F474167

General Info

Members Datasets Scaffolds Average Seq Length
671 328 1342 60

Family's Representative Sequence

Representative Sequence 3300031235|Ga0265330_10173653|Ga0265330_101736532
Length 70
Sequence MQATQSMQNLSPRHVKTEEALWLGVVSGWYSTKVSGTFVSGPHDSEADCLSRIAEINPPPAKRIRVAPAA

Samples

Sample ID Description Type Environment
1 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
62 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
63 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
67 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
72 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
94 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
99 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
152 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
153 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
154 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
155 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
156 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
157 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
158 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
159 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
160 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
161 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
162 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
163 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
164 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
165 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
166 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
167 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
168 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
169 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
170 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
171 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
172 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
173 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
174 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
175 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
176 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
177 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
178 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
179 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
180 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
181 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
182 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
183 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
184 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
185 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
186 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
187 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
188 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
189 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
190 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
191 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
192 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
193 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
194 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
195 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
196 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
197 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
198 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
199 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
200 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
201 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
202 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
203 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
204 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
205 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
206 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
207 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
208 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
209 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
210 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
211 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
212 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
213 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
214 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
215 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
216 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
217 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
218 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
219 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
220 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
221 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
222 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
223 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
224 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
225 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
226 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
227 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
228 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
229 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
230 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
231 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
232 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
233 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
234 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
235 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
236 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
237 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
238 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
239 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
240 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
241 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
242 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
243 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
244 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
245 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
246 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
247 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
248 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
249 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
250 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
251 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
252 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
253 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
254 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
255 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
256 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
257 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
258 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
259 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
260 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
261 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
262 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
263 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
264 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
265 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
266 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
267 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
268 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
269 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
270 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
271 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
272 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
273 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
274 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
275 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
276 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
277 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
278 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
279 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
280 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
281 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
282 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
283 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
284 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
285 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
286 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
287 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
288 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
289 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
290 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
291 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
292 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
293 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
294 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
295 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
296 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
297 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
298 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
299 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
300 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
301 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
302 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
303 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
