467261 243
39 iso_pu_bacteria 2537561587 2537874446 243
40 iso_pu_bacteria 2554235003 2554247056 243
41 iso_pu_bacteria 2558860242 2559294281 243
42 iso_pu_bacteria 2599185156 2599333851 243
43 iso_pu_bacteria 2599185210 2599602654 243
44 iso_pu_bacteria 2600254933 2600375213 243
45 iso_pu_bacteria 2600255279 2601608732 243
46 iso_pu_bacteria 2600255308 2601745506 243
47 iso_pu_bacteria 2643221557 2643807259 243
48 iso_pu_bacteria 2643221568 2643855922 243
49 iso_pu_bacteria 2643221582 2643918656 243
50 iso_pu_bacteria 2643221668 2644380641 243
51 iso_pu_bacteria 2643221693 2644518801 243
52 iso_pu_bacteria 2690316117 2692316876 243
53 iso_pu_bacteria 2738543031 2739347771 243
54 iso_pu_bacteria 2791355091 2792622735 243
55 iso_pu_bacteria 2791355092 2792628345 243
56 iso_pu_bacteria 2791355253 2793282252 243
57 iso_pu_bacteria 2808606387 2808985944 243
58 iso_pu_bacteria 2818991439 2819556064 243
59 iso_pu_bacteria 2837651117 2837653386 243
60 iso_pu_bacteria 2838675328 2838676790 243
61 iso_pu_bacteria 2838714209 2838715674 243
62 iso_pu_bacteria 2838719591 2838720526 243
63 iso_pu_bacteria 2838724970 2838726430 243
64 iso_pu_bacteria 2841734538 2841741197 243
65 iso_pu_bacteria 2841846520 2841847460 243
66 iso_pu_bacteria 2841859092 2841860004 243
67 iso_pu_bacteria 2842124991 2842126510 243
68 iso_pu_bacteria 2842130223 2842131683 243
69 iso_pu_bacteria 2842152218 2842153148 243
70 iso_pu_bacteria 2842170452 2842171917 243
71 iso_pu_bacteria 2842175837 2842176767 243
72 iso_pu_bacteria 2842187318 2842188782 243
73 iso_pu_bacteria 2842211629 2842213093 243
74 iso_pu_bacteria 2842224351 2842225288 243
75 iso_pu_bacteria 2842515876 2842516789 243
76 iso_pu_bacteria 2842922631 2842924711 243
77 iso_pu_bacteria 2847417321 2847418057 243
78 iso_pu_bacteria 2848992105 2848993032 243
79 iso_pu_bacteria 2855872281 2855879170 243
80 iso_pu_bacteria 2856342000 2856345527 243
81 iso_pu_bacteria 2856349417 2856352574 243
82 iso_pu_bacteria 2869162929 2869168296 243
83 iso_pu_bacteria 2871488783 2871494016 243
84 iso_pu_bacteria 2874123672 2874127646 243
85 iso_pu_bacteria 2874139085 2874140656 243
86 iso_pu_bacteria 2876363079 2876366697 243
87 iso_pu_bacteria 2878753008 2878756592 243
88 iso_pu_bacteria 2878774303 2878775409 243
89 iso_pu_bacteria 2881155292 2881157535 243
90 iso_pu_bacteria 2882912400 2882918842 243
91 iso_pu_bacteria 2885312484 2885316323 243
92 iso_pu_bacteria 2885318864 2885321973 243
93 iso_pu_bacteria 2885350715 2885353816 243
94 iso_pu_bacteria 2888343758 2888348554 243
95 iso_pu_bacteria 2889790730 2889795298 243
96 iso_pu_bacteria 2899792073 2899794964 243
97 iso_pu_bacteria 2899845264 2899847189 243
98 iso_pu_bacteria 2903448605 2903452873 243
99 iso_pu_bacteria 2903521522 2903524564 243
100 iso_pu_bacteria 2903528002 2903531193 243
101 iso_pu_bacteria 2919114240 2919115877 243
102 iso_pu_bacteria 2919166419 2919167312 243
103 iso_pu_bacteria 2924754689 2924757803 243
104 iso_pu_bacteria 2926754445 2926756817 243
105 iso_pu_bacteria 2926760298 2926761056 243
106 iso_pu_bacteria 2933006813 2933007791 243
107 iso_pu_bacteria 2933011516 2933012569 243
108 iso_pu_bacteria 2933594066 2933595011 243
109 iso_pu_bacteria 2978969890 2978973745 243
110 iso_pu_bacteria 2979089926 2979093665 243
111 iso_pu_bacteria 2979095461 2979098951 243
112 iso_pu_bacteria 2979100975 2979105643 243
113 iso_pu_bacteria 2984509177 2984512511 243
114 iso_pu_bacteria 2984518228 2984521128 243
115 iso_pu_bacteria 2984537506 2984540422 243
116 iso_pu_bacteria 2984587000 2984592016 243
117 iso_pu_bacteria 2984601300 2984602619 243
118 iso_pu_bacteria 643692032 643825034 243
119 iso_pu_bacteria 650716007 650739478 243
120 iso_pu_bacteria 8003570095 8003570521 243
121 iso_pu_bacteria 8054460903 8054461846 243
122 iso_pu_bacteria 2511231027 2511392709 244
123 iso_pu_bacteria 2643221623 2644132839 244
124 iso_pu_bacteria 2738543024 2739306536 244
125 iso_pu_bacteria 2775506902 2776271999 244
126 iso_pu_bacteria 2839993093 2839995945 244
127 iso_pu_bacteria 2840764183 2840769620 244
128 iso_pu_bacteria 2842871566 2842874574 244
129 iso_pu_bacteria 2894652903 2894654932 244
130 iso_pu_bacteria 2904578770 2904581317 244
131 iso_pu_bacteria 2919119836 2919122556 244
132 iso_pu_bacteria 2928521798 2928524731 244
133 iso_pu_bacteria 2937843397 2937846736 244
134 iso_pu_bacteria 8002285264 8002287887 244
135 3300049569 Ga0501032_0254795 Ga0501032_0254795_317_1069 245
136 3300049572 Ga0501036_0222151 Ga0501036_0222151_354_1106 245
