F474278

General Info

Members Datasets Scaffolds Average Seq Length
673 262 1346 309

Family's Representative Sequence

Representative Sequence 3300005290|Ga0065712_10088652|Ga0065712_100886522
Length 285
Sequence VLENVTVIYGKNQALKNVSARFERGAVGLLGPNGAGKSTMLKSLLGFVKPDMPETDGHIPGMNAVSFVAYCGQLAGLPAVDAMQRAHEVLYYVGLGEARYRNLETYSTGMKQRIKLAQAIVHDPDLLFLDEPTNGMDPKGRDEMLELIRDLGHNKNVSLILSSHLLPDVEFTCDHVVVMDKGQVAAQGPIDDLKGPAGRVFELRVKTTGGTLPAFIEVLQKAGMECHATDEDVMRVFVPASVAGGDHRDQQAIFSLAAKEGVQVRHLRPSVPTLEDVFAKAVGDL

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
59 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
60 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
61 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
138 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
142 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
143 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
144 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
145 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
146 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
147 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
148 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
149 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
150 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
151 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
152 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
153 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
154 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
155 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
156 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
157 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
158 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
159 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
160 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
161 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
162 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
163 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
164 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
165 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
166 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
167 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
168 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
169 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
170 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
171 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
172 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
173 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
174 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
175 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
176 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
177 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
178 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
179 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
180 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
181 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
182 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
183 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
184 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
185 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
186 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
187 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
188 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
189 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
190 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
191 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
192 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
193 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
194 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
195 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
196 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
197 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
198 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
199 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
200 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
201 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
202 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
203 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
204 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
205 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
206 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
207 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
208 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
209 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
223 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
224 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
225 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
226 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
227 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
228 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
229 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
230 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
231 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
232 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
233 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
234 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
235 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
236 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
238 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
239 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
240 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
241 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
242 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
243 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
244 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
245 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
246 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
247 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
248 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
249 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
250 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
251 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
252 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
253 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
254 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
255 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
256 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
257 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
258 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
259 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
260 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
261 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
262 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.23
Nodule 0
Rhizoplane 5.05
Rhizosphere 92.57
Stem 0
Stem Tuber 0
Unclassified 0.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10088652 3300005290 Bacteria 2505
2 JGI24746J21847_1002357 3300001977 Bacteria 3018
3 JGI24749J21850_1003767 3300002076 Bacteria 2118
4 Ga0065704_10007534 3300005289 Bacteria 2432
5 Ga0065712_10173122 3300005290 Bacteria 1232
6 Ga0065712_10220420 3300005290 Bacteria 1040
7 Ga0065715_10000380 3300005293 Bacteria 27890
8 Ga0065715_10003642 3300005293 Bacteria 4257
9 Ga0065707_10086151 3300005295 Bacteria 5632
10 Ga0065707_10090345 3300005295 Bacteria 4158
11 Ga0065707_10110134 3300005295 Bacteria 2442
12 Ga0065707_10238379 3300005295 Bacteria 1164
13 Ga0070658_10074096 3300005327 Bacteria 2792
14 Ga0070658_10219601 3300005327 Bacteria 1607
15 Ga0070676_10020457 3300005328 Bacteria 3695
16 Ga0070676_10031331 3300005328 Bacteria 3038
17 Ga0070676_10053916 3300005328 Bacteria 2369
18 Ga0070683_100071853 3300005329 Bacteria 3229