304 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
305 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
306 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
307 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
308 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
309 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
310 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
311 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
312 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
313 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
314 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
315 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
316 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
317 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
318 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
319 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
320 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
321 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
322 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
323 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
324 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
325 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
326 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
327 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
328 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.55
Metatranscriptomes 0.45
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.49
Nodule 0
Rhizoplane 7.15
Rhizosphere 77.79
Stem 0
Stem Tuber 0
Unclassified 3.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265330_10173653 3300031235 Bacteria 913
2 JGI24736J21556_1031737 3300001904 Bacteria 816
3 JGI24739J22299_10000994 3300001989 Bacteria 10559
4 JGI24739J22299_10020547 3300001989 Bacteria 2359
5 JGI24737J22298_10002808 3300001990 Bacteria 6167
6 JGI24737J22298_10009616 3300001990 Bacteria 3207
7 JGI24735J21928_10006210 3300002067 Bacteria 3946
8 JGI25153J46596_10059817 3300003215 Bacteria 1041
9 Ga0065715_10120325 3300005293 Bacteria 2261
10 Ga0070658_10306872 3300005327 Bacteria 1354
11 Ga0070683_100050223 3300005329 Bacteria 3860
12 Ga0070683_100783139 3300005329 Bacteria 914
13 Ga0070683_102313892 3300005329 Unclassified 515
14 Ga0070677_10507936 3300005333 Bacteria 654
15 Ga0068869_100636811 3300005334 Bacteria 904
16 Ga0068869_100966370 3300005334 Bacteria 740
17 Ga0070680_100361631 3300005336 Bacteria 1234
18 Ga0070680_100906893 3300005336 Bacteria 760
19 Ga0070682_100865885 3300005337 Bacteria 740
20 Ga0068868_100897588 3300005338 Bacteria 805
21 Ga0068868_101109224 3300005338 Bacteria 728
22 Ga0068868_101963200 3300005338 Bacteria 555
23 Ga0070660_100003722 3300005339 Bacteria 10534
24 Ga0070660_100256463 3300005339 Bacteria 1427
25 Ga0070660_101547230 3300005339 Bacteria 564
26 Ga0070687_101187946 3300005343 Bacteria 562
27 Ga0070661_100271222 3300005344 Bacteria 1314
28 Ga0070661_100315525 3300005344 Bacteria 1220
29 Ga0070668_101119995 3300005347 Bacteria 711
30 Ga0070668_101130424 3300005347 Bacteria 708
31 Ga0070668_101829452 3300005347 Bacteria 559
32 Ga0070675_100602962 3300005354 Bacteria 996
33 Ga0070674_101619814 3300005356 Bacteria 584
34 Ga0070673_101832984 3300005364 Bacteria 575
35 Ga0070659_100233334 3300005366 Bacteria 1521
36 Ga0070659_100258064 3300005366 Bacteria 1446
37 Ga0070659_101784772 3300005366 Bacteria 551
38 Ga0070667_100317816 3300005367 Bacteria 1405
39 Ga0070709_10003383 3300005434 Bacteria 8567
40 Ga0070709_10097254 3300005434 Bacteria 1954
41 Ga0070709_10353795 3300005434 Bacteria 1086
42 Ga0070714_100507205 3300005435 Bacteria 1151
43 Ga0070714_100636630 3300005435 Bacteria 1026
44 Ga0070714_101925400 3300005435 Bacteria 577
45 Ga0070713_100002594 3300005436 Bacteria 11804
46 Ga0070713_100111204 3300005436 Bacteria 2389
47 Ga0070713_100251769 3300005436 Bacteria 1611
48 Ga0070710_10005449 3300005437 Bacteria 6046
49 Ga0070710_10043834 3300005437 Bacteria 2479
50 Ga0070711_100023046 3300005439 Bacteria 4044
51 Ga0070711_100025335 3300005439 Bacteria 3881
52 Ga0070711_100289792 3300005439 Bacteria 1298
53 Ga0070711_101446452 3300005439 Bacteria 599
54 Ga0070711_101569920 3300005439 Unclassified 575
55 Ga0070663_100017501 3300005455 Bacteria 4679
56 Ga0070663_101074072 3300005455 Bacteria 703
57 Ga0070663_101365250 3300005455 Unclassified 627
58 Ga0070663_101588143 3300005455 Bacteria 583
59 Ga0070678_100079467 3300005456 Bacteria 2481
60 Ga0070662_100075193 3300005457 Bacteria 2501
61 Ga0070681_10010223 3300005458 Bacteria 9257
62 Ga0070681_10057793 3300005458 Bacteria 3859
63 Ga0070681_10469730 3300005458 Bacteria 1170
64 Ga0068867_100523272 3300005459 Bacteria 1023
65 Ga0070706_100330359 3300005467 Bacteria 1422
66 Ga0070706_100612872 3300005467 Bacteria 1011