137 3300049579 Ga0501043_0414713 Ga0501043_0414713_204_956 245
138 3300049581 Ga0501047_0142117 Ga0501047_0142117_1291_2043 245
139 3300049586 Ga0501070_0086141 Ga0501070_0086141_1414_2166 245
140 iso_pu_bacteria 2503198000 2503203379 245
141 iso_pu_bacteria 2508501123 2509116138 245
142 iso_pu_bacteria 2508501127 2509141538 245
143 iso_pu_bacteria 2509276018 2509370105 245
144 iso_pu_bacteria 2509276022 2509397805 245
145 iso_pu_bacteria 2510065059 2510319063 245
146 iso_pu_bacteria 2512875016 2512929740 245
147 iso_pu_bacteria 2512875024 2512964510 245
148 iso_pu_bacteria 2513237090 2513608381 245
149 iso_pu_bacteria 2513237164 2514033378 245
150 iso_pu_bacteria 2513237351 2514588240 245
151 iso_pu_bacteria 2597489875 2597815078 245
152 iso_pu_bacteria 2599185301 2599940335 245
153 iso_pu_bacteria 2643221550 2643770217 245
154 iso_pu_bacteria 2643221551 2643774880 245
155 iso_pu_bacteria 2643221555 2643793324 245
156 iso_pu_bacteria 2643221564 2643838717 245
157 iso_pu_bacteria 2643221595 2643985414 245
158 iso_pu_bacteria 2643221627 2644152110 245
159 iso_pu_bacteria 2687453392 2688600211 245
160 iso_pu_bacteria 2693429783 2694633783 245
161 iso_pu_bacteria 2693429784 2694639877 245
162 iso_pu_bacteria 2721755686 2723577488 245
163 iso_pu_bacteria 2756170246 2756673228 245
164 iso_pu_bacteria 2791355123 2792749196 245
165 iso_pu_bacteria 2844009547 2844015528 245
166 iso_pu_bacteria 2847670302 2847671899 245
167 iso_pu_bacteria 2847686936 2847688127 245
168 iso_pu_bacteria 2856314179 2856318371 245
169 iso_pu_bacteria 2856320880 2856324323 245
170 iso_pu_bacteria 2856328259 2856328514 245
171 iso_pu_bacteria 2856334872 2856339199 245
172 iso_pu_bacteria 2856364286 2856364725 245
173 iso_pu_bacteria 2857349434 2857355000 245
174 iso_pu_bacteria 2857367948 2857375067 245
175 iso_pu_bacteria 2869234852 2869241833 245
176 iso_pu_bacteria 2869242130 2869242294 245
177 iso_pu_bacteria 2869249662 2869250651 245
178 iso_pu_bacteria 2869256925 2869257556 245
179 iso_pu_bacteria 2869264136 2869264692 245
180 iso_pu_bacteria 2869271264 2869277657 245
181 iso_pu_bacteria 2869278585 2869281679 245
182 iso_pu_bacteria 2869285874 2869289826 245
183 iso_pu_bacteria 2871429161 2871431947 245
184 iso_pu_bacteria 2871444079 2871451306 245
185 iso_pu_bacteria 2871451962 2871455674 245
186 iso_pu_bacteria 2871459585 2871460760 245
187 iso_pu_bacteria 2871481445 2871488563 245
188 iso_pu_bacteria 2871495908 2871500216 245
189 iso_pu_bacteria 2874102143 2874103320 245
190 iso_pu_bacteria 2874116593 2874118937 245
191 iso_pu_bacteria 2874131515 2874138344 245
192 iso_pu_bacteria 2874146452 2874155570 245
193 iso_pu_bacteria 2874155637 2874162427 245
194 iso_pu_bacteria 2874162495 2874165740 245
195 iso_pu_bacteria 2874168670 2874175369 245
196 iso_pu_bacteria 2876369609 2876376537 245
197 iso_pu_bacteria 2876377896 2876383844 245
198 iso_pu_bacteria 2876386047 2876390664 245
199 iso_pu_bacteria 2876392853 2876399384 245
200 iso_pu_bacteria 2876399893 2876400506 245
201 iso_pu_bacteria 2876406927 2876413288 245
202 iso_pu_bacteria 2876413966 2876420915 245
203 iso_pu_bacteria 2876420981 2876427214 245
204 iso_pu_bacteria 2878035449 2878037707 245
205 iso_pu_bacteria 2878738818 2878742438 245
206 iso_pu_bacteria 2878745973 2878748553 245
207 iso_pu_bacteria 2878760144 2878764327 245
208 iso_pu_bacteria 2878767105 2878771408 245
209 iso_pu_bacteria 2878781027 2878787327 245
210 iso_pu_bacteria 2881147464 2881153748 245
211 iso_pu_bacteria 2881161766 2881162897 245
212 iso_pu_bacteria 2881845957 2881847136 245
213 iso_pu_bacteria 2881853255 2881859879 245
214 iso_pu_bacteria 2881861095 2881861996 245
215 iso_pu_bacteria 2882632389 2882634463 245
216 iso_pu_bacteria 2885305155 2885311681 245
217 iso_pu_bacteria 2885326080 2885327386 245
218 iso_pu_bacteria 2885334103 2885337198 245
219 iso_pu_bacteria 2885342637 2885349841 245
220 iso_pu_bacteria 2888337043 2888341394 245
221 iso_pu_bacteria 2888350351 2888350721 245
222 iso_pu_bacteria 2889010040 2889013061 245
223 iso_pu_bacteria 2889016732 2889022078 245
224 iso_pu_bacteria 2889914905 2889916833 245
225 iso_pu_bacteria 2903492973 2903502480 245
226 iso_pu_bacteria 2903492973 2903506175 245
227 iso_pu_bacteria 2903540706 2903545029 245
228 iso_pu_bacteria 2904659560 2904665911 245
229 iso_pu_bacteria 2906308376 2906312115 245
230 iso_pu_bacteria 2906321335 2906323853 245
231 iso_pu_bacteria 2906328253 2906331294 245
232 iso_pu_bacteria 2906401398 2906402644 245
233 iso_pu_bacteria 2906414383 2906418408 245