19 Ga0070690_100104917 3300005330 Bacteria 1878
20 Ga0070670_100003083 3300005331 Bacteria 13782
21 Ga0070670_100029465 3300005331 Bacteria 4726
22 Ga0070670_100071756 3300005331 Bacteria 2973
23 Ga0070670_100098835 3300005331 Bacteria 2511
24 Ga0070677_10005765 3300005333 Bacteria 4096
25 Ga0070677_10094836 3300005333 Bacteria 1304
26 Ga0068869_100045674 3300005334 Bacteria 3155
27 Ga0068869_100066455 3300005334 Bacteria 2657
28 Ga0068869_100072769 3300005334 Bacteria 2547
29 Ga0068869_100079636 3300005334 Bacteria 2442
30 Ga0070666_10116612 3300005335 Bacteria 1849
31 Ga0070680_100400000 3300005336 Bacteria 1171
32 Ga0068868_100022880 3300005338 Bacteria 4724
33 Ga0068868_100321843 3300005338 Bacteria 1318
34 Ga0070689_100008690 3300005340 Bacteria 7167
35 Ga0070689_100156663 3300005340 Bacteria 1839
36 Ga0070689_100170358 3300005340 Bacteria 1764
37 Ga0070687_100009424 3300005343 Bacteria 4184
38 Ga0070687_100023225 3300005343 Bacteria 2945
39 Ga0070687_100190760 3300005343 Bacteria 1235
40 Ga0070668_100433747 3300005347 Bacteria 1127
41 Ga0070669_100000449 3300005353 Bacteria 31407
42 Ga0070669_100002731 3300005353 Bacteria 12736
43 Ga0070669_100010650 3300005353 Bacteria 6528
44 Ga0070669_100043492 3300005353 Bacteria 3271
45 Ga0070669_100090863 3300005353 Bacteria 2289
46 Ga0070675_100008093 3300005354 Bacteria 8151
47 Ga0070675_100018320 3300005354 Bacteria 5573
48 Ga0070675_100112917 3300005354 Bacteria 2301
49 Ga0070675_100116672 3300005354 Bacteria 2265
50 Ga0070675_100126120 3300005354 Bacteria 2178
51 Ga0070675_100202069 3300005354 Bacteria 1725
52 Ga0070675_100235749 3300005354 Bacteria 1598
53 Ga0070671_100013639 3300005355 Bacteria 6554
54 Ga0070674_100092181 3300005356 Bacteria 2189
55 Ga0070673_100007888 3300005364 Bacteria 7056
56 Ga0070673_100008869 3300005364 Bacteria 6718
57 Ga0070673_100049079 3300005364 Bacteria 3294
58 Ga0070688_100007684 3300005365 Bacteria 5823
59 Ga0070688_100188426 3300005365 Bacteria 1436
60 Ga0070688_100271040 3300005365 Bacteria 1216
61 Ga0070659_100263278 3300005366 Bacteria 1431
62 Ga0070659_100303925 3300005366 Bacteria 1331
63 Ga0070667_100049733 3300005367 Bacteria 3531
64 Ga0070667_100289850 3300005367 Bacteria 1472
65 Ga0070709_10088529 3300005434 Bacteria 2037
66 Ga0070713_100006723 3300005436 Bacteria 8005
67 Ga0070705_100088241 3300005440 Bacteria 1925
68 Ga0070700_100010164 3300005441 Bacteria 5187
69 Ga0070694_100009258 3300005444 Bacteria 6043
70 Ga0070678_100003249 3300005456 Bacteria 9028
71 Ga0070678_100029384 3300005456 Bacteria 3763
72 Ga0070678_100276117 3300005456 Bacteria 1419
73 Ga0070678_100346439 3300005456 Bacteria 1276
74 Ga0070662_100002932 3300005457 Bacteria 10608
75 Ga0070662_100135422 3300005457 Bacteria 1904
76 Ga0070662_100136198 3300005457 Bacteria 1899
77 Ga0070662_100137097 3300005457 Bacteria 1893
78 Ga0070662_100492440 3300005457 Bacteria 1022
79 Ga0068867_100004667 3300005459 Bacteria 9639
80 Ga0068867_100039234 3300005459 Bacteria 3452
81 Ga0068867_100299287 3300005459 Bacteria 1326
82 Ga0070685_10002042 3300005466 Bacteria 10451
83 Ga0070685_10004934 3300005466 Bacteria 6749
84 Ga0070685_10172491 3300005466 Bacteria 1387
85 Ga0070699_100015643 3300005518 Bacteria 6517
86 Ga0070679_100065021 3300005530 Bacteria 3636
87 Ga0070679_100229283 3300005530 Bacteria 1817
88 Ga0070672_100005408 3300005543 Bacteria 8460
89 Ga0070672_100045990 3300005543 Bacteria 3380
90 Ga0070672_100123673 3300005543 Bacteria 2120
91 Ga0070686_100004533 3300005544 Bacteria 7661
92 Ga0070686_100039100 3300005544 Bacteria 2954
93 Ga0070686_100073665 3300005544 Bacteria 2242
94 Ga0070686_100093015 3300005544 Bacteria 2021
95 Ga0070695_100001042 3300005545 Bacteria 15156
96 Ga0070695_100052205 3300005545 Bacteria 2626
97 Ga0070696_100053533 3300005546 Bacteria 2810
98 Ga0070693_100012455 3300005547 Bacteria 4303
99 Ga0070693_100022713 3300005547 Bacteria 3340
100 Ga0070665_100004309 3300005548 Bacteria 14957
101 Ga0070665_100037052 3300005548 Bacteria 4905
102 Ga0070665_100135362 3300005548 Bacteria 2466
103 Ga0070665_100137793 3300005548 Bacteria 2443
104 Ga0070665_100451001 3300005548 Bacteria 1296
105 Ga0070704_100007618 3300005549 Bacteria 6454
106 Ga0070704_100079537 3300005549 Bacteria 2409
107 Ga0070664_100024609 3300005564 Bacteria 4982
108 Ga0070664_100029088 3300005564 Bacteria 4604
109 Ga0070664_100084616 3300005564 Bacteria 2738
110 Ga0070664_100138439 3300005564 Bacteria 2142
111 Ga0070664_100239909 3300005564 Bacteria 1627
112 Ga0068857_100035909 3300005577 Bacteria 4391
113 Ga0068857_100458856 3300005577 Bacteria 1192
114 Ga0068854_100224239 3300005578 Bacteria 1488
115 Ga0068854_100471993 3300005578 Bacteria 1052
116 Ga0068859_100045897 3300005617 Bacteria 4389
117 Ga0068859_100110656 3300005617 Bacteria 2808
118 Ga0068859_100354305 3300005617 Bacteria 1562
119 Ga0068864_100002276 3300005618 Bacteria 15878
120 Ga0068864_100052826 3300005618 Bacteria 3504
121 Ga0068864_100257221 3300005618 Bacteria 1623
122 Ga0068864_100517798 3300005618 Bacteria 1149
123 Ga0068861_100041479 3300005719 Bacteria 3447
124 Ga0068861_100050937 3300005719 Bacteria 3141
125 Ga0068861_100096800 3300005719 Bacteria 2340
126 Ga0068861_100143447 3300005719 Bacteria 1952
127 Ga0068870_10101756 3300005840 Bacteria 1625
128 Ga0068863_100016572 3300005841 Bacteria 7071
129 Ga0068863_100078702 3300005841 Bacteria 3122
130 Ga0068863_100101266 3300005841 Bacteria 2738
131 Ga0068858_100026810 3300005842 Bacteria 5353
132 Ga0068858_100075313 3300005842 Bacteria 3134
133 Ga0068858_100184520 3300005842 Bacteria 1970
134 Ga0068860_100016344 3300005843 Bacteria 7235
135 Ga0068860_100209085 3300005843 Bacteria 1892
136 Ga0068860_100370857 3300005843 Bacteria 1412
137 Ga0068862_100023803 3300005844 Bacteria 5134
138 Ga0068862_100059922 3300005844 Bacteria 3269
139 Ga0081455_10042127 3300005937 Bacteria 4008
140 Ga0075368_10032902 3300006042 Bacteria 2015
141 Ga0075368_10077654 3300006042 Bacteria 1348
142 Ga0075364_10037029 3300006051 Bacteria 3156
143 Ga0070715_10098587 3300006163 Bacteria 1359
144 Ga0075367_10009517 3300006178 Bacteria 5084
145 Ga0075367_10010764 3300006178 Bacteria 4816
146 Ga0075367_10058319 3300006178 Bacteria 2297
147 Ga0097621_100000075 3300006237 Bacteria 51581
148 Ga0097621_100000846 3300006237 Bacteria 21555
149 Ga0097621_100014409 3300006237 Bacteria 5916
150 Ga0097621_100045198 3300006237 Bacteria 3556
151 Ga0097621_100250727 3300006237 Bacteria 1550
152 Ga0068871_100000117 3300006358 Bacteria 49272
153 Ga0068871_100001012 3300006358 Bacteria 18862
154 Ga0068871_100013025 3300006358 Bacteria 6162
155 Ga0068871_100044896 3300006358 Bacteria 3555
156 Ga0075428_100000903 3300006844 Bacteria 31327
157 Ga0075428_100004820 3300006844 Bacteria 14965
158 Ga0075428_100011822 3300006844 Bacteria 9715
159 Ga0075428_100064317 3300006844 Bacteria 4017
160 Ga0075428_100126018 3300006844 Bacteria 2787
161 Ga0075428_100165304 3300006844 Bacteria 2400
162 Ga0075428_100526646 3300006844 Bacteria 1264
163 Ga0075430_100007806 3300006846 Bacteria 9039
164 Ga0075430_100065602 3300006846 Bacteria 3050
165 Ga0075431_100003305 3300006847 Bacteria 15612
166 Ga0075431_100031863 3300006847 Bacteria 5430
167 Ga0075431_100055112 3300006847 Bacteria 4101
168 Ga0075431_100082582 3300006847 Bacteria 3317
169 Ga0075431_100208891 3300006847 Bacteria 1995
170 Ga0075433_10002511 3300006852 Bacteria 13956
171 Ga0075433_10003905 3300006852 Bacteria 11538
172 Ga0075433_10011221 3300006852 Bacteria 7211
173 Ga0075433_10223130 3300006852 Bacteria 1674
174 Ga0075434_100000190 3300006871 Bacteria 40653
175 Ga0075434_100003159 3300006871 Bacteria 14687
176 Ga0075434_100007038 3300006871 Bacteria 10377
177 Ga0075434_100011753 3300006871 Bacteria 8269
178 Ga0075434_100023809 3300006871 Bacteria 5974
179 Ga0075434_100051983 3300006871 Bacteria 4071
180 Ga0075429_100025327 3300006880 Bacteria 5149
181 Ga0075429_100352768 3300006880 Bacteria 1288
182 Ga0068865_100158841 3300006881 Bacteria 1722