67 Ga0070707_100106096 3300005468 Bacteria 2725
68 Ga0070698_100842729 3300005471 Bacteria 861
69 Ga0070699_101641184 3300005518 Bacteria 589
70 Ga0070679_100004045 3300005530 Bacteria 13508
71 Ga0070679_101021125 3300005530 Bacteria 771
72 Ga0070684_100212619 3300005535 Bacteria 1763
73 Ga0070684_100218336 3300005535 Bacteria 1739
74 Ga0070684_100684088 3300005535 Bacteria 956
75 Ga0070684_101301882 3300005535 Bacteria 684
76 Ga0070697_100008732 3300005536 Bacteria 7911
77 Ga0070697_100424487 3300005536 Bacteria 1156
78 Ga0070697_101111451 3300005536 Bacteria 703
79 Ga0068853_100011965 3300005539 Bacteria 7057
80 Ga0068853_100044352 3300005539 Bacteria 3807
81 Ga0068853_100058719 3300005539 Bacteria 3321
82 Ga0068853_100078277 3300005539 Bacteria 2889
83 Ga0068853_100106594 3300005539 Bacteria 2484
84 Ga0068853_102021580 3300005539 Bacteria 559
85 Ga0070672_100025342 3300005543 Bacteria 4397
86 Ga0070672_100448674 3300005543 Bacteria 1111
87 Ga0070686_100094482 3300005544 Bacteria 2007
88 Ga0070693_100349127 3300005547 Bacteria 1012
89 Ga0070693_100652772 3300005547 Bacteria 765
90 Ga0070693_100689407 3300005547 Bacteria 747
91 Ga0070665_100830823 3300005548 Bacteria 937
92 Ga0070665_101452953 3300005548 Bacteria 694
93 Ga0070665_101880714 3300005548 Bacteria 604
94 Ga0068855_100020255 3300005563 Bacteria 7984
95 Ga0068855_100020651 3300005563 Bacteria 7898
96 Ga0068855_100024639 3300005563 Bacteria 7197
97 Ga0070664_100199805 3300005564 Bacteria 1784
98 Ga0070664_100392479 3300005564 Bacteria 1268
99 Ga0068857_100010911 3300005577 Bacteria 7909
100 Ga0068857_100073096 3300005577 Bacteria 3055
101 Ga0068857_100185123 3300005577 Bacteria 1896
102 Ga0068854_100057575 3300005578 Bacteria 2804
103 Ga0068854_100206793 3300005578 Bacteria 1546
104 Ga0068854_102057572 3300005578 Bacteria 527
105 Ga0068856_100013826 3300005614 Bacteria 7803
106 Ga0070702_100370414 3300005615 Bacteria 1015
107 Ga0068852_100275230 3300005616 Bacteria 1621
108 Ga0068852_100674898 3300005616 Bacteria 1042
109 Ga0068852_101989409 3300005616 Unclassified 603
110 Ga0068852_102210537 3300005616 Bacteria 572
111 Ga0068859_100298992 3300005617 Bacteria 1703
112 Ga0068859_102089109 3300005617 Unclassified 625
113 Ga0068866_10389442 3300005718 Bacteria 896
114 Ga0068851_10242155 3300005834 Bacteria 1020
115 Ga0068851_10434412 3300005834 Bacteria 777
116 Ga0068851_11044693 3300005834 Bacteria 517
117 Ga0068863_100835384 3300005841 Bacteria 919
118 Ga0068863_100902150 3300005841 Bacteria 884
119 Ga0068858_100177733 3300005842 Bacteria 2009
120 Ga0068858_100226200 3300005842 Bacteria 1773
121 Ga0068858_101093175 3300005842 Unclassified 783
122 Ga0068860_100993774 3300005843 Bacteria 857
123 Ga0068860_101243427 3300005843 Bacteria 765
124 Ga0081455_10035923 3300005937 Bacteria 4419
125 Ga0070717_10067381 3300006028 Bacteria 2978
126 Ga0070717_10179047 3300006028 Bacteria 1847
127 Ga0070717_10392678 3300006028 Bacteria 1245
128 Ga0070717_11596520 3300006028 Bacteria 591
129 Ga0075365_10138058 3300006038 Bacteria 1691
130 Ga0075365_10400926 3300006038 Bacteria 968
131 Ga0075365_11322186 3300006038 Bacteria 506
132 Ga0075364_10183994 3300006051 Bacteria 1414
133 Ga0070715_10003754 3300006163 Bacteria 4892
134 Ga0070715_10094890 3300006163 Bacteria 1380
135 Ga0070716_100055242 3300006173 Bacteria 2271
136 Ga0070716_100117844 3300006173 Bacteria 1657
137 Ga0070716_100498210 3300006173 Bacteria 898
138 Ga0070716_101024157 3300006173 Bacteria 654
139 Ga0070712_100009607 3300006175 Bacteria 6098
140 Ga0070712_100039813 3300006175 Bacteria 3218
141 Ga0070712_100405534 3300006175 Bacteria 1127
142 Ga0075367_10206761 3300006178 Bacteria 1227
143 Ga0075367_10268677 3300006178 Unclassified 1071
144 Ga0075369_10654701 3300006186 Bacteria 504
145 Ga0097621_100225663 3300006237 Bacteria 1634
146 Ga0097621_100815406 3300006237 Bacteria 865
147 Ga0097621_102323818 3300006237 Bacteria 513
148 Ga0097621_102335592 3300006237 Bacteria 512
149 Ga0068865_100338136 3300006881 Bacteria 1216
150 Ga0097620_100298996 3300006931 Bacteria 1703
151 Ga0097620_102089854 3300006931 Unclassified 625
152 Ga0099794_10585178 3300007265 Bacteria 591
153 Ga0099794_10671529 3300007265 Unclassified 551
154 Ga0099794_10726870 3300007265 Bacteria 529
155 Ga0099794_10730020 3300007265 Bacteria 528
156 Ga0099795_10021022 3300007788 Bacteria 2135
157 Ga0099795_10027813 3300007788 Bacteria 1916
158 Ga0099795_10148003 3300007788 Bacteria 960
159 Ga0099795_10654860 3300007788 Bacteria 503
160 Ga0105240_10031140 3300009093 Bacteria 6922
161 Ga0105240_10035863 3300009093 Bacteria 6387
162 Ga0105240_10197718 3300009093 Bacteria 2358
163 Ga0105240_10398156 3300009093 Bacteria 1551
164 Ga0105240_10402848 3300009093 Bacteria 1540
165 Ga0105240_10523887 3300009093 Bacteria 1315