234 iso_pu_bacteria 2906427513 2906428026 245
235 iso_pu_bacteria 2922151315 2922157795 245
236 iso_pu_bacteria 2922158528 2922161589 245
237 iso_pu_bacteria 2922172374 2922172431 245
238 iso_pu_bacteria 2922178524 2922185149 245
239 iso_pu_bacteria 2924710171 2924711063 245
240 iso_pu_bacteria 2924726620 2924726733 245
241 iso_pu_bacteria 2924733363 2924735472 245
242 iso_pu_bacteria 2924741084 2924742887 245
243 iso_pu_bacteria 2924748358 2924751584 245
244 iso_pu_bacteria 2924762789 2924764549 245
245 iso_pu_bacteria 2924776078 2924780238 245
246 iso_pu_bacteria 2924784321 2924788178 245
247 iso_pu_bacteria 2937813078 2937818061 245
248 iso_pu_bacteria 2937822353 2937829194 245
249 iso_pu_bacteria 2937836603 2937840755 245
250 iso_pu_bacteria 2937848649 2937850778 245
251 iso_pu_bacteria 2937868953 2937876636 245
252 iso_pu_bacteria 2937877337 2937882758 245
253 iso_pu_bacteria 2937891427 2937894591 245
254 iso_pu_bacteria 2937994558 2937998876 245
255 iso_pu_bacteria 2958034702 2958037640 245
256 iso_pu_bacteria 2958041894 2958047351 245
257 iso_pu_bacteria 2958041894 2958056600 245
258 iso_pu_bacteria 2958064165 2958066014 245
259 iso_pu_bacteria 2958071322 2958075108 245
260 iso_pu_bacteria 2958084443 2958089883 245
261 iso_pu_bacteria 2958092219 2958098605 245
262 iso_pu_bacteria 2958100919 2958107881 245
263 iso_pu_bacteria 2958115193 2958116909 245
264 iso_pu_bacteria 2958122699 2958123747 245
265 iso_pu_bacteria 2958130278 2958134198 245
266 iso_pu_bacteria 2958144490 2958149399 245
267 iso_pu_bacteria 2958158011 2958163821 245
268 iso_pu_bacteria 2958165035 2958169351 245
269 iso_pu_bacteria 2958172287 2958174756 245
270 iso_pu_bacteria 2958179912 2958183844 245
271 iso_pu_bacteria 2961077736 2961081810 245
272 iso_pu_bacteria 2961114664 2961121255 245
273 iso_pu_bacteria 2961127735 2961133628 245
274 iso_pu_bacteria 2961163497 2961167812 245
275 iso_pu_bacteria 2961170736 2961172882 245
276 iso_pu_bacteria 2963644680 2963649491 245
277 iso_pu_bacteria 2965018300 2965022631 245
278 iso_pu_bacteria 2965025482 2965026135 245
279 iso_pu_bacteria 2965040258 2965042620 245
280 iso_pu_bacteria 2965047637 2965053499 245
281 iso_pu_bacteria 2965062239 2965069925 245
282 iso_pu_bacteria 2965089291 2965091619 245
283 iso_pu_bacteria 2967996073 2967998092 245
284 iso_pu_bacteria 2968003550 2968008744 245
285 iso_pu_bacteria 2968016561 2968019525 245
286 iso_pu_bacteria 2968083720 2968084654 245
287 iso_pu_bacteria 2968091066 2968092335 245
288 iso_pu_bacteria 2968097103 2968097617 245
289 iso_pu_bacteria 2968110612 2968117407 245
290 iso_pu_bacteria 2968117919 2968118413 245
291 iso_pu_bacteria 2968128360 2968131746 245
292 iso_pu_bacteria 2968138860 2968142192 245
293 iso_pu_bacteria 2968171901 2968176212 245
294 iso_pu_bacteria 2970469710 2970472846 245
295 iso_pu_bacteria 2970489779 2970494861 245
296 iso_pu_bacteria 2970503327 2970505476 245
297 iso_pu_bacteria 2970510686 2970518086 245
298 iso_pu_bacteria 2970524798 2970529636 245
299 iso_pu_bacteria 2970532167 2970537647 245
300 iso_pu_bacteria 2970540015 2970543006 245
301 iso_pu_bacteria 2970547951 2970547959 245
302 iso_pu_bacteria 2970554993 2970559171 245
303 iso_pu_bacteria 2970593180 2970596282 245
304 iso_pu_bacteria 2970619444 2970625804 245
305 iso_pu_bacteria 2970627176 2970632999 245
306 iso_pu_bacteria 2977821940 2977825772 245
307 iso_pu_bacteria 2977828996 2977833533 245
308 iso_pu_bacteria 2977843712 2977851159 245
309 iso_pu_bacteria 2977851361 2977852968 245
310 iso_pu_bacteria 2977858184 2977862137 245
311 iso_pu_bacteria 2977864932 2977869479 245
312 iso_pu_bacteria 2977872689 2977872821 245
313 iso_pu_bacteria 2977907340 2977909890 245
314 iso_pu_bacteria 2977915119 2977919061 245
315 iso_pu_bacteria 2977922695 2977926307 245
316 iso_pu_bacteria 2977942078 2977943940 245
317 iso_pu_bacteria 2977950692 2977955095 245
318 iso_pu_bacteria 2977957713 2977964348 245
319 iso_pu_bacteria 2977971508 2977971945 245
320 iso_pu_bacteria 2977986579 2977990977 245
321 iso_pu_bacteria 2979710463 2979714010 245
322 iso_pu_bacteria 2979742915 2979744585 245
323 iso_pu_bacteria 2979764755 2979764988 245
324 iso_pu_bacteria 2979772303 2979772312 245
325 iso_pu_bacteria 2979779861 2979781221 245
326 iso_pu_bacteria 2979793036 2979795721 245
327 iso_pu_bacteria 2979808191 2979810197 245
328 iso_pu_bacteria 2987636660 2987643601 245
329 iso_pu_bacteria 2987645492 2987650012 245
330 iso_pu_bacteria 2987652177 2987659213 245
331 iso_pu_bacteria 2987659509 2987663821 245