183 Ga0068865_100191034 3300006881 Bacteria 1584
184 Ga0075436_100000303 3300006914 Bacteria 31545
185 Ga0075436_100013595 3300006914 Bacteria 5575
186 Ga0075436_100023197 3300006914 Bacteria 4263
187 Ga0075436_100089207 3300006914 Bacteria 2142
188 Ga0097620_100045897 3300006931 Bacteria 4389
189 Ga0097620_100110655 3300006931 Bacteria 2808
190 Ga0097620_100354301 3300006931 Bacteria 1562
191 Ga0075435_100000120 3300007076 Bacteria 44119
192 Ga0075435_100000950 3300007076 Bacteria 18270
193 Ga0075435_100012767 3300007076 Bacteria 6223
194 Ga0075435_100046531 3300007076 Bacteria 3480
195 Ga0075435_100072983 3300007076 Bacteria 2804
196 Ga0075435_100086732 3300007076 Bacteria 2578
197 Ga0105240_10361396 3300009093 Bacteria 1644
198 Ga0111539_10001783 3300009094 Bacteria 28619
199 Ga0111539_10006238 3300009094 Bacteria 15388
200 Ga0111539_10010186 3300009094 Bacteria 11846
201 Ga0111539_10017585 3300009094 Bacteria 8848
202 Ga0111539_10022067 3300009094 Bacteria 7824
203 Ga0111539_10040324 3300009094 Bacteria 5622
204 Ga0111539_10050816 3300009094 Bacteria 4939
205 Ga0111539_10066018 3300009094 Bacteria 4274
206 Ga0111539_10413851 3300009094 Bacteria 1570
207 Ga0105247_10017713 3300009101 Bacteria 4272
208 Ga0114129_10002451 3300009147 Bacteria 25770
209 Ga0114129_10025441 3300009147 Bacteria 8388
210 Ga0114129_10036720 3300009147 Bacteria 6918
211 Ga0114129_10048292 3300009147 Bacteria 5981
212 Ga0114129_10094809 3300009147 Bacteria 4134
213 Ga0114129_10527400 3300009147 Bacteria 1539
214 Ga0105242_10007270 3300009176 Bacteria 8541
215 Ga0105242_10020524 3300009176 Bacteria 5181
216 Ga0105248_10008405 3300009177 Bacteria 11328
217 Ga0105248_10009323 3300009177 Bacteria 10808
218 Ga0105248_10021966 3300009177 Bacteria 7071
219 Ga0105248_10043055 3300009177 Bacteria 5063
220 Ga0105248_10184943 3300009177 Bacteria 2348
221 Ga0105237_10270348 3300009545 Bacteria 1703
222 Ga0105238_10365624 3300009551 Bacteria 1432
223 Ga0105238_10591563 3300009551 Bacteria 1117
224 Ga0105249_10011641 3300009553 Bacteria 7735
225 Ga0105249_10023800 3300009553 Bacteria 5501
226 Ga0105249_10176038 3300009553 Bacteria 2078
227 Ga0157371_10330181 3300013102 Bacteria 1108
228 Ga0157378_10002536 3300013297 Bacteria 16251
229 Ga0163162_10029897 3300013306 Bacteria 5394
230 Ga0163162_10049858 3300013306 Bacteria 4197
231 Ga0163162_10381104 3300013306 Bacteria 1543
232 Ga0163162_10453240 3300013306 Bacteria 1415
233 Ga0163162_10705550 3300013306 Bacteria 1130
234 Ga0163163_10339392 3300014325 Bacteria 1557
235 Ga0163163_10352532 3300014325 Bacteria 1528
236 Ga0157380_10001869 3300014326 Bacteria 13935
237 Ga0157380_10002114 3300014326 Bacteria 13324
238 Ga0157380_10017845 3300014326 Bacteria 5259
239 Ga0157380_10099202 3300014326 Bacteria 2422
240 Ga0157377_10006256 3300014745 Bacteria 5667
241 Ga0157379_10034236 3300014968 Bacteria 4527
242 Ga0157379_10037658 3300014968 Bacteria 4314
243 Ga0157376_10039756 3300014969 Bacteria 3838
244 Ga0157376_10061652 3300014969 Bacteria 3154
245 Ga0157376_10153828 3300014969 Bacteria 2077
246 Ga0163161_10114426 3300017792 Bacteria 2021
247 Ga0207666_1009324 3300025271 Bacteria 1325
248 Ga0207697_10007053 3300025315 Bacteria 5032
249 Ga0207682_10002886 3300025893 Bacteria 7586
250 Ga0207682_10003879 3300025893 Bacteria 6395
251 Ga0207682_10026503 3300025893 Bacteria 2304
252 Ga0207682_10060959 3300025893 Bacteria 1579
253 Ga0207710_10062961 3300025900 Bacteria 1687
254 Ga0207688_10000058 3300025901 Bacteria 40361
255 Ga0207645_10000244 3300025907 Bacteria 45170
256 Ga0207645_10003113 3300025907 Bacteria 12717
257 Ga0207645_10006245 3300025907 Bacteria 8561
258 Ga0207643_10006597 3300025908 Bacteria 6223
259 Ga0207705_10269093 3300025909 Bacteria 1303
260 Ga0207662_10001736 3300025918 Bacteria 10690
261 Ga0207662_10006976 3300025918 Bacteria 6130
262 Ga0207662_10025805 3300025918 Bacteria 3386
263 Ga0207657_10221351 3300025919 Bacteria 1516
264 Ga0207649_10049803 3300025920 Bacteria 2589
265 Ga0207652_10030909 3300025921 Bacteria 4491
266 Ga0207646_10172520 3300025922 Bacteria 1953
267 Ga0207681_10006665 3300025923 Bacteria 7092
268 Ga0207681_10012462 3300025923 Bacteria 5247
269 Ga0207681_10026905 3300025923 Bacteria 3714
270 Ga0207650_10001935 3300025925 Bacteria 14582
271 Ga0207650_10013957 3300025925 Bacteria 5575
272 Ga0207650_10017996 3300025925 Bacteria 4953
273 Ga0207659_10001233 3300025926 Bacteria 15316
274 Ga0207659_10078681 3300025926 Bacteria 2430
275 Ga0207659_10176775 3300025926 Bacteria 1688
276 Ga0207659_10343602 3300025926 Bacteria 1236
277 Ga0207687_10043197 3300025927 Bacteria 3105
278 Ga0207687_10073924 3300025927 Bacteria 2442
279 Ga0207700_10014167 3300025928 Bacteria 5216
280 Ga0207644_10032811 3300025931 Bacteria 3626
281 Ga0207644_10105323 3300025931 Bacteria 2125
282 Ga0207644_10255507 3300025931 Bacteria 1399
283 Ga0207690_10048363 3300025932 Bacteria 2828
284 Ga0207690_10157722 3300025932 Bacteria 1689
285 Ga0207690_10218226 3300025932 Bacteria 1458
286 Ga0207690_10438349 3300025932 Bacteria 1048
287 Ga0207706_10019108 3300025933 Bacteria 6164
288 Ga0207706_10028121 3300025933 Bacteria 5023
289 Ga0207706_10051035 3300025933 Bacteria 3654
290 Ga0207706_10140641 3300025933 Bacteria 2123
291 Ga0207706_10171217 3300025933 Bacteria 1908
292 Ga0207706_10273342 3300025933 Bacteria 1474
293 Ga0207706_10290017 3300025933 Bacteria 1426
294 Ga0207686_10086967 3300025934 Bacteria 2054
295 Ga0207709_10141740 3300025935 Bacteria 1653
296 Ga0207670_10017396 3300025936 Bacteria 4346
297 Ga0207670_10346786 3300025936 Bacteria 1175
298 Ga0207669_10005447 3300025937 Bacteria 5711
299 Ga0207669_10054976 3300025937 Bacteria 2408
300 Ga0207669_10069585 3300025937 Bacteria 2203
301 Ga0207669_10104410 3300025937 Bacteria 1882
302 Ga0207704_10003992 3300025938 Bacteria 6715
303 Ga0207704_10009921 3300025938 Bacteria 4619
304 Ga0207691_10013787 3300025940 Bacteria 7722
305 Ga0207691_10018297 3300025940 Bacteria 6637
306 Ga0207691_10030781 3300025940 Bacteria 5013
307 Ga0207691_10042490 3300025940 Bacteria 4190
308 Ga0207691_10058044 3300025940 Bacteria 3520
309 Ga0207691_10071478 3300025940 Bacteria 3131
310 Ga0207691_10143733 3300025940 Bacteria 2101
311 Ga0207711_10003819 3300025941 Bacteria 12957
312 Ga0207711_10060234 3300025941 Bacteria 3271
313 Ga0207711_10080023 3300025941 Bacteria 2854
314 Ga0207711_10125130 3300025941 Bacteria 2299
315 Ga0207711_10130785 3300025941 Bacteria 2250
316 Ga0207689_10000917 3300025942 Bacteria 28290
317 Ga0207689_10028841 3300025942 Bacteria 4640
318 Ga0207689_10045136 3300025942 Bacteria 3645
319 Ga0207689_10105217 3300025942 Bacteria 2318
320 Ga0207679_10006742 3300025945 Bacteria 7276
321 Ga0207651_10012662 3300025960 Bacteria 4785
322 Ga0207651_10043889 3300025960 Bacteria 2988
323 Ga0207651_10075149 3300025960 Bacteria 2409
324 Ga0207651_10155692 3300025960 Bacteria 1785
325 Ga0207712_10005428 3300025961 Bacteria 8045
326 Ga0207712_10090125 3300025961 Bacteria 2256
327 Ga0207640_10257579 3300025981 Bacteria 1358
328 Ga0207658_10129453 3300025986 Bacteria 2025
329 Ga0207677_10046464 3300026023 Bacteria 2907
330 Ga0207703_10080702 3300026035 Bacteria 2709
331 Ga0207703_10094445 3300026035 Bacteria 2521
332 Ga0207678_10051823 3300026067 Bacteria 3542
333 Ga0207708_10001542 3300026075 Bacteria 17184
334 Ga0207708_10005533 3300026075 Bacteria 9320
335 Ga0207708_10009769 3300026075 Bacteria 7119
336 Ga0207708_10029019 3300026075 Bacteria 4190
337 Ga0207708_10103709 3300026075 Bacteria 2203
338 Ga0207708_10191727 3300026075 Bacteria 1627
339 Ga0207641_10008812 3300026088 Bacteria 8333
340 Ga0207641_10058317 3300026088 Bacteria 3285
341 Ga0207641_10331751 3300026088 Bacteria 1445
342 Ga0207648_10001413 3300026089 Bacteria 26456
343 Ga0207648_10005095 3300026089 Bacteria 13315
344 Ga0207648_10017234 3300026089 Bacteria 6581
345 Ga0207648_10024375 3300026089 Bacteria 5401
346 Ga0207648_10044582 3300026089 Bacteria 3891
347 Ga0207648_10156242 3300026089 Bacteria 2013