166 Ga0105247_10158870 3300009101 Bacteria 1495
167 Ga0105247_10287949 3300009101 Bacteria 1135
168 Ga0105247_10448835 3300009101 Bacteria 929
169 Ga0105247_11862777 3300009101 Bacteria 502
170 Ga0105243_10370078 3300009148 Bacteria 1322
171 Ga0105243_11257933 3300009148 Bacteria 755
172 Ga0105241_10055041 3300009174 Bacteria 3047
173 Ga0105241_10200352 3300009174 Bacteria 1667
174 Ga0105241_11454213 3300009174 Unclassified 658
175 Ga0105241_11601032 3300009174 Bacteria 630
176 Ga0105242_10630021 3300009176 Bacteria 1040
177 Ga0105248_10025081 3300009177 Bacteria 6629
178 Ga0105248_10305891 3300009177 Bacteria 1790
179 Ga0105248_12988661 3300009177 Bacteria 539
180 Ga0105237_10009459 3300009545 Bacteria 10438
181 Ga0105237_10009470 3300009545 Bacteria 10433
182 Ga0105237_10123402 3300009545 Bacteria 2584
183 Ga0105237_10255007 3300009545 Bacteria 1756
184 Ga0105237_10275301 3300009545 Bacteria 1686
185 Ga0105237_10758847 3300009545 Bacteria 977
186 Ga0105237_11182669 3300009545 Bacteria 771
187 Ga0105237_11723665 3300009545 Unclassified 634
188 Ga0105238_10009011 3300009551 Bacteria 9983
189 Ga0105238_10017548 3300009551 Bacteria 7278
190 Ga0105238_10156359 3300009551 Bacteria 2255
191 Ga0105238_10390752 3300009551 Bacteria 1383
192 Ga0105249_10219056 3300009553 Bacteria 1872
193 Ga0105249_10251662 3300009553 Bacteria 1752
194 Ga0099796_10075009 3300010159 Bacteria 1229
195 Ga0099796_10160526 3300010159 Bacteria 891
196 Ga0099796_10308289 3300010159 Bacteria 672
197 Ga0105239_10015132 3300010375 Bacteria 8551
198 Ga0105239_10027064 3300010375 Bacteria 6313
199 Ga0105239_10149385 3300010375 Bacteria 2607
200 Ga0105239_10253658 3300010375 Bacteria 1976
201 Ga0105239_10464963 3300010375 Bacteria 1436
202 Ga0105239_11447518 3300010375 Bacteria 793
203 Ga0105239_12527561 3300010375 Bacteria 599
204 Ga0105246_10331686 3300011119 Bacteria 1240
205 Ga0105246_10488858 3300011119 Bacteria 1043
206 Ga0105246_10805062 3300011119 Bacteria 834
207 Ga0105246_12329422 3300011119 Bacteria 524
208 Ga0157370_10033076 3300013104 Bacteria 5042
209 Ga0157369_10020222 3300013105 Bacteria 7443
210 Ga0157369_12204306 3300013105 Bacteria 559
211 Ga0157374_10460966 3300013296 Bacteria 1273
212 Ga0157374_11793989 3300013296 Bacteria 639
213 Ga0163162_10484505 3300013306 Bacteria 1368
214 Ga0157372_10166903 3300013307 Bacteria 2546
215 Ga0157375_12882046 3300013308 Bacteria 575
216 Ga0163163_10963761 3300014325 Unclassified 916
217 Ga0163163_11128721 3300014325 Bacteria 847
218 Ga0163163_11673690 3300014325 Unclassified 697
219 Ga0163163_12214358 3300014325 Unclassified 609
220 Ga0157380_13161504 3300014326 Bacteria 526
221 Ga0182008_10110458 3300014497 Bacteria 1362
222 Ga0157377_10281129 3300014745 Bacteria 1091
223 Ga0157379_10209148 3300014968 Bacteria 1766
224 Ga0157379_10939541 3300014968 Bacteria 822
225 Ga0157376_10319065 3300014969 Bacteria 1477
226 Ga0157376_12611199 3300014969 Bacteria 545
227 Ga0163161_10095370 3300017792 Bacteria 2207
228 Ga0163161_11457037 3300017792 Bacteria 600
229 Ga0209758_1004067 3300025297 Bacteria 12592
230 Ga0207697_10007283 3300025315 Bacteria 4942
231 Ga0207656_10083290 3300025321 Bacteria 1441
232 Ga0207656_10216650 3300025321 Bacteria 929
233 Ga0207692_10032424 3300025898 Bacteria 2511
234 Ga0207692_10129017 3300025898 Bacteria 1425
235 Ga0207710_10473186 3300025900 Unclassified 648
236 Ga0207710_10549819 3300025900 Bacteria 601
237 Ga0207688_10149914 3300025901 Bacteria 1377
238 Ga0207647_10006000 3300025904 Bacteria 8850
239 Ga0207647_10022741 3300025904 Bacteria 4160
240 Ga0207647_10156001 3300025904 Bacteria 1333
241 Ga0207647_10344404 3300025904 Bacteria 844
242 Ga0207685_10027964 3300025905 Bacteria 1980
243 Ga0207699_10018080 3300025906 Bacteria 3728
244 Ga0207699_10030363 3300025906 Bacteria 3023
245 Ga0207699_10172022 3300025906 Bacteria 1450
246 Ga0207699_10713003 3300025906 Unclassified 735
247 Ga0207705_10295032 3300025909 Bacteria 1243
248 Ga0207684_10568814 3300025910 Bacteria 969
249 Ga0207654_10876709 3300025911 Bacteria 650
250 Ga0207707_10005343 3300025912 Bacteria 11225
251 Ga0207707_10051455 3300025912 Bacteria 3587
252 Ga0207707_10088161 3300025912 Bacteria 2710
253 Ga0207695_10047109 3300025913 Bacteria 4565
254 Ga0207695_10096550 3300025913 Bacteria 2957
255 Ga0207695_10223701 3300025913 Bacteria 1789
256 Ga0207695_10252428 3300025913 Bacteria 1663
257 Ga0207695_10299191 3300025913 Bacteria 1500
258 Ga0207695_10475279 3300025913 Bacteria 1132
259 Ga0207695_10883556 3300025913 Bacteria 773
260 Ga0207671_10084211 3300025914 Bacteria 2388
261 Ga0207671_10126647 3300025914 Bacteria 1957
262 Ga0207671_10723876 3300025914 Bacteria 791
263 Ga0207671_10776972 3300025914 Bacteria 760
264 Ga0207671_11437910 3300025914 Unclassified 534
265 Ga0207693_10015799 3300025915 Bacteria 6048