332 iso_pu_bacteria 2987666974 2987667353 245
333 iso_pu_bacteria 2987673487 2987676777 245
334 iso_pu_bacteria 2996310559 2996313258 245
335 iso_pu_bacteria 2996336353 2996340279 245
336 iso_pu_bacteria 2996341866 2996343155 245
337 iso_pu_bacteria 2996348954 2996352035 245
338 iso_pu_bacteria 2996386984 2996392083 245
339 iso_pu_bacteria 3000135777 3000141933 245
340 iso_pu_bacteria 3004167301 3004170988 245
341 iso_pu_bacteria 3004188549 3004192877 245
342 iso_pu_bacteria 3004195979 3004203807 245
343 iso_pu_bacteria 3004203850 3004207146 245
344 iso_pu_bacteria 3004211236 3004214567 245
345 iso_pu_bacteria 3004218560 3004219249 245
346 iso_pu_bacteria 3004232784 3004238807 245
347 iso_pu_bacteria 3004239961 3004246656 245
348 iso_pu_bacteria 3004268573 3004273477 245
349 iso_pu_bacteria 3004275668 3004278733 245
350 iso_pu_bacteria 3004289098 3004295519 245
351 iso_pu_bacteria 3004334049 3004339319 245
352 iso_pu_bacteria 637000159 637079484 245
353 iso_pu_bacteria 649633066 649874686 245
354 iso_pu_bacteria 8004361976 8004364312 245
355 iso_pu_bacteria 8004374579 8004378180 245
356 iso_pu_bacteria 8004387939 8004391703 245
357 iso_pu_bacteria 8004395343 8004396966 245
358 iso_pu_bacteria 8004445564 8004451862 245
359 iso_pu_bacteria 8004640170 8004641277 245
360 iso_pu_bacteria 8004695233 8004695839 245
361 iso_pu_bacteria 8004703790 8004710791 245
362 iso_pu_bacteria 8004714634 8004717072 245
363 iso_pu_bacteria 8004727605 8004731483 245
364 iso_pu_bacteria 8055617313 8055622776 245
365 3300049743 Ga0501081_0221310 Ga0501081_0221310_509_1330 246
366 iso_pu_bacteria 2534681786 2535484410 246
367 iso_pu_bacteria 2751185800 2753358976 246
368 iso_pu_bacteria 2758568016 2758641211 246
369 iso_pu_bacteria 2854911287 2854914492 246
370 iso_pu_bacteria 2915650412 2915651480 246
371 3300003856 Ga0058692_1001670 Ga0058692_10016707 247
372 3300003856 Ga0058692_1002906 Ga0058692_10029064 247
373 3300006042 Ga0075368_10007335 Ga0075368_100073353 247
374 3300006048 Ga0075363_100076185 Ga0075363_1000761853 247
375 3300006051 Ga0075364_10000626 Ga0075364_100006268 247
376 3300006051 Ga0075364_10078825 Ga0075364_100788253 247
377 3300006177 Ga0075362_10018882 Ga0075362_100188823 247
378 3300006178 Ga0075367_10020251 Ga0075367_100202514 247
379 3300006186 Ga0075369_10039311 Ga0075369_100393112 247
380 3300006186 Ga0075369_10058278 Ga0075369_100582782 247
381 3300006195 Ga0075366_10007799 Ga0075366_100077996 247
382 3300006353 Ga0075370_10126902 Ga0075370_101269022 247
383 3300006948 Ga0099826_10000859 Ga0099826_1000085912 247
384 3300009148 Ga0105243_10054588 Ga0105243_100545883 247
385 3300013100 Ga0157373_10003685 Ga0157373_1000368510 247
386 3300013102 Ga0157371_10000380 Ga0157371_1000038046 247
387 3300013102 Ga0157371_10030075 Ga0157371_100300752 247
388 3300013104 Ga0157370_10000748 Ga0157370_1000074831 247
389 3300013105 Ga0157369_10160761 Ga0157369_101607613 247
390 3300013307 Ga0157372_10245231 Ga0157372_102452312 247
391 3300025294 Ga0209025_1000074 Ga0209025_1000074199 247
392 3300025294 Ga0209025_1000080 Ga0209025_100008094 247
393 3300025935 Ga0207709_10031697 Ga0207709_100316973 247
394 3300025981 Ga0207640_10171338 Ga0207640_101713382 247
395 3300027312 Ga0209371_1000021 Ga0209371_1000021538 247
396 3300027312 Ga0209371_1003040 Ga0209371_10030405 247
397 3300027666 Ga0209282_1000483 Ga0209282_100048310 247
398 3300027866 Ga0209813_10005510 Ga0209813_100055102 247
399 3300030500 Ga0268256_1000020 Ga0268256_1000020544 247
400 3300030500 Ga0268256_1006707 Ga0268256_10067075 247
401 3300030744 Ga0316181_1167977 Ga0316181_11679772 247
402 3300046530 Ga0495654_0000198 Ga0495654_0000198_52918_53667 247
403 3300046674 Ga0495588_0023685 Ga0495588_0023685_846_1592 247
404 3300046692 Ga0495671_0010893 Ga0495671_0010893_963_1709 247
405 3300048913 Ga0496110_0520804 Ga0496110_0520804_31_777 247
406 3300048916 Ga0496113_0014660 Ga0496113_0014660_4075_4821 247
407 3300048919 Ga0496116_0000036 Ga0496116_0000036_222726_223472 247
408 3300048919 Ga0496116_0030524 Ga0496116_0030524_1054_1800 247
409 3300048920 Ga0496117_0000002 Ga0496117_0000002_1545203_1545949 247
410 3300048920 Ga0496117_0121961 Ga0496117_0121961_240_986 247
411 3300048921 Ga0496118_0000214 Ga0496118_0000214_3041_3787 247
412 3300048922 Ga0496119_0025883 Ga0496119_0025883_3008_3754 247
413 3300048923 Ga0496120_0000125 Ga0496120_0000125_113850_114596 247
414 3300048925 Ga0496122_0000001 Ga0496122_0000001_915992_916738 247
415 3300048925 Ga0496122_0014863 Ga0496122_0014863_4893_5639 247