348 Ga0207676_10021466 3300026095 Bacteria 4737
349 Ga0207676_10191966 3300026095 Bacteria 1798
350 Ga0207674_10009058 3300026116 Bacteria 11430
351 Ga0207674_10026476 3300026116 Bacteria 6157
352 Ga0207674_10304409 3300026116 Bacteria 1543
353 Ga0207674_10354307 3300026116 Bacteria 1419
354 Ga0207675_100011274 3300026118 Bacteria 8370
355 Ga0207675_100039131 3300026118 Bacteria 4426
356 Ga0207675_100126756 3300026118 Bacteria 2418
357 Ga0207675_100400655 3300026118 Bacteria 1352
358 Ga0207683_10004379 3300026121 Bacteria 12201
359 Ga0207683_10021032 3300026121 Bacteria 5584
360 Ga0207683_10022282 3300026121 Bacteria 5436
361 Ga0207683_10035150 3300026121 Bacteria 4358
362 Ga0209971_1012570 3300027682 Bacteria 2004
363 Ga0207428_10000910 3300027907 Bacteria 33053
364 Ga0207428_10001154 3300027907 Bacteria 28569
365 Ga0207428_10001542 3300027907 Bacteria 24109
366 Ga0207428_10001583 3300027907 Bacteria 23694
367 Ga0207428_10010763 3300027907 Bacteria 8155
368 Ga0207428_10018225 3300027907 Bacteria 6000
369 Ga0207428_10041825 3300027907 Bacteria 3709
370 Ga0207428_10049618 3300027907 Bacteria 3362
371 Ga0268266_10013401 3300028379 Bacteria 7061
372 Ga0268266_10026683 3300028379 Bacteria 4914
373 Ga0268266_10082151 3300028379 Bacteria 2810
374 Ga0268266_10110648 3300028379 Bacteria 2433
375 Ga0268265_10035677 3300028380 Bacteria 3636
376 Ga0268265_10094441 3300028380 Bacteria 2399
377 Ga0268265_10175833 3300028380 Bacteria 1835
378 Ga0268265_10192183 3300028380 Bacteria 1764
379 Ga0268265_10254106 3300028380 Bacteria 1559
380 Ga0268264_10026058 3300028381 Bacteria 4775
381 Ga0268264_10091329 3300028381 Bacteria 2626
382 Ga0268264_10119906 3300028381 Bacteria 2317
383 Ga0268264_10204050 3300028381 Bacteria 1810
384 Ga0268264_10478077 3300028381 Bacteria 1211
385 Ga0265331_10085289 3300031250 Bacteria 1463
386 Ga0307408_100160793 3300031548 Bacteria 1784
387 Ga0307408_100196897 3300031548 Bacteria 1628
388 Ga0265314_10064995 3300031711 Bacteria 2466
389 Ga0307413_10019880 3300031824 Bacteria 3559
390 Ga0307413_10028596 3300031824 Bacteria 3107
391 Ga0307413_10145806 3300031824 Bacteria 1643
392 Ga0307413_10215020 3300031824 Bacteria 1399
393 Ga0307410_10063340 3300031852 Bacteria 2536
394 Ga0307410_10116414 3300031852 Bacteria 1942
395 Ga0307406_10007353 3300031901 Bacteria 6104
396 Ga0307406_10061721 3300031901 Bacteria 2422
397 Ga0307406_10215045 3300031901 Bacteria 1425
398 Ga0307407_10141976 3300031903 Bacteria 1550
399 Ga0307407_10162799 3300031903 Bacteria 1461
400 Ga0307407_10247097 3300031903 Bacteria 1220
401 Ga0307412_10015722 3300031911 Bacteria 4492
402 Ga0307412_10067976 3300031911 Bacteria 2421
403 Ga0307409_100021527 3300031995 Bacteria 4423
404 Ga0307409_100032883 3300031995 Bacteria 3767
405 Ga0307409_100094664 3300031995 Bacteria 2458
406 Ga0307409_100254215 3300031995 Bacteria 1608
407 Ga0307416_100042993 3300032002 Bacteria 3533
408 Ga0307416_100072092 3300032002 Bacteria 2873
409 Ga0307416_100099091 3300032002 Bacteria 2530
410 Ga0307416_100125095 3300032002 Bacteria 2301
411 Ga0307416_100295609 3300032002 Bacteria 1606
412 Ga0307414_10276486 3300032004 Bacteria 1409
413 Ga0307411_10001318 3300032005 Bacteria 9987
414 Ga0307411_10140750 3300032005 Bacteria 1779
415 Ga0307411_10153794 3300032005 Bacteria 1713
416 Ga0307411_10299263 3300032005 Bacteria 1289
417 Ga0307415_100115426 3300032126 Bacteria 2001
418 Ga0307415_100139158 3300032126 Bacteria 1851
419 Ga0373941_0055122 3300035115 Bacteria 1277
420 Ga0373953_0007099 3300035117 Bacteria 3733
421 Ga0373954_0114033 3300035118 Bacteria 1309
422 Ga0373956_0009271 3300035119 Bacteria 3998
423 Ga0373957_0012452 3300035120 Bacteria 2865
424 Ga0373957_0040156 3300035120 Bacteria 1758
425 Ga0373955_0063303 3300035172 Bacteria 2048
426 Ga0373955_0105335 3300035172 Bacteria 1624
427 Ga0373924_0006993 3300035410 Bacteria 4061
428 Ga0373931_0095618 3300035691 Bacteria 1663
429 Ga0373935_0315058 3300035692 Bacteria 1109
430 Ga0373933_0007742 3300035724 Bacteria 5868
431 Ga0373933_0205301 3300035724 Bacteria 1262
432 Ga0373947_0254527 3300035725 Bacteria 1162
433 Ga0373937_0015524 3300036401 Bacteria 6738
434 Ga0373937_0016963 3300036401 Bacteria 6476
435 Ga0373937_0073595 3300036401 Bacteria 3152
436 Ga0373937_0076002 3300036401 Bacteria 3102
437 Ga0373937_0078503 3300036401 Bacteria 3051
438 Ga0373925_0003025 3300037068 Bacteria 13231
439 Ga0436365_1209205 3300039437 Bacteria 5351
440 Ga0439439_0041731 3300041406 Bacteria 1191
441 Ga0439431_0013343 3300041997 Bacteria 1895
442 Ga0439462_0007686 3300042015 Bacteria 2704
443 Ga0439462_0025983 3300042015 Bacteria 1542
444 Ga0450894_010115 3300042131 Bacteria 1223
445 Ga0439446_0026952 3300042156 Bacteria 1649
446 Ga0439434_0009000 3300042435 Bacteria 2935
447 Ga0439434_0025962 3300042435 Bacteria 1769
448 Ga0439435_0026814 3300042436 Bacteria 1537
449 Ga0439435_0029386 3300042436 Bacteria 1483
450 Ga0439460_0021193 3300042461 Bacteria 1774
451 Ga0451577_0232176 3300042876 Bacteria 1669
452 Ga0439440_0016713 3300042993 Bacteria 1610
453 Ga0451576_0177712 3300045051 Bacteria 2222
454 Ga0451576_0180507 3300045051 Bacteria 2204
455 Ga0451576_0189979 3300045051 Bacteria 2145
456 Ga0495629_0054532 3300046459 Bacteria 2796
457 Ga0495629_0074363 3300046459 Bacteria 2373
458 Ga0495629_0186724 3300046459 Bacteria 1436
459 Ga0495582_0078109 3300046473 Bacteria 1836
460 Ga0495664_0064310 3300046477 Bacteria 2187
461 Ga0495628_0047158 3300046516 Bacteria 3420
462 Ga0495630_0094127 3300046517 Bacteria 2265
463 Ga0495621_0035171 3300046539 Bacteria 1734
464 Ga0495621_0040136 3300046539 Bacteria 1639
465 Ga0495645_0000776 3300046543 Bacteria 21886
466 Ga0495645_0037976 3300046543 Bacteria 3511
467 Ga0495633_0083321 3300046558 Bacteria 1488
468 Ga0495656_0040387 3300046615 Bacteria 1944
469 Ga0495635_0080895 3300046663 Bacteria 2223
470 Ga0495658_0108419 3300046683 Bacteria 1667
471 Ga0495658_0166255 3300046683 Bacteria 1363
472 Ga0495613_0003856 3300046689 Bacteria 11218
473 Ga0495613_0096249 3300046689 Bacteria 2141
474 Ga0495604_0025364 3300047317 Bacteria 4724
475 Ga0495604_0232485 3300047317 Bacteria 1264
476 Ga0495675_0176326 3300047444 Bacteria 1311
477 Ga0495675_0250766 3300047444 Bacteria 1063
478 Ga0495684_0000131 3300047471 Bacteria 54636
479 Ga0496100_0007715 3300048903 Bacteria 5957
480 Ga0496100_0166992 3300048903 Bacteria 1582
481 Ga0496101_0006042 3300048904 Bacteria 7770
482 Ga0496101_0030870 3300048904 Bacteria 3762
483 Ga0496101_0174435 3300048904 Bacteria 1653
484 Ga0496102_0142129 3300048905 Bacteria 2251
485 Ga0496102_0223376 3300048905 Bacteria 1776
486 Ga0496103_0072071 3300048906 Bacteria 2163
487 Ga0496104_0002322 3300048907 Bacteria 16430
488 Ga0496104_0005698 3300048907 Bacteria 10903
489 Ga0496104_0092905 3300048907 Bacteria 2885
490 Ga0496106_0073241 3300048909 Bacteria 2620
491 Ga0496107_0154079 3300048910 Bacteria 1701
492 Ga0496108_0002813 3300048911 Bacteria 13963
493 Ga0496108_0015563 3300048911 Bacteria 6203
494 Ga0496109_0002172 3300048912 Bacteria 16298
495 Ga0496109_0031026 3300048912 Bacteria 4793
496 Ga0496109_0086305 3300048912 Bacteria 2898
497 Ga0496109_0174304 3300048912 Bacteria 2019
498 Ga0496109_0364366 3300048912 Bacteria 1365
499 Ga0496109_0401826 3300048912 Bacteria 1294
500 Ga0496110_0007883 3300048913 Bacteria 8529
501 Ga0496111_0029811 3300048914 Bacteria 3876
502 Ga0496112_0000823 3300048915 Bacteria 22013
503 Ga0496112_0021470 3300048915 Bacteria 6141
504 Ga0496112_0024629 3300048915 Bacteria 5767
505 Ga0496112_0055339 3300048915 Bacteria 3901
506 Ga0496112_0219182 3300048915 Bacteria 1859
507 Ga0496112_0235560 3300048915 Bacteria 1784
508 Ga0496113_0003704 3300048916 Bacteria 9213
509 Ga0496114_0000662 3300048917 Bacteria 25550
510 Ga0496114_0096756 3300048917 Bacteria 2514
511 Ga0496114_0182483 3300048917 Bacteria 1833
512 Ga0496115_0065096 3300048918 Bacteria 2944
513 Ga0501031_0217467 3300049568 Bacteria 1244
514 Ga0501031_0265217 3300049568 Bacteria 1116