266 Ga0207693_10184408 3300025915 Bacteria 1643
267 Ga0207693_10233469 3300025915 Bacteria 1444
268 Ga0207663_10055078 3300025916 Bacteria 2494
269 Ga0207663_10212756 3300025916 Bacteria 1402
270 Ga0207663_10300981 3300025916 Bacteria 1198
271 Ga0207663_10349887 3300025916 Bacteria 1118
272 Ga0207660_10018171 3300025917 Bacteria 4682
273 Ga0207660_10053074 3300025917 Bacteria 2888
274 Ga0207662_10941031 3300025918 Bacteria 612
275 Ga0207657_10006315 3300025919 Bacteria 12312
276 Ga0207657_11238234 3300025919 Bacteria 566
277 Ga0207649_10125903 3300025920 Bacteria 1734
278 Ga0207649_11688191 3300025920 Bacteria 501
279 Ga0207652_10116431 3300025921 Bacteria 2374
280 Ga0207652_10145273 3300025921 Bacteria 2122
281 Ga0207652_10857866 3300025921 Bacteria 804
282 Ga0207694_10043027 3300025924 Bacteria 3485
283 Ga0207694_10105853 3300025924 Bacteria 2234
284 Ga0207694_10118535 3300025924 Bacteria 2112
285 Ga0207694_10415166 3300025924 Bacteria 1120
286 Ga0207659_10724391 3300025926 Bacteria 852
287 Ga0207700_10003371 3300025928 Bacteria 9275
288 Ga0207700_10056874 3300025928 Bacteria 2947
289 Ga0207700_10090527 3300025928 Bacteria 2415
290 Ga0207664_10020128 3300025929 Bacteria 4941
291 Ga0207664_10146209 3300025929 Bacteria 2005
292 Ga0207664_10548180 3300025929 Bacteria 1037
293 Ga0207690_10080187 3300025932 Bacteria 2277
294 Ga0207690_11675302 3300025932 Bacteria 531
295 Ga0207706_10101488 3300025933 Bacteria 2531
296 Ga0207706_10229253 3300025933 Bacteria 1625
297 Ga0207686_10586344 3300025934 Bacteria 876
298 Ga0207686_11329049 3300025934 Bacteria 591
299 Ga0207709_11047440 3300025935 Bacteria 668
300 Ga0207670_10180841 3300025936 Bacteria 1588
301 Ga0207669_10419467 3300025937 Bacteria 1053
302 Ga0207669_11132619 3300025937 Bacteria 661
303 Ga0207669_11622139 3300025937 Bacteria 552
304 Ga0207665_10033272 3300025939 Bacteria 3416
305 Ga0207665_10938287 3300025939 Bacteria 687
306 Ga0207711_10109583 3300025941 Bacteria 2454
307 Ga0207711_10324839 3300025941 Bacteria 1422
308 Ga0207711_10911551 3300025941 Bacteria 817
309 Ga0207661_10032322 3300025944 Bacteria 4052
310 Ga0207661_10051711 3300025944 Bacteria 3279
311 Ga0207661_11155184 3300025944 Bacteria 713
312 Ga0207661_11311935 3300025944 Bacteria 665
313 Ga0207667_10014461 3300025949 Bacteria 8997
314 Ga0207667_10023959 3300025949 Bacteria 6715
315 Ga0207667_10044250 3300025949 Bacteria 4719
316 Ga0207667_10867583 3300025949 Bacteria 896
317 Ga0207667_10878231 3300025949 Bacteria 890
318 Ga0207712_10375695 3300025961 Bacteria 1188
319 Ga0207712_10873808 3300025961 Bacteria 793
320 Ga0207712_11090285 3300025961 Bacteria 710
321 Ga0207640_10015094 3300025981 Bacteria 4464
322 Ga0207640_10420404 3300025981 Bacteria 1094
323 Ga0207640_12017685 3300025981 Bacteria 523
324 Ga0207658_10807077 3300025986 Bacteria 852
325 Ga0207703_10371248 3300026035 Bacteria 1321
326 Ga0207703_12133922 3300026035 Bacteria 536
327 Ga0207639_10031182 3300026041 Bacteria 3916
328 Ga0207639_10088708 3300026041 Bacteria 2469
329 Ga0207639_10134662 3300026041 Bacteria 2050
330 Ga0207639_10656871 3300026041 Bacteria 970
331 Ga0207639_10702688 3300026041 Bacteria 938
332 Ga0207639_11961514 3300026041 Bacteria 546
333 Ga0207678_10135485 3300026067 Bacteria 2101
334 Ga0207678_10510941 3300026067 Bacteria 1048
335 Ga0207678_10535077 3300026067 Bacteria 1024
336 Ga0207702_10026782 3300026078 Bacteria 4787
337 Ga0207702_10693403 3300026078 Bacteria 1003
338 Ga0207641_10265154 3300026088 Bacteria 1610
339 Ga0207641_10405586 3300026088 Bacteria 1310
340 Ga0207674_10006945 3300026116 Bacteria 13259
341 Ga0207674_10017516 3300026116 Bacteria 7815
342 Ga0207674_10078005 3300026116 Bacteria 3318
343 Ga0207675_101843607 3300026118 Bacteria 624
344 Ga0207683_10351773 3300026121 Bacteria 1352
345 Ga0207683_11201608 3300026121 Bacteria 703
346 Ga0207698_10139373 3300026142 Bacteria 2087
347 Ga0207698_10355981 3300026142 Bacteria 1384
348 Ga0207698_10885328 3300026142 Bacteria 899
349 Ga0209179_1019280 3300027512 Bacteria 1312
350 Ga0209179_1058124 3300027512 Bacteria 837
351 Ga0209179_1074138 3300027512 Bacteria 747
352 Ga0209179_1093384 3300027512 Bacteria 668
353 Ga0209588_1079305 3300027671 Bacteria 1061
354 Ga0209813_10323648 3300027866 Unclassified 604
355 Ga0268266_11795174 3300028379 Bacteria 588
356 Ga0268264_11223208 3300028381 Bacteria 761
357 Ga0268264_11249358 3300028381 Bacteria 753
358 Ga0265334_10066879 3300028573 Bacteria 1344
359 Ga0307517_10000483 3300028786 Bacteria 68332
360 Ga0307517_10544396 3300028786 Bacteria 581
361 Ga0307515_10035400 3300028794 Bacteria 8125
362 Ga0307515_10393518 3300028794 Bacteria 1014
363 Ga0307515_10867000 3300028794 Bacteria 531
364 Ga0265762_1015148 3300030760 Bacteria 1395
365 Ga0265763_1011726 3300030763 Bacteria 827