416 3300048925 Ga0496122_0071209 Ga0496122_0071209_1087_1833 247
417 3300048926 Ga0496123_0000001 Ga0496123_0000001_919723_920469 247
418 3300048926 Ga0496123_0071533 Ga0496123_0071533_558_1304 247
419 3300048927 Ga0496124_0004429 Ga0496124_0004429_3478_4224 247
420 3300048927 Ga0496124_0417945 Ga0496124_0417945_51_797 247
421 3300048928 Ga0496125_0051318 Ga0496125_0051318_1615_2361 247
422 3300048928 Ga0496125_0124954 Ga0496125_0124954_317_1063 247
423 3300048929 Ga0496126_0000156 Ga0496126_0000156_150768_151514 247
424 3300048929 Ga0496126_0203838 Ga0496126_0203838_358_1104 247
425 3300049571 Ga0501034_0004261 Ga0501034_0004261_5553_6317 247
426 3300050490 nmdc:mga03n38_801_c1 nmdc:mga03n38_801_c1_6755_7501 247
427 3300050491 nmdc:mga00v17_530_c1 nmdc:mga00v17_530_c1_18236_18985 247
428 3300050491 nmdc:mga00v17_7046_c1 nmdc:mga00v17_7046_c1_763_1509 247
429 3300050492 nmdc:mga0yw44_9629_c1 nmdc:mga0yw44_9629_c1_1716_2462 247
430 3300050493 nmdc:mga0k408_107889_c1 nmdc:mga0k408_107889_c1_359_1105 247
431 3300050494 nmdc:mga06z11_17652_c1 nmdc:mga06z11_17652_c1_541_1287 247
432 3300050495 nmdc:mga04h51_12015_c1 nmdc:mga04h51_12015_c1_541_1287 247
433 3300050516 nmdc:mga0sz30_150_c1 nmdc:mga0sz30_150_c1_15406_16152 247
434 3300053111 Ga0500572_018131 Ga0500572_018131_827_1576 247
435 3300053137 Ga0500561_0000418 Ga0500561_0000418_5280_6026 247
436 3300053157 Ga0500624_003228 Ga0500624_003228_35_781 247
437 3300053177 Ga0500636_0000004 Ga0500636_0000004_40264_41010 247
438 3300059508 Ga0587088_002861 Ga0587088_002861_32_778 247
439 iso_pu_bacteria 2775506904 2776279482 247
440 iso_pu_bacteria 2954011201 2954015076 247
441 iso_pu_bacteria 3002141150 3002143276 247
442 3300028381 Ga0268264_10473565 Ga0268264_104735652 248
443 3300049571 Ga0501034_0030790 Ga0501034_0030790_2917_3663 248
444 3300049575 Ga0501039_0043342 Ga0501039_0043342_616_1362 248
445 3300049589 Ga0501073_0074751 Ga0501073_0074751_1205_1969 248
446 3300049743 Ga0501081_0335701 Ga0501081_0335701_322_1086 248
447 3300053087 Ga0500643_022824 Ga0500643_022824_205_951 248
448 3300001979 JGI24740J21852_10024397 JGI24740J21852_100243972 249
449 3300001989 JGI24739J22299_10007696 JGI24739J22299_100076962 249
450 3300001989 JGI24739J22299_10056678 JGI24739J22299_100566782 249
451 3300002067 JGI24735J21928_10006906 JGI24735J21928_100069062 249
452 3300002705 JGI25156J39149_1007302 JGI25156J39149_10073024 249
453 3300002741 JGI25157J39369_1001413 JGI25157J39369_10014135 249
454 3300003214 JGI25165J46597_1000028 JGI25165J46597_1000028315 249
455 3300003762 Ga0055542_1001586 Ga0055542_100158610 249
456 3300003762 Ga0055542_1001800 Ga0055542_10018003 249
457 3300003763 Ga0055529_1006399 Ga0055529_10063992 249
458 3300003775 Ga0055524_1001301 Ga0055524_100130110 249
459 3300005336 Ga0070680_100500933 Ga0070680_1005009331 249
460 3300005339 Ga0070660_100160827 Ga0070660_1001608272 249
461 3300005356 Ga0070674_100117929 Ga0070674_1001179292 249
462 3300005366 Ga0070659_100123624 Ga0070659_1001236243 249
463 3300005455 Ga0070663_100080493 Ga0070663_1000804932 249
464 3300005459 Ga0068867_100703974 Ga0068867_1007039741 249
465 3300005539 Ga0068853_100111880 Ga0068853_1001118803 249
466 3300005548 Ga0070665_100025048 Ga0070665_1000250484 249
467 3300005563 Ga0068855_100422595 Ga0068855_1004225952 249
468 3300005563 Ga0068855_100567794 Ga0068855_1005677942 249
469 3300005614 Ga0068856_100118758 Ga0068856_1001187582 249
470 3300005616 Ga0068852_100104729 Ga0068852_1001047293 249
471 3300005937 Ga0081455_10057792 Ga0081455_100577924 249
472 3300005983 Ga0081540_1007848 Ga0081540_10078487 249
473 3300005985 Ga0081539_10008531 Ga0081539_100085314 249
474 3300006038 Ga0075365_10001916 Ga0075365_1000191610 249
475 3300006038 Ga0075365_10036833 Ga0075365_100368333 249
476 3300006038 Ga0075365_10077682 Ga0075365_100776823 249
477 3300006042 Ga0075368_10034699 Ga0075368_100346993 249
478 3300006048 Ga0075363_100066015 Ga0075363_1000660153 249
479 3300006051 Ga0075364_10019200 Ga0075364_100192002 249
480 3300006177 Ga0075362_10081216 Ga0075362_100812162 249
481 3300006178 Ga0075367_10025683 Ga0075367_100256832 249
482 3300006186 Ga0075369_10008812 Ga0075369_100088123 249
483 3300006353 Ga0075370_10322935 Ga0075370_103229351 249
484 3300006844 Ga0075428_100349449 Ga0075428_1003494492 249
485 3300009093 Ga0105240_10426516 Ga0105240_104265161 249
486 3300009098 Ga0105245_10185233 Ga0105245_101852332 249
487 3300009098 Ga0105245_10635334 Ga0105245_106353341 249