515 Ga0501032_0004225 3300049569 Bacteria 10862
516 Ga0501034_0001801 3300049571 Bacteria 27349
517 Ga0501034_0062026 3300049571 Bacteria 3753
518 Ga0501034_0103428 3300049571 Bacteria 2841
519 Ga0501034_0168375 3300049571 Bacteria 2159
520 Ga0501036_0024294 3300049572 Bacteria 5108
521 Ga0501036_0046612 3300049572 Bacteria 3671
522 Ga0501036_0195373 3300049572 Bacteria 1702
523 Ga0501036_0287336 3300049572 Bacteria 1376
524 Ga0501037_0098994 3300049573 Bacteria 2106
525 Ga0501038_0005448 3300049574 Bacteria 11826
526 Ga0501038_0041156 3300049574 Bacteria 4030
527 Ga0501038_0121936 3300049574 Bacteria 2149
528 Ga0501038_0227007 3300049574 Bacteria 1488
529 Ga0501039_0003696 3300049575 Bacteria 11475
530 Ga0501039_0028592 3300049575 Bacteria 4291
531 Ga0501039_0114147 3300049575 Bacteria 2113
532 Ga0501041_0038171 3300049577 Bacteria 2912
533 Ga0501041_0040358 3300049577 Bacteria 2833
534 Ga0501042_0038641 3300049578 Bacteria 3389
535 Ga0501042_0141051 3300049578 Bacteria 1738
536 Ga0501043_0009977 3300049579 Bacteria 7449
537 Ga0501043_0165743 3300049579 Bacteria 1725
538 Ga0501046_0001889 3300049580 Bacteria 19915
539 Ga0501046_0052542 3300049580 Bacteria 3211
540 Ga0501046_0084814 3300049580 Bacteria 2443
541 Ga0501047_0003158 3300049581 Bacteria 15621
542 Ga0501047_0003468 3300049581 Bacteria 14900
543 Ga0501047_0435833 3300049581 Bacteria 1141
544 Ga0501048_0016812 3300049582 Bacteria 5392
545 Ga0501048_0041735 3300049582 Bacteria 3286
546 Ga0501067_0021001 3300049583 Bacteria 3613
547 Ga0501067_0029562 3300049583 Bacteria 3037
548 Ga0501067_0081934 3300049583 Bacteria 1789
549 Ga0501067_0090769 3300049583 Bacteria 1696
550 Ga0501068_0011003 3300049584 Bacteria 5091
551 Ga0501071_0145720 3300049587 Bacteria 1765
552 Ga0501071_0192995 3300049587 Bacteria 1528
553 Ga0501071_0239458 3300049587 Bacteria 1368
554 Ga0501072_0045094 3300049588 Bacteria 3466
555 Ga0501072_0075548 3300049588 Unclassified 2665
556 Ga0501072_0079423 3300049588 Bacteria 2598
557 Ga0501072_0098447 3300049588 Bacteria 2325
558 Ga0501072_0214231 3300049588 Bacteria 1535
559 Ga0501073_0001811 3300049589 Bacteria 15901
560 Ga0501073_0017642 3300049589 Bacteria 5167
561 Ga0501073_0019132 3300049589 Bacteria 4948
562 Ga0501074_0129938 3300049590 Bacteria 1802
563 Ga0501075_0027868 3300049591 Bacteria 4165
564 Ga0501075_0039490 3300049591 Bacteria 3533
565 Ga0501075_0049391 3300049591 Bacteria 3162
566 Ga0501076_0065090 3300049592 Bacteria 2906
567 Ga0501076_0187745 3300049592 Bacteria 1686
568 Ga0501077_0029563 3300049593 Bacteria 3484
569 Ga0501077_0220587 3300049593 Bacteria 1205
570 Ga0501077_0224969 3300049593 Bacteria 1193
571 Ga0501079_0009386 3300049741 Bacteria 7415
572 Ga0501079_0442232 3300049741 Bacteria 1021
573 Ga0501080_0001517 3300049742 Bacteria 19598
574 Ga0501080_0041051 3300049742 Bacteria 4313
575 Ga0501080_0105157 3300049742 Bacteria 2618
576 Ga0501080_0143647 3300049742 Bacteria 2206
577 Ga0501081_0042066 3300049743 Bacteria 3131
578 Ga0501081_0100816 3300049743 Bacteria 2041
579 Ga0501081_0363127 3300049743 Bacteria 1068
580 Ga0501083_0040570 3300049744 Bacteria 3159
581 Ga0501083_0059884 3300049744 Bacteria 2546
582 Ga0501273_003219 3300049770 Bacteria 1716
583 Ga0501044_0004234 3300049823 Bacteria 16111
584 Ga0501045_0003698 3300049824 Bacteria 10525
585 Ga0501045_0224071 3300049824 Bacteria 1400
586 nmdc:mga0k408_56219_c1 3300050493 Bacteria 2283
587 nmdc:mga0k408_6070_c1 3300050493 Bacteria 6440
588 nmdc:mga06z11_36503_c1 3300050494 Bacteria 2427
589 nmdc:mga06z11_64613_c1 3300050494 Bacteria 1919
590 nmdc:mga06z11_8357_c1 3300050494 Bacteria 4312
591 nmdc:mga04h51_31349_c1 3300050495 Bacteria 1679
592 nmdc:mga05p37_113765_c1 3300050507 Bacteria 3327
593 nmdc:mga05p37_250440_c1 3300050507 Bacteria 2125
594 nmdc:mga05p37_294080_c1 3300050507 Bacteria 1932
595 nmdc:mga05p37_32478_c1 3300050507 Bacteria 6383
596 nmdc:mga05p37_33054_c1 3300050507 Bacteria 6335
597 nmdc:mga05p37_53283_c1 3300050507 Bacteria 4975
598 nmdc:mga05p37_53866_c1 3300050507 Bacteria 4949
599 nmdc:mga05p37_587292_c1 3300050507 Bacteria 1260
600 nmdc:mga05p37_64069_c1 3300050507 Bacteria 4523
601 nmdc:mga09592_11687_c1 3300050508 Bacteria 7141
602 nmdc:mga09592_2150_c1 3300050508 Bacteria 15909
603 nmdc:mga0qj67_110718_c1 3300050509 Bacteria 2217
604 nmdc:mga0qj67_22134_c1 3300050509 Bacteria 4880
605 nmdc:mga0qj67_69844_c1 3300050509 Bacteria 2801
606 nmdc:mga06r32_107056_c1 3300050510 Bacteria 2747
607 nmdc:mga06r32_1269_c1 3300050510 Bacteria 22696
608 nmdc:mga06r32_14407_c1 3300050510 Bacteria 7176
609 nmdc:mga06r32_363910_c1 3300050510 Bacteria 1430
610 nmdc:mga06r32_369103_c1 3300050510 Bacteria 1418
611 nmdc:mga06r32_46245_c1 3300050510 Bacteria 4153
612 nmdc:mga06r32_53859_c1 3300050510 Bacteria 3856
613 nmdc:mga06r32_560470_c1 3300050510 Bacteria 1116
614 nmdc:mga06r32_77966_c1 3300050510 Bacteria 3220
615 nmdc:mga08y16_156878_c1 3300050511 Bacteria 2365
616 nmdc:mga08y16_1780_c1 3300050511 Bacteria 21816
617 nmdc:mga08y16_18328_c1 3300050511 Bacteria 7377
618 nmdc:mga08y16_200708_c1 3300050511 Bacteria 2067
619 nmdc:mga08y16_204285_c1 3300050511 Bacteria 2047
620 nmdc:mga08y16_2527_c1 3300050511 Bacteria 18803
621 nmdc:mga08y16_3640_c1 3300050511 Bacteria 16016
622 nmdc:mga08y16_56614_c1 3300050511 Bacteria 4097
623 nmdc:mga08y16_596367_c1 3300050511 Bacteria 1114
624 nmdc:mga0n895_11208_c1 3300050512 Bacteria 7984
625 nmdc:mga0n895_126048_c1 3300050512 Bacteria 2584
626 nmdc:mga0n895_158549_c1 3300050512 Bacteria 2294
627 nmdc:mga0n895_260985_c1 3300050512 Bacteria 1758
628 nmdc:mga0n895_26191_c1 3300050512 Bacteria 5519
629 nmdc:mga0n895_36_c1 3300050512 Bacteria 78366
630 nmdc:mga0n895_8197_c1 3300050512 Bacteria 9031
631 nmdc:mga0n895_9736_c1 3300050512 Bacteria 8429
632 nmdc:mga0rr50_29_c1 3300050513 Bacteria 106517
633 nmdc:mga0rr50_45120_c1 3300050513 Bacteria 3237
634 nmdc:mga0rr50_48612_c1 3300050513 Bacteria 3137
635 nmdc:mga0rr50_6159_c1 3300050513 Bacteria 7265
636 nmdc:mga0rr50_89153_c1 3300050513 Bacteria 2398
637 nmdc:mga08x19_154_c1 3300050514 Bacteria 56260
638 nmdc:mga08x19_49518_c1 3300050514 Bacteria 2694
639 nmdc:mga08x19_50629_c1 3300050514 Bacteria 2666
640 nmdc:mga08x19_84613_c1 3300050514 Bacteria 2087
641 nmdc:mga08x19_94794_c1 3300050514 Bacteria 1974
642 nmdc:mga0a205_1110_c1 3300050515 Bacteria 22302
643 nmdc:mga0a205_120904_c1 3300050515 Bacteria 2518
644 nmdc:mga0a205_19141_c1 3300050515 Bacteria 6453
645 nmdc:mga0a205_21114_c1 3300050515 Bacteria 6157
646 nmdc:mga0a205_7556_c1 3300050515 Bacteria 5101
647 Ga0495601_0072979 3300053077 Bacteria 2193
648 Ga0495601_0131982 3300053077 Bacteria 1627
649 Ga0495595_0124300 3300053084 Bacteria 1258
650 Ga0495619_0009295 3300053085 Bacteria 6207
651 Ga0495619_0026243 3300053085 Bacteria 3747
652 Ga0495619_0095387 3300053085 Bacteria 2018
653 Ga0500555_000374 3300053103 Bacteria 18992
654 Ga0500592_002391 3300053116 Bacteria 3023
655 Ga0500645_001740 3300053730 Bacteria 10557
656 Ga0501084_0025901 3300054114 Bacteria 4891
657 Ga0501084_0075698 3300054114 Bacteria 2820
658 Ga0501084_0086688 3300054114 Bacteria 2629
659 Ga0501084_0114433 3300054114 Bacteria 2268
660 Ga0590071_000269 3300059421 Bacteria 15136
661 Ga0590071_023055 3300059421 Bacteria 1470
662 Ga0590074_006377 3300059423 Bacteria 1958
663 Ga0590075_000497 3300059424 Bacteria 10655
664 Ga0590075_001810 3300059424 Bacteria 5222
665 Ga0590075_035224 3300059424 Bacteria 1275
666 Ga0590077_000591 3300059426 Bacteria 9967
667 Ga0590077_001411 3300059426 Bacteria 5632
668 Ga0590077_017732 3300059426 Bacteria 1499
669 Ga0501082_0012459 3300060353 Bacteria 7306
670 Ga0501082_0053453 3300060353 Bacteria 3482
671 Ga0501082_0121367 3300060353 Bacteria 2265
672 Ga0530510_0012759 3300061734 Bacteria 5907
673 Ga0530510_0188902 3300061734 Bacteria 1529
674 Ga0065712_10088652
675 JGI24746J21847_1002357
676 JGI24749J21850_1003767
677 Ga0065704_10007534
678 Ga0065712_10173122
679 Ga0065712_10220420