366 Ga0265760_10052842 3300031090 Bacteria 1225
367 Ga0265330_10003310 3300031235 Bacteria 8474
368 Ga0265330_10020070 3300031235 Bacteria 3055
369 Ga0265330_10056010 3300031235 Bacteria 1721
370 Ga0265332_10329663 3300031238 Bacteria 630
371 Ga0265328_10260667 3300031239 Bacteria 665
372 Ga0265325_10066080 3300031241 Bacteria 1824
373 Ga0265340_10000504 3300031247 Bacteria 21438
374 Ga0265340_10044772 3300031247 Bacteria 2165
375 Ga0265331_10289362 3300031250 Bacteria 734
376 Ga0265316_10134732 3300031344 Bacteria 1859
377 Ga0265316_10324436 3300031344 Bacteria 1118
378 Ga0307513_10211720 3300031456 Bacteria 1769
379 Ga0307408_100433661 3300031548 Bacteria 1136
380 Ga0307408_100800787 3300031548 Bacteria 855
381 Ga0265313_10053565 3300031595 Bacteria 1920
382 Ga0307508_10091451 3300031616 Bacteria 2631
383 Ga0307508_10124169 3300031616 Bacteria 2184
384 Ga0307508_10179322 3300031616 Bacteria 1721
385 Ga0265314_10005362 3300031711 Bacteria 11590
386 Ga0265342_10087734 3300031712 Bacteria 1787
387 Ga0265342_10160817 3300031712 Bacteria 1241
388 Ga0307516_10032161 3300031730 Bacteria 5284
389 Ga0307516_10195303 3300031730 Bacteria 1747
390 Ga0307516_10620178 3300031730 Bacteria 736
391 Ga0307516_10990182 3300031730 Bacteria 512
392 Ga0307405_10710768 3300031731 Bacteria 833
393 Ga0307413_10679583 3300031824 Bacteria 853
394 Ga0307406_10090174 3300031901 Bacteria 2062
395 Ga0307412_10635582 3300031911 Bacteria 908
396 Ga0307416_100340528 3300032002 Bacteria 1512
397 Ga0307416_100984081 3300032002 Bacteria 946
398 Ga0307411_10409545 3300032005 Bacteria 1123
399 Ga0307411_10523279 3300032005 Bacteria 1007
400 Ga0307411_12120760 3300032005 Bacteria 526
401 Ga0307415_102017136 3300032126 Bacteria 562
402 Ga0373930_0029012 3300034816 Bacteria 1129
403 Ga0373948_0070034 3300034817 Bacteria 785
404 Ga0373958_0202952 3300034819 Bacteria 520
405 Ga0373929_0129057 3300035085 Bacteria 661
406 Ga0373934_0018773 3300035086 Bacteria 2649
407 Ga0373952_0009417 3300035092 Bacteria 1870
408 Ga0373923_0026612 3300035111 Bacteria 2302
409 Ga0373932_0428040 3300035112 Bacteria 516
410 Ga0373936_0089798 3300035113 Bacteria 1287
411 Ga0373939_0225005 3300035114 Bacteria 720
412 Ga0373939_0468383 3300035114 Bacteria 533
413 Ga0373941_0019211 3300035115 Bacteria 1899
414 Ga0373953_0036598 3300035117 Bacteria 1934
415 Ga0373954_0000167 3300035118 Bacteria 23536
416 Ga0373954_0010236 3300035118 Bacteria 4135
417 Ga0373956_0008200 3300035119 Bacteria 4228
418 Ga0373957_0010346 3300035120 Bacteria 3081
419 Ga0373943_0514682 3300035170 Bacteria 700
420 Ga0373946_0121518 3300035171 Bacteria 1193
421 Ga0373955_0036864 3300035172 Bacteria 2598
422 Ga0373942_0252111 3300035207 Bacteria 600
423 Ga0373961_0340611 3300035241 Bacteria 563
424 Ga0373931_0046226 3300035691 Bacteria 2300
425 Ga0373931_1031291 3300035691 Bacteria 558
426 Ga0373935_0064843 3300035692 Bacteria 2343
427 Ga0373935_0189332 3300035692 Bacteria 1416
428 Ga0373927_0030244 3300035695 Bacteria 3534
429 Ga0373927_0054833 3300035695 Bacteria 2578
430 Ga0373927_0137605 3300035695 Bacteria 1596
431 Ga0373933_0000007 3300035724 Bacteria 123599
432 Ga0373933_0167420 3300035724 Bacteria 1397
433 Ga0373933_0813823 3300035724 Bacteria 615
434 Ga0373947_0007264 3300035725 Bacteria 6418
435 Ga0373947_0026147 3300035725 Bacteria 3408
436 Ga0373947_0315040 3300035725 Bacteria 1045
437 Ga0373937_0109431 3300036401 Bacteria 2569
438 Ga0373937_1354069 3300036401 Bacteria 660
439 Ga0373925_0054927 3300037068 Bacteria 2980
440 Ga0373925_0321310 3300037068 Bacteria 1252
441 Ga0373925_0406969 3300037068 Bacteria 1110
442 Ga0373925_0853740 3300037068 Bacteria 750
443 Ga0395905_0108267 3300037471 Bacteria 2609
444 Ga0439465_0164620 3300041413 Bacteria 797
445 Ga0451797_0927315 3300041453 Bacteria 620
446 Ga0451807_0729203 3300041486 Bacteria 539
447 Ga0451807_2732070 3300041486 Bacteria 751
448 Ga0451843_1558469 3300041509 Bacteria 569
449 Ga0451853_1829236 3300041512 Bacteria 547
450 Ga0451853_3880663 3300041512 Bacteria 1037
451 Ga0495592_0098584 3300046454 Bacteria 2085
452 Ga0495592_0347980 3300046454 Bacteria 951
453 Ga0495603_0044822 3300046455 Bacteria 2639
454 Ga0495603_0182585 3300046455 Bacteria 1214
455 Ga0495603_0203838 3300046455 Bacteria 1143
456 Ga0495629_0007517 3300046459 Bacteria 8035
457 Ga0495629_0598971 3300046459 Bacteria 737
458 Ga0495638_0146764 3300046460 Bacteria 1372
459 Ga0495638_0206863 3300046460 Bacteria 1104
460 Ga0495641_0276798 3300046461 Bacteria 755
461 Ga0495651_0070399 3300046462 Bacteria 2661
462 Ga0495651_0237577 3300046462 Bacteria 1251
463 Ga0495651_0396542 3300046462 Bacteria 902
464 Ga0495653_0046964 3300046463 Bacteria 3341
465 Ga0495580_0380064 3300046472 Bacteria 954
466 Ga0495582_0821511 3300046473 Bacteria 538
467 Ga0495639_0219630 3300046475 Bacteria 934