488 3300009174 Ga0105241_10152799 Ga0105241_101527992 249
489 3300009545 Ga0105237_10041428 Ga0105237_100414283 249
490 3300009545 Ga0105237_10596786 Ga0105237_105967862 249
491 3300009551 Ga0105238_10013813 Ga0105238_100138136 249
492 3300009551 Ga0105238_10396215 Ga0105238_103962151 249
493 3300010375 Ga0105239_10038611 Ga0105239_100386116 249
494 3300011119 Ga0105246_10289255 Ga0105246_102892552 249
495 3300011119 Ga0105246_10412181 Ga0105246_104121812 249
496 3300013104 Ga0157370_10087023 Ga0157370_100870235 249
497 3300013297 Ga0157378_10103604 Ga0157378_101036041 249
498 3300013306 Ga0163162_10350234 Ga0163162_103502342 249
499 3300013307 Ga0157372_10578995 Ga0157372_105789951 249
500 3300014968 Ga0157379_10404349 Ga0157379_104043492 249
501 3300015261 Ga0182006_1028288 Ga0182006_10282883 249
502 3300021320 Ga0214544_1000008 Ga0214544_10000088 249
503 3300021321 Ga0214542_1005858 Ga0214542_10058588 249
504 3300021327 Ga0214543_1005579 Ga0214543_10055798 249
505 3300025246 Ga0209646_1011669 Ga0209646_10116692 249
506 3300025250 Ga0209026_1000215 Ga0209026_100021558 249
507 3300025254 Ga0209148_1000056 Ga0209148_1000056152 249
508 3300025256 Ga0209759_1000478 Ga0209759_100047823 249
509 3300025261 Ga0209233_1000087 Ga0209233_1000087319 249
510 3300025272 Ga0209455_1000137 Ga0209455_100013747 249
511 3300025297 Ga0209758_1008307 Ga0209758_10083079 249
512 3300025909 Ga0207705_10054760 Ga0207705_100547602 249
513 3300025911 Ga0207654_10077613 Ga0207654_100776133 249
514 3300025913 Ga0207695_10072649 Ga0207695_100726496 249
515 3300025919 Ga0207657_10159904 Ga0207657_101599043 249
516 3300025932 Ga0207690_10269734 Ga0207690_102697342 249
517 3300025937 Ga0207669_10350418 Ga0207669_103504182 249
518 3300026041 Ga0207639_10028627 Ga0207639_100286273 249
519 3300026067 Ga0207678_10052608 Ga0207678_100526082 249
520 3300026067 Ga0207678_10104408 Ga0207678_101044082 249
521 3300026067 Ga0207678_10183794 Ga0207678_101837943 249
522 3300026089 Ga0207648_10058392 Ga0207648_100583923 249
523 3300026116 Ga0207674_10124910 Ga0207674_101249104 249
524 3300026121 Ga0207683_10163516 Ga0207683_101635163 249
525 3300026142 Ga0207698_10197886 Ga0207698_101978862 249
526 3300026142 Ga0207698_10335091 Ga0207698_103350911 249
527 3300028379 Ga0268266_10010946 Ga0268266_100109468 249
528 3300028379 Ga0268266_10084145 Ga0268266_100841453 249
529 3300031548 Ga0307408_100490478 Ga0307408_1004904781 249
530 3300033180 Ga0307510_10299852 Ga0307510_102998522 249
531 3300037312 Ga0395899_0058938 Ga0395899_0058938_986_1735 249
532 3300037418 Ga0395900_0041650 Ga0395900_0041650_2367_3116 249
533 3300037418 Ga0395900_0396415 Ga0395900_0396415_161_910 249
534 3300037471 Ga0395905_0038783 Ga0395905_0038783_2472_3221 249
535 3300037471 Ga0395905_0117305 Ga0395905_0117305_1488_2237 249
536 3300037471 Ga0395905_0341531 Ga0395905_0341531_339_1088 249
537 3300038443 Ga0395901_0021337 Ga0395901_0021337_1105_1854 249
538 3300038443 Ga0395901_0073601 Ga0395901_0073601_2498_3247 249
539 3300038443 Ga0395901_0125454 Ga0395901_0125454_1574_2323 249
540 3300038443 Ga0395901_0306309 Ga0395901_0306309_546_1295 249
541 3300038443 Ga0395901_0424660 Ga0395901_0424660_280_1029 249
542 3300038443 Ga0395901_0475378 Ga0395901_0475378_380_1129 249
543 3300041404 Ga0439436_0004198 Ga0439436_0004198_1268_2050 249
544 3300041452 Ga0451793_0783434 Ga0451793_0783434_410_1159 249
545 3300041460 Ga0451802_2155873 Ga0451802_2155873_103_852 249
546 3300042005 Ga0439448_0035944 Ga0439448_0035944_82_834 249
547 3300044658 Ga0466972_0015562 Ga0466972_0015562_2106_2855 249
548 3300044901 Ga0466960_0043832 Ga0466960_0043832_524_1273 249
549 3300045976 Ga0466967_0193794 Ga0466967_0193794_1118_1867 249
550 3300046460 Ga0495638_0008182 Ga0495638_0008182_5130_5903 249
551 3300046507 Ga0495606_0167840 Ga0495606_0167840_459_1208 249
552 3300046518 Ga0495631_0127337 Ga0495631_0127337_147_896 249
553 3300046522 Ga0495643_0036263 Ga0495643_0036263_1705_2454 249
554 3300046522 Ga0495643_0120812 Ga0495643_0120812_141_971 249
555 3300046660 Ga0495625_0114672 Ga0495625_0114672_83_832 249
556 3300048905 Ga0496102_0567500 Ga0496102_0567500_40_789 249
557 3300048906 Ga0496103_0223829 Ga0496103_0223829_240_989 249
558 3300048908 Ga0496105_0142711 Ga0496105_0142711_266_1015 249
559 3300048911 Ga0496108_0319092 Ga0496108_0319092_440_1270 249
560 3300048915 Ga0496112_0124980 Ga0496112_0124980_514_1263 249
561 3300048916 Ga0496113_0439565 Ga0496113_0439565_251_1000 249
562 3300048918 Ga0496115_0238607 Ga0496115_0238607_232_1059 249