680 Ga0065715_10000380
681 Ga0065715_10003642
682 Ga0065707_10086151
683 Ga0065707_10090345
684 Ga0065707_10110134
685 Ga0065707_10238379
686 Ga0070658_10074096
687 Ga0070658_10219601
688 Ga0070676_10020457
689 Ga0070676_10031331
690 Ga0070676_10053916
691 Ga0070683_100071853
692 Ga0070690_100104917
693 Ga0070670_100003083
694 Ga0070670_100029465
695 Ga0070670_100071756
696 Ga0070670_100098835
697 Ga0070677_10005765
698 Ga0070677_10094836
699 Ga0068869_100045674
700 Ga0068869_100066455
701 Ga0068869_100072769
702 Ga0068869_100079636
703 Ga0070666_10116612
704 Ga0070680_100400000
705 Ga0068868_100022880
706 Ga0068868_100321843
707 Ga0070689_100008690
708 Ga0070689_100156663
709 Ga0070689_100170358
710 Ga0070687_100009424
711 Ga0070687_100023225
712 Ga0070687_100190760
713 Ga0070668_100433747
714 Ga0070669_100000449
715 Ga0070669_100002731
716 Ga0070669_100010650
717 Ga0070669_100043492
718 Ga0070669_100090863
719 Ga0070675_100008093
720 Ga0070675_100018320
721 Ga0070675_100112917
722 Ga0070675_100116672
723 Ga0070675_100126120
724 Ga0070675_100202069
725 Ga0070675_100235749
726 Ga0070671_100013639
727 Ga0070674_100092181
728 Ga0070673_100007888
729 Ga0070673_100008869
730 Ga0070673_100049079
731 Ga0070688_100007684
732 Ga0070688_100188426
733 Ga0070688_100271040
734 Ga0070659_100263278
735 Ga0070659_100303925
736 Ga0070667_100049733
737 Ga0070667_100289850
738 Ga0070709_10088529
739 Ga0070713_100006723
740 Ga0070705_100088241
741 Ga0070700_100010164
742 Ga0070694_100009258
743 Ga0070678_100003249
744 Ga0070678_100029384
745 Ga0070678_100276117
746 Ga0070678_100346439
747 Ga0070662_100002932
748 Ga0070662_100135422
749 Ga0070662_100136198
750 Ga0070662_100137097
751 Ga0070662_100492440
752 Ga0068867_100004667
753 Ga0068867_100039234
754 Ga0068867_100299287
755 Ga0070685_10002042
756 Ga0070685_10004934
757 Ga0070685_10172491
758 Ga0070699_100015643
759 Ga0070679_100065021
760 Ga0070679_100229283
761 Ga0070672_100005408
762 Ga0070672_100045990
763 Ga0070672_100123673
764 Ga0070686_100004533
765 Ga0070686_100039100
766 Ga0070686_100073665
767 Ga0070686_100093015
768 Ga0070695_100001042
769 Ga0070695_100052205
770 Ga0070696_100053533
771 Ga0070693_100012455
772 Ga0070693_100022713
773 Ga0070665_100004309
774 Ga0070665_100037052
775 Ga0070665_100135362
776 Ga0070665_100137793
777 Ga0070665_100451001
778 Ga0070704_100007618
779 Ga0070704_100079537
780 Ga0070664_100024609
781 Ga0070664_100029088
782 Ga0070664_100084616
783 Ga0070664_100138439
784 Ga0070664_100239909
785 Ga0068857_100035909
786 Ga0068857_100458856
787 Ga0068854_100224239
788 Ga0068854_100471993
789 Ga0068859_100045897
790 Ga0068859_100110656
791 Ga0068859_100354305
792 Ga0068864_100002276
793 Ga0068864_100052826
794 Ga0068864_100257221
795 Ga0068864_100517798
796 Ga0068861_100041479
797 Ga0068861_100050937
798 Ga0068861_100096800
799 Ga0068861_100143447
800 Ga0068870_10101756
801 Ga0068863_100016572
802 Ga0068863_100078702
803 Ga0068863_100101266
804 Ga0068858_100026810
805 Ga0068858_100075313
806 Ga0068858_100184520
807 Ga0068860_100016344
808 Ga0068860_100209085
809 Ga0068860_100370857
810 Ga0068862_100023803
811 Ga0068862_100059922
812 Ga0081455_10042127
813 Ga0075368_10032902
814 Ga0075368_10077654
815 Ga0075364_10037029
816 Ga0070715_10098587
817 Ga0075367_10009517
818 Ga0075367_10010764
819 Ga0075367_10058319
820 Ga0097621_100000075
821 Ga0097621_100000846
822 Ga0097621_100014409
823 Ga0097621_100045198
824 Ga0097621_100250727
825 Ga0068871_100000117
826 Ga0068871_100001012
827 Ga0068871_100013025
828 Ga0068871_100044896
829 Ga0075428_100000903
830 Ga0075428_100004820
831 Ga0075428_100011822
832 Ga0075428_100064317
833 Ga0075428_100126018
834 Ga0075428_100165304
835 Ga0075428_100526646
836 Ga0075430_100007806
837 Ga0075430_100065602
838 Ga0075431_100003305
839 Ga0075431_100031863
840 Ga0075431_100055112
841 Ga0075431_100082582
842 Ga0075431_100208891
843 Ga0075433_10002511
844 Ga0075433_10003905
845 Ga0075433_10011221
846 Ga0075433_10223130
847 Ga0075434_100000190
848 Ga0075434_100003159
849 Ga0075434_100007038
850 Ga0075434_100011753
851 Ga0075434_100023809
852 Ga0075434_100051983
853 Ga0075429_100025327
854 Ga0075429_100352768
855 Ga0068865_100158841
856 Ga0068865_100191034
857 Ga0075436_100000303
858 Ga0075436_100013595
859 Ga0075436_100023197
860 Ga0075436_100089207
861 Ga0097620_100045897
862 Ga0097620_100110655
863 Ga0097620_100354301
864 Ga0075435_100000120
865 Ga0075435_100000950
866 Ga0075435_100012767
867 Ga0075435_100046531
868 Ga0075435_100072983
869 Ga0075435_100086732
870 Ga0105240_10361396
871 Ga0111539_10001783
872 Ga0111539_10006238
873 Ga0111539_10010186
874 Ga0111539_10017585
875 Ga0111539_10022067
876 Ga0111539_10040324
877 Ga0111539_10050816
878 Ga0111539_10066018
879 Ga0111539_10413851
880 Ga0105247_10017713
881 Ga0114129_10002451
882 Ga0114129_10025441
883 Ga0114129_10036720
884 Ga0114129_10048292
885 Ga0114129_10094809
886 Ga0114129_10527400
887 Ga0105242_10007270
888 Ga0105242_10020524
889 Ga0105248_10008405
890 Ga0105248_10009323
891 Ga0105248_10021966
892 Ga0105248_10043055
893 Ga0105248_10184943
894 Ga0105237_10270348
895 Ga0105238_10365624
896 Ga0105238_10591563
897 Ga0105249_10011641
898 Ga0105249_10023800
899 Ga0105249_10176038
900 Ga0157371_10330181
901 Ga0157378_10002536
902 Ga0163162_10029897
903 Ga0163162_10049858
904 Ga0163162_10381104
905 Ga0163162_10453240
906 Ga0163162_10705550
907 Ga0163163_10339392
908 Ga0163163_10352532
909 Ga0157380_10001869
910 Ga0157380_10002114
911 Ga0157380_10017845
912 Ga0157380_10099202
913 Ga0157377_10006256
914 Ga0157379_10034236
915 Ga0157379_10037658
916 Ga0157376_10039756
917 Ga0157376_10061652
918 Ga0157376_10153828
919 Ga0163161_10114426
920 Ga0207666_1009324
921 Ga0207697_10007053
922 Ga0207682_10002886
923 Ga0207682_10003879
924 Ga0207682_10026503
925 Ga0207682_10060959
926 Ga0207710_10062961
927 Ga0207688_10000058
928 Ga0207645_10000244
929 Ga0207645_10003113
930 Ga0207645_10006245
931 Ga0207643_10006597
932 Ga0207705_10269093
933 Ga0207662_10001736
934 Ga0207662_10006976
935 Ga0207662_10025805
936 Ga0207657_10221351
937 Ga0207649_10049803
938 Ga0207652_10030909
939 Ga0207646_10172520
940 Ga0207681_10006665
941 Ga0207681_10012462
942 Ga0207681_10026905
943 Ga0207650_10001935
944 Ga0207650_10013957
945 Ga0207650_10017996
946 Ga0207659_10001233
947 Ga0207659_10078681
948 Ga0207659_10176775
949 Ga0207659_10343602
950 Ga0207687_10043197
951 Ga0207687_10073924
952 Ga0207700_10014167
953 Ga0207644_10032811
954 Ga0207644_10105323
955 Ga0207644_10255507
956 Ga0207690_10048363
957 Ga0207690_10157722
958 Ga0207690_10218226
959 Ga0207690_10438349
960 Ga0207706_10019108
961 Ga0207706_10028121
962 Ga0207706_10051035
963 Ga0207706_10140641
964 Ga0207706_10171217
965 Ga0207706_10273342
966 Ga0207706_10290017
967 Ga0207686_10086967
968 Ga0207709_10141740
969 Ga0207670_10017396
970 Ga0207670_10346786
971 Ga0207669_10005447
972 Ga0207669_10054976
973 Ga0207669_10069585
974 Ga0207669_10104410
975 Ga0207704_10003992
976 Ga0207704_10009921
977 Ga0207691_10013787
978 Ga0207691_10018297
979 Ga0207691_10030781
980 Ga0207691_10042490
981 Ga0207691_10058044
982 Ga0207691_10071478
983 Ga0207691_10143733
984 Ga0207711_10003819
985 Ga0207711_10060234
986 Ga0207711_10080023
987 Ga0207711_10125130
988 Ga0207711_10130785
989 Ga0207689_10000917
990 Ga0207689_10028841
991 Ga0207689_10045136
992 Ga0207689_10105217
993 Ga0207679_10006742
994 Ga0207651_10012662
995 Ga0207651_10043889
996 Ga0207651_10075149
997 Ga0207651_10155692
998 Ga0207712_10005428
999 Ga0207712_10090125
1000 Ga0207640_10257579
1001 Ga0207658_10129453
1002 Ga0207677_10046464
1003 Ga0207703_10080702
1004 Ga0207703_10094445
1005 Ga0207678_10051823
1006 Ga0207708_10001542
1007 Ga0207708_10005533
1008 Ga0207708_10009769
1009 Ga0207708_10029019
1010 Ga0207708_10103709
1011 Ga0207708_10191727
1012 Ga0207641_10008812
1013 Ga0207641_10058317
1014 Ga0207641_10331751
1015 Ga0207648_10001413
1016 Ga0207648_10005095
1017 Ga0207648_10017234
1018 Ga0207648_10024375
1019 Ga0207648_10044582
1020 Ga0207648_10156242
1021 Ga0207676_10021466
1022 Ga0207676_10191966
1023 Ga0207674_10009058
1024 Ga0207674_10026476
1025 Ga0207674_10304409
1026 Ga0207674_10354307
1027 Ga0207675_100011274
1028 Ga0207675_100039131
1029 Ga0207675_100126756
1030 Ga0207675_100400655
1031 Ga0207683_10004379
1032 Ga0207683_10021032
1033 Ga0207683_10022282
1034 Ga0207683_10035150
1035 Ga0209971_1012570
1036 Ga0207428_10000910
1037 Ga0207428_10001154
1038 Ga0207428_10001542
1039 Ga0207428_10001583
1040 Ga0207428_10010763
1041 Ga0207428_10018225
1042 Ga0207428_10041825
1043 Ga0207428_10049618
1044 Ga0268266_10013401
1045 Ga0268266_10026683
1046 Ga0268266_10082151
1047 Ga0268266_10110648
1048 Ga0268265_10035677
1049 Ga0268265_10094441
1050 Ga0268265_10175833
1051 Ga0268265_10192183
1052 Ga0268265_10254106
1053 Ga0268264_10026058
1054 Ga0268264_10091329
1055 Ga0268264_10119906
1056 Ga0268264_10204050
1057 Ga0268264_10478077
1058 Ga0265331_10085289
1059 Ga0307408_100160793
1060 Ga0307408_100196897
1061 Ga0265314_10064995
1062 Ga0307413_10019880
1063 Ga0307413_10028596
1064 Ga0307413_10145806
1065 Ga0307413_10215020
1066 Ga0307410_10063340
1067 Ga0307410_10116414
1068 Ga0307406_10007353
1069 Ga0307406_10061721
1070 Ga0307406_10215045
1071 Ga0307407_10141976
1072 Ga0307407_10162799
1073 Ga0307407_10247097
1074 Ga0307412_10015722
1075 Ga0307412_10067976
1076 Ga0307409_100021527
1077 Ga0307409_100032883
1078 Ga0307409_100094664
1079 Ga0307409_100254215
1080 Ga0307416_100042993
1081 Ga0307416_100072092
1082 Ga0307416_100099091
1083 Ga0307416_100125095
1084 Ga0307416_100295609
1085 Ga0307414_10276486
1086 Ga0307411_10001318
1087 Ga0307411_10140750
1088 Ga0307411_10153794
1089 Ga0307411_10299263
1090 Ga0307415_100115426
1091 Ga0307415_100139158
1092 Ga0373941_0055122
1093 Ga0373953_0007099
1094 Ga0373954_0114033
1095 Ga0373956_0009271
1096 Ga0373957_0012452
1097 Ga0373957_0040156
1098 Ga0373955_0063303
1099 Ga0373955_0105335
1100 Ga0373924_0006993
1101 Ga0373931_0095618
1102 Ga0373935_0315058
1103 Ga0373933_0007742
1104 Ga0373933_0205301
1105 Ga0373947_0254527
1106 Ga0373937_0015524
1107 Ga0373937_0016963
1108 Ga0373937_0073595
1109 Ga0373937_0076002
1110 Ga0373937_0078503
1111 Ga0373925_0003025
1112 Ga0436365_1209205
1113 Ga0439439_0041731
1114 Ga0439431_0013343
1115 Ga0439462_0007686
1116 Ga0439462_0025983
1117 Ga0450894_010115
1118 Ga0439446_0026952
1119 Ga0439434_0009000
1120 Ga0439434_0025962
1121 Ga0439435_0026814
1122 Ga0439435_0029386
1123 Ga0439460_0021193
1124 Ga0451577_0232176
1125 Ga0439440_0016713
1126 Ga0451576_0177712
1127 Ga0451576_0180507
1128 Ga0451576_0189979
1129 Ga0495629_0054532
1130 Ga0495629_0074363
1131 Ga0495629_0186724
1132 Ga0495582_0078109
1133 Ga0495664_0064310
1134 Ga0495628_0047158
1135 Ga0495630_0094127
1136 Ga0495621_0035171
1137 Ga0495621_0040136
1138 Ga0495645_0000776
1139 Ga0495645_0037976
1140 Ga0495633_0083321
1141 Ga0495656_0040387
1142 Ga0495635_0080895
1143 Ga0495658_0108419
1144 Ga0495658_0166255
1145 Ga0495613_0003856
1146 Ga0495613_0096249
1147 Ga0495604_0025364
1148 Ga0495604_0232485
1149 Ga0495675_0176326
1150 Ga0495675_0250766
1151 Ga0495684_0000131
1152 Ga0496100_0007715
1153 Ga0496100_0166992
1154 Ga0496101_0006042
1155 Ga0496101_0030870
1156 Ga0496101_0174435
1157 Ga0496102_0142129
1158 Ga0496102_0223376
1159 Ga0496103_0072071
1160 Ga0496104_0002322
1161 Ga0496104_0005698
1162 Ga0496104_0092905
1163 Ga0496106_0073241
1164 Ga0496107_0154079
1165 Ga0496108_0002813
1166 Ga0496108_0015563
1167 Ga0496109_0002172
1168 Ga0496109_0031026
1169 Ga0496109_0086305
1170 Ga0496109_0174304
1171 Ga0496109_0364366
1172 Ga0496109_0401826
1173 Ga0496110_0007883
1174 Ga0496111_0029811
1175 Ga0496112_0000823
1176 Ga0496112_0021470
1177 Ga0496112_0024629
1178 Ga0496112_0055339
1179 Ga0496112_0219182
1180 Ga0496112_0235560
1181 Ga0496113_0003704
1182 Ga0496114_0000662
1183 Ga0496114_0096756
1184 Ga0496114_0182483
1185 Ga0496115_0065096
1186 Ga0501031_0217467
1187 Ga0501031_0265217
1188 Ga0501032_0004225
1189 Ga0501034_0001801
1190 Ga0501034_0062026
1191 Ga0501034_0103428
1192 Ga0501034_0168375
1193 Ga0501036_0024294
1194 Ga0501036_0046612
1195 Ga0501036_0195373
1196 Ga0501036_0287336
1197 Ga0501037_0098994
1198 Ga0501038_0005448
1199 Ga0501038_0041156
1200 Ga0501038_0121936
1201 Ga0501038_0227007
1202 Ga0501039_0003696
1203 Ga0501039_0028592
1204 Ga0501039_0114147
1205 Ga0501041_0038171
1206 Ga0501041_0040358
1207 Ga0501042_0038641
1208 Ga0501042_0141051
1209 Ga0501043_0009977
1210 Ga0501043_0165743
1211 Ga0501046_0001889
1212 Ga0501046_0052542
1213 Ga0501046_0084814
1214 Ga0501047_0003158
1215 Ga0501047_0003468
1216 Ga0501047_0435833
1217 Ga0501048_0016812
1218 Ga0501048_0041735
1219 Ga0501067_0021001
1220 Ga0501067_0029562
1221 Ga0501067_0081934
1222 Ga0501067_0090769
1223 Ga0501068_0011003
1224 Ga0501071_0145720
1225 Ga0501071_0192995
1226 Ga0501071_0239458
1227 Ga0501072_0045094
1228 Ga0501072_0075548
1229 Ga0501072_0079423
1230 Ga0501072_0098447
1231 Ga0501072_0214231
1232 Ga0501073_0001811
1233 Ga0501073_0017642
1234 Ga0501073_0019132
1235 Ga0501074_0129938
1236 Ga0501075_0027868
1237 Ga0501075_0039490
1238 Ga0501075_0049391
1239 Ga0501076_0065090
1240 Ga0501076_0187745
1241 Ga0501077_0029563
1242 Ga0501077_0220587
1243 Ga0501077_0224969
1244 Ga0501079_0009386
1245 Ga0501079_0442232
1246 Ga0501080_0001517
1247 Ga0501080_0041051
1248 Ga0501080_0105157
1249 Ga0501080_0143647
1250 Ga0501081_0042066
1251 Ga0501081_0100816
1252 Ga0501081_0363127
1253 Ga0501083_0040570
1254 Ga0501083_0059884
1255 Ga0501273_003219
1256 Ga0501044_0004234
1257 Ga0501045_0003698
1258 Ga0501045_0224071
1259 nmdc:mga0k408_56219_c1
1260 nmdc:mga0k408_6070_c1
1261 nmdc:mga06z11_36503_c1
1262 nmdc:mga06z11_64613_c1
1263 nmdc:mga06z11_8357_c1
1264 nmdc:mga04h51_31349_c1
1265 nmdc:mga05p37_113765_c1
1266 nmdc:mga05p37_250440_c1
1267 nmdc:mga05p37_294080_c1
1268 nmdc:mga05p37_32478_c1
1269 nmdc:mga05p37_33054_c1
1270 nmdc:mga05p37_53283_c1
1271 nmdc:mga05p37_53866_c1
1272 nmdc:mga05p37_587292_c1
1273 nmdc:mga05p37_64069_c1
1274 nmdc:mga09592_11687_c1
1275 nmdc:mga09592_2150_c1
1276 nmdc:mga0qj67_110718_c1
1277 nmdc:mga0qj67_22134_c1
1278 nmdc:mga0qj67_69844_c1
1279 nmdc:mga06r32_107056_c1
1280 nmdc:mga06r32_1269_c1
1281 nmdc:mga06r32_14407_c1
1282 nmdc:mga06r32_363910_c1
1283 nmdc:mga06r32_369103_c1
1284 nmdc:mga06r32_46245_c1
1285 nmdc:mga06r32_53859_c1
1286 nmdc:mga06r32_560470_c1
1287 nmdc:mga06r32_77966_c1
1288 nmdc:mga08y16_156878_c1
1289 nmdc:mga08y16_1780_c1
1290 nmdc:mga08y16_18328_c1
1291 nmdc:mga08y16_200708_c1
1292 nmdc:mga08y16_204285_c1
1293 nmdc:mga08y16_2527_c1
1294 nmdc:mga08y16_3640_c1
1295 nmdc:mga08y16_56614_c1
1296 nmdc:mga08y16_596367_c1
1297 nmdc:mga0n895_11208_c1
1298 nmdc:mga0n895_126048_c1
1299 nmdc:mga0n895_158549_c1
1300 nmdc:mga0n895_260985_c1
1301 nmdc:mga0n895_26191_c1
1302 nmdc:mga0n895_36_c1
1303 nmdc:mga0n895_8197_c1
1304 nmdc:mga0n895_9736_c1
1305 nmdc:mga0rr50_29_c1
1306 nmdc:mga0rr50_45120_c1
1307 nmdc:mga0rr50_48612_c1
1308 nmdc:mga0rr50_6159_c1
1309 nmdc:mga0rr50_89153_c1
1310 nmdc:mga08x19_154_c1
1311 nmdc:mga08x19_49518_c1
1312 nmdc:mga08x19_50629_c1
1313 nmdc:mga08x19_84613_c1
1314 nmdc:mga08x19_94794_c1
1315 nmdc:mga0a205_1110_c1
1316 nmdc:mga0a205_120904_c1
1317 nmdc:mga0a205_19141_c1
1318 nmdc:mga0a205_21114_c1
1319 nmdc:mga0a205_7556_c1
1320 Ga0495601_0072979
1321 Ga0495601_0131982
1322 Ga0495595_0124300
1323 Ga0495619_0009295
1324 Ga0495619_0026243
1325 Ga0495619_0095387
1326 Ga0500555_000374
1327 Ga0500592_002391
1328 Ga0500645_001740
1329 Ga0501084_0025901
1330 Ga0501084_0075698
1331 Ga0501084_0086688
1332 Ga0501084_0114433
1333 Ga0590071_000269
1334 Ga0590071_023055
1335 Ga0590074_006377
1336 Ga0590075_000497
1337 Ga0590075_001810
1338 Ga0590075_035224
1339 Ga0590077_000591
1340 Ga0590077_001411
1341 Ga0590077_017732
1342 Ga0501082_0012459
1343 Ga0501082_0053453
1344 Ga0501082_0121367
1345 Ga0530510_0012759
1346 Ga0530510_0188902