563 3300048920 Ga0496117_0077827 Ga0496117_0077827_188_937 249
564 3300048922 Ga0496119_0007236 Ga0496119_0007236_2878_3660 249
565 3300048922 Ga0496119_0027287 Ga0496119_0027287_428_1177 249
566 3300048923 Ga0496120_0000860 Ga0496120_0000860_39010_39759 249
567 3300048923 Ga0496120_0125140 Ga0496120_0125140_353_1135 249
568 3300048923 Ga0496120_0137784 Ga0496120_0137784_142_969 249
569 3300048924 Ga0496121_0389861 Ga0496121_0389861_104_886 249
570 3300048925 Ga0496122_0059237 Ga0496122_0059237_1136_1918 249
571 3300048926 Ga0496123_0012003 Ga0496123_0012003_3190_3972 249
572 3300048928 Ga0496125_0081890 Ga0496125_0081890_1544_2326 249
573 3300048928 Ga0496125_0130759 Ga0496125_0130759_976_1725 249
574 3300048929 Ga0496126_0170342 Ga0496126_0170342_352_1101 249
575 3300049568 Ga0501031_0000001 Ga0501031_0000001_80947_81711 249
576 3300049568 Ga0501031_0096366 Ga0501031_0096366_1064_1813 249
577 3300049569 Ga0501032_0000003 Ga0501032_0000003_80956_81720 249
578 3300049569 Ga0501032_0006944 Ga0501032_0006944_1546_2295 249
579 3300049569 Ga0501032_0025563 Ga0501032_0025563_919_1668 249
580 3300049569 Ga0501032_0050092 Ga0501032_0050092_591_1340 249
581 3300049570 Ga0501033_0000150 Ga0501033_0000150_26848_27612 249
582 3300049570 Ga0501033_0000296 Ga0501033_0000296_43238_43987 249
583 3300049570 Ga0501033_0014062 Ga0501033_0014062_149_898 249
584 3300049570 Ga0501033_0044067 Ga0501033_0044067_1177_1941 249
585 3300049571 Ga0501034_0000005 Ga0501034_0000005_80956_81720 249
586 3300049571 Ga0501034_0008254 Ga0501034_0008254_259_1014 249
587 3300049571 Ga0501034_0043004 Ga0501034_0043004_2840_3589 249
588 3300049571 Ga0501034_0192351 Ga0501034_0192351_121_885 249
589 3300049571 Ga0501034_0301449 Ga0501034_0301449_751_1500 249
590 3300049571 Ga0501034_0480812 Ga0501034_0480812_160_909 249
591 3300049572 Ga0501036_0000018 Ga0501036_0000018_80956_81720 249
592 3300049572 Ga0501036_0138737 Ga0501036_0138737_363_1112 249
593 3300049572 Ga0501036_0195033 Ga0501036_0195033_451_1200 249
594 3300049573 Ga0501037_0000005 Ga0501037_0000005_80947_81711 249
595 3300049573 Ga0501037_0000077 Ga0501037_0000077_17701_18450 249
596 3300049574 Ga0501038_0000001 Ga0501038_0000001_80956_81720 249
597 3300049574 Ga0501038_0134499 Ga0501038_0134499_1177_1941 249
598 3300049575 Ga0501039_0000015 Ga0501039_0000015_137751_138515 249
599 3300049576 Ga0501040_0004884 Ga0501040_0004884_6916_7680 249
600 3300049576 Ga0501040_0093454 Ga0501040_0093454_1195_1944 249
601 3300049579 Ga0501043_0000104 Ga0501043_0000104_23488_24237 249
602 3300049579 Ga0501043_0000735 Ga0501043_0000735_12173_12937 249
603 3300049579 Ga0501043_0082486 Ga0501043_0082486_42_791 249
604 3300049579 Ga0501043_0200601 Ga0501043_0200601_596_1345 249
605 3300049579 Ga0501043_0314902 Ga0501043_0314902_59_823 249
606 3300049580 Ga0501046_0033522 Ga0501046_0033522_2589_3338 249
607 3300049581 Ga0501047_0000941 Ga0501047_0000941_16803_17567 249
608 3300049581 Ga0501047_0049088 Ga0501047_0049088_2240_2989 249
609 3300049581 Ga0501047_0050194 Ga0501047_0050194_2556_3305 249
610 3300049581 Ga0501047_0097123 Ga0501047_0097123_1892_2719 249
611 3300049581 Ga0501047_0295334 Ga0501047_0295334_343_1092 249
612 3300049582 Ga0501048_0212788 Ga0501048_0212788_202_951 249
613 3300049583 Ga0501067_0061970 Ga0501067_0061970_1073_1822 249
614 3300049584 Ga0501068_0012912 Ga0501068_0012912_955_1704 249
615 3300049585 Ga0501069_0000016 Ga0501069_0000016_99420_100169 249
616 3300049586 Ga0501070_0000048 Ga0501070_0000048_67450_68199 249
617 3300049586 Ga0501070_0012428 Ga0501070_0012428_2346_3110 249
618 3300049586 Ga0501070_0031557 Ga0501070_0031557_3212_3961 249
619 3300049586 Ga0501070_0041902 Ga0501070_0041902_1265_2014 249
620 3300049589 Ga0501073_0221117 Ga0501073_0221117_257_1006 249
621 3300049590 Ga0501074_0000001 Ga0501074_0000001_2148_2897 249
622 3300049590 Ga0501074_0303838 Ga0501074_0303838_175_924 249
623 3300049742 Ga0501080_0000270 Ga0501080_0000270_11896_12645 249
624 3300049742 Ga0501080_0017786 Ga0501080_0017786_1499_2248 249
625 3300049744 Ga0501083_0000069 Ga0501083_0000069_20419_21168 249
626 3300049744 Ga0501083_0109348 Ga0501083_0109348_969_1718 249
627 3300049822 Ga0501035_0000008 Ga0501035_0000008_26835_27599 249
628 3300049822 Ga0501035_0000048 Ga0501035_0000048_79207_79956 249
629 3300049822 Ga0501035_0022535 Ga0501035_0022535_1483_2247 249
630 3300049822 Ga0501035_0041338 Ga0501035_0041338_1497_2246 249
631 3300049822 Ga0501035_0075570 Ga0501035_0075570_596_1345 249