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13304

AAA_21

AAA domain, putative AbiEii toxin, Type IV TA system

60

167

0.88

PF00005

ABC_tran

ABC transporter

15

134

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ch0-assembly1.cif.gz_E the overall structure of the mlafedb complex in atp-bound eqclose conformation (mutation of e170q on mlaf) 0.9108 3 226
7ahd-assembly1.cif.gz_D opua (e190q) occluded 0.9008 7 220
7z16-assembly1.cif.gz_J e. coli c-p lyase bound to phnk/phnl dual abc dimer with amppnp and phnk e171q mutation 0.8928 5 225
7cha-assembly1.cif.gz_J cryo-em structure of p.aeruginosa mlafebd with amppnp 0.8925 5 226
6xgz-assembly4.cif.gz_G crystal structure of e. coli mlafb abc transport subunits in the monomeric state 0.8849 2 228
ID Description Score Start End Superfamily
af_A1ZBS3_470_698_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9042 5 225 3.40.50.300
af_P37624_8_264_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9035 3 225 3.40.50.300
af_A4HV32_726_961_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9035 3 225 3.40.50.300
af_P36879_1_236_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9021 4 224 3.40.50.300
af_A0A0R0KIK5_1390_1640_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9004 2 225 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A4D4MZJ6-F1-model_v4 ABC transporter domain-containing protein 0.919 7 225 GO:0005524
GO:0016887
AF-A0A6I3RIS9-F1-model_v4 deleted 0.9163 2 220
AF-A0A7M3X126-F1-model_v4 ABC transporter ATP-binding protein 0.9083 1 225 GO:0005524
GO:0016887
AF-A0A1C5EWI0-F1-model_v4 Osmoprotectant transport system ATP-binding protein 0.9077 7 226 GO:0005524
GO:0016020
GO:0016887
GO:0031460
AF-A0A7Z0A8D1-F1-model_v4 deleted 0.9039 3 226

Map