632 3300049822 Ga0501035_0081056 Ga0501035_0081056_1207_1956 249
633 3300049822 Ga0501035_0109686 Ga0501035_0109686_386_1135 249
634 3300049823 Ga0501044_0000001 Ga0501044_0000001_336368_337132 249
635 3300049823 Ga0501044_0000003 Ga0501044_0000003_174022_174771 249
636 3300049823 Ga0501044_0023415 Ga0501044_0023415_5403_6152 249
637 3300049823 Ga0501044_0308623 Ga0501044_0308623_258_1007 249
638 3300049824 Ga0501045_0089971 Ga0501045_0089971_879_1643 249
639 3300049824 Ga0501045_0124294 Ga0501045_0124294_1124_1873 249
640 3300050489 nmdc:mga03683_116677_c1 nmdc:mga03683_116677_c1_328_1077 249
641 3300050489 nmdc:mga03683_29170_c1 nmdc:mga03683_29170_c1_512_1261 249
642 3300050490 nmdc:mga03n38_31037_c1 nmdc:mga03n38_31037_c1_1442_2191 249
643 3300050492 nmdc:mga0yw44_10672_c1 nmdc:mga0yw44_10672_c1_405_1232 249
644 3300050492 nmdc:mga0yw44_207090_c1 nmdc:mga0yw44_207090_c1_167_940 249
645 3300050492 nmdc:mga0yw44_27316_c1 nmdc:mga0yw44_27316_c1_1544_2293 249
646 3300050492 nmdc:mga0yw44_283763_c1 nmdc:mga0yw44_283763_c1_220_969 249
647 3300050494 nmdc:mga06z11_170363_c1 nmdc:mga06z11_170363_c1_74_823 249
648 3300050516 nmdc:mga0sz30_3710_c1 nmdc:mga0sz30_3710_c1_3302_4051 249
649 3300053079 Ga0500610_0027936 Ga0500610_0027936_944_1693 249
650 3300053139 Ga0500568_0001123 Ga0500568_0001123_12000_12749 249
651 3300053151 Ga0500604_0075843 Ga0500604_0075843_97_846 249
652 3300053153 Ga0500616_0009072 Ga0500616_0009072_2206_2955 249
653 3300053153 Ga0500616_0032376 Ga0500616_0032376_1302_2051 249
654 3300053155 Ga0500620_000138 Ga0500620_000138_6508_7257 249
655 3300053155 Ga0500620_121084 Ga0500620_121084_62_811 249
656 3300053727 Ga0500611_073929 Ga0500611_073929_45_794 249
657 3300053731 Ga0500609_012972 Ga0500609_012972_300_1049 249
658 3300059605 Ga0587106_008143 Ga0587106_008143_197_946 249
659 3300059641 Ga0587068_041347 Ga0587068_041347_33_782 249
660 3300059651 Ga0587105_003309 Ga0587105_003309_148_897 249
661 iso_pu_bacteria 2588253730 2588515323 249
662 iso_pu_bacteria 2657244999 2657683316 249
663 iso_pu_bacteria 2765235802 2765465148 249
664 iso_pu_bacteria 2791355094 2792638393 249
665 iso_pu_bacteria 2802429268 2804751294 249
666 iso_pu_bacteria 2844002411 2844005688 249
667 iso_pu_bacteria 2871466892 2871471131 249
668 iso_pu_bacteria 2871474448 2871478790 249
669 iso_pu_bacteria 2906370794 2906375296 249
670 iso_pu_bacteria 2913295892 2913297492 249
671 iso_pu_bacteria 2937972304 2937973268 249
672 iso_pu_bacteria 2977898635 2977901307 249
673 iso_pu_bacteria 8004633249 8004638260 249

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10502

Peptidase_S26

Signal peptidase, peptidase S26

40

247

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
1o7k-assembly1.cif.gz_C human p47 px domain complex with sulphates 0.8238 130 166
4n31-assembly1.cif.gz_A structure and activity of streptococcus pyogenes sipa: a signal peptidase homologue essential for pilus polymerisation 0.8017 35 216
3iiq-assembly1.cif.gz_B crystallographic analysis of bacterial signal peptidase in ternary complex with arylomycin a2 and a beta-sultam inhibitor 0.7271 36 249
1b12-assembly4.cif.gz_D crystal structure of type 1 signal peptidase from escherichia coli in complex with a beta-lactam inhibitor 0.7223 32 247
4n31-assembly1.cif.gz_A structure and activity of streptococcus pyogenes sipa: a signal peptidase homologue essential for pilus polymerisation 0.7166 35 216
ID Description Score Start End Superfamily
1kn9D01 Mainly Beta;Ribbon;Umud Fragment, subunit A;Umud Fragment, subunit A 0.9068 36 244 2.10.109.10
1kn9D01 Mainly Beta;Ribbon;Umud Fragment, subunit A;Umud Fragment, subunit A 0.8746 36 244 2.10.109.10
1b12C01 Mainly Beta;Ribbon;Umud Fragment, subunit A;Umud Fragment, subunit A 0.8638 38 246 2.10.109.10
af_Q54RP1_162_281_2.10.109.10 Mainly Beta;Ribbon;Umud Fragment, subunit A;Umud Fragment, subunit A 0.8451 31 216 2.10.109.10
1b12C01 Mainly Beta;Ribbon;Umud Fragment, subunit A;Umud Fragment, subunit A 0.8233 38 246 2.10.109.10
ID Description Score Start End GO Terms
AF-A0A443G007-F1-model_v4 deleted 0.9695 88 219
AF-A0A443G007-F1-model_v4 deleted 0.9623 88 219
AF-A0A7C1SX00-F1-model_v4 Signal peptidase I (EC 3.4.21.89) 0.943 87 249 GO:0004252
GO:0006465
GO:0016020
AF-A0A7C1SX00-F1-model_v4 Signal peptidase I (EC 3.4.21.89) 0.9375 87 249 GO:0004252
GO:0006465
GO:0016020
AF-A0A1S6XGL1-F1-model_v4 deleted 0.9241 28 248

Feature Viewer

pLDDT pTM Quality
78.52 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map