468 Ga0495639_0418016 3300046475 Bacteria 679
469 Ga0495664_0141838 3300046477 Bacteria 1457
470 Ga0495585_0195454 3300046492 Bacteria 1033
471 Ga0495594_0179064 3300046499 Bacteria 1207
472 Ga0495608_0020550 3300046511 Bacteria 4538
473 Ga0495608_0356938 3300046511 Bacteria 899
474 Ga0495618_0099410 3300046514 Bacteria 1862
475 Ga0495618_0468346 3300046514 Bacteria 763
476 Ga0495628_0075427 3300046516 Bacteria 2626
477 Ga0495628_0948014 3300046516 Bacteria 595
478 Ga0495628_1202165 3300046516 Bacteria 514
479 Ga0495630_0111792 3300046517 Bacteria 2069
480 Ga0495630_1082726 3300046517 Bacteria 608
481 Ga0495631_0200633 3300046518 Bacteria 853
482 Ga0495632_0146203 3300046519 Bacteria 1094
483 Ga0495652_0519930 3300046529 Bacteria 823
484 Ga0495652_0678237 3300046529 Bacteria 695
485 Ga0495652_1108562 3300046529 Bacteria 513
486 Ga0495640_0478595 3300046533 Bacteria 759
487 Ga0495640_0806888 3300046533 Bacteria 559
488 Ga0495640_0809797 3300046533 Bacteria 558
489 Ga0495587_0091601 3300046536 Bacteria 1755
490 Ga0495587_0746320 3300046536 Bacteria 535
491 Ga0495609_0140149 3300046538 Bacteria 1032
492 Ga0495645_0010229 3300046543 Bacteria 6573
493 Ga0495633_0163374 3300046558 Bacteria 1027
494 Ga0495667_0526317 3300046559 Bacteria 739
495 Ga0495668_0063371 3300046616 Bacteria 2036
496 Ga0495668_0208938 3300046616 Bacteria 1069
497 Ga0495668_0293011 3300046616 Bacteria 892
498 Ga0495668_0369223 3300046616 Bacteria 788
499 Ga0495634_0014308 3300046642 Bacteria 5724
500 Ga0495625_0281457 3300046660 Bacteria 1070
501 Ga0495625_0455891 3300046660 Bacteria 789
502 Ga0495635_0003274 3300046663 Bacteria 11179
503 Ga0495635_0995604 3300046663 Bacteria 534
504 Ga0495588_0089468 3300046674 Bacteria 1612
505 Ga0495657_0080130 3300046675 Bacteria 2113
506 Ga0495657_0282121 3300046675 Bacteria 994
507 Ga0495599_0151751 3300046678 Bacteria 1434
508 Ga0495623_0030686 3300046679 Bacteria 3457
509 Ga0495623_0257122 3300046679 Bacteria 980
510 Ga0495646_0056840 3300046680 Bacteria 2344
511 Ga0495658_0342121 3300046683 Bacteria 950
512 Ga0495669_0144623 3300046684 Bacteria 1123
513 Ga0495613_0434284 3300046689 Bacteria 892
514 Ga0495613_0485165 3300046689 Bacteria 834
515 Ga0495624_0157474 3300046690 Bacteria 1388
516 Ga0495624_0480984 3300046690 Bacteria 743
517 Ga0495600_0277534 3300046809 Bacteria 1061
518 Ga0495600_0408815 3300046809 Bacteria 843
519 Ga0495581_0197796 3300047315 Bacteria 1176
520 Ga0495604_0336399 3300047317 Bacteria 1006
521 Ga0495604_0443849 3300047317 Bacteria 848
522 Ga0495604_0743782 3300047317 Bacteria 621
523 Ga0495674_0059246 3300047319 Bacteria 3345
524 Ga0495674_0693374 3300047319 Bacteria 800
525 Ga0495674_1244652 3300047319 Bacteria 561
526 Ga0495672_0043133 3300047320 Bacteria 2714
527 Ga0495672_0051539 3300047320 Bacteria 2423
528 Ga0495680_0628819 3300047322 Bacteria 715
529 Ga0495680_0727409 3300047322 Bacteria 653
530 Ga0495683_0457694 3300047323 Unclassified 523
531 Ga0495675_0336293 3300047444 Bacteria 890
532 Ga0495675_0812056 3300047444 Unclassified 517
533 Ga0495684_0004169 3300047471 Bacteria 11285
534 Ga0495684_0488731 3300047471 Bacteria 849
535 Ga0495686_0684323 3300047472 Bacteria 524
536 Ga0495593_0000677 3300047673 Bacteria 19636
537 Ga0495602_0128374 3300048088 Bacteria 2027
538 Ga0495602_0165923 3300048088 Bacteria 1719
539 Ga0496100_0121130 3300048903 Bacteria 1830
540 Ga0496100_0777672 3300048903 Bacteria 749
541 Ga0496101_0351167 3300048904 Bacteria 1159
542 Ga0496101_0553801 3300048904 Bacteria 909
543 Ga0496101_0800897 3300048904 Bacteria 743
544 Ga0496102_0041504 3300048905 Bacteria 4166
545 Ga0496102_0886682 3300048905 Bacteria 814
546 Ga0496102_1048929 3300048905 Bacteria 735
547 Ga0496103_0044738 3300048906 Bacteria 2729
548 Ga0496103_0682323 3300048906 Unclassified 652
549 Ga0496103_0782969 3300048906 Bacteria 602
550 Ga0496104_0049725 3300048907 Bacteria 3953
551 Ga0496104_0796277 3300048907 Bacteria 851
552 Ga0496105_0279096 3300048908 Bacteria 1347
553 Ga0496105_0624893 3300048908 Unclassified 834
554 Ga0496106_0037402 3300048909 Bacteria 3631
555 Ga0496106_0427881 3300048909 Bacteria 1064
556 Ga0496106_0469218 3300048909 Bacteria 1011
557 Ga0496107_0018511 3300048910 Bacteria 4905
558 Ga0496108_0183820 3300048911 Bacteria 1811
559 Ga0496108_0226278 3300048911 Bacteria 1626
560 Ga0496108_0813113 3300048911 Unclassified 806
561 Ga0496109_0043350 3300048912 Bacteria 4078
562 Ga0496110_0042751 3300048913 Bacteria 3955
563 Ga0496110_0189253 3300048913 Bacteria 1869
564 Ga0496110_0326242 3300048913 Bacteria 1398
565 Ga0496110_0753317 3300048913 Unclassified 877
566 Ga0496110_1255030 3300048913 Unclassified 650
567 Ga0496111_0260331 3300048914 Bacteria 1287
568 Ga0496112_0163417 3300048915 Bacteria 2192
569 Ga0496112_0166716 3300048915 Bacteria 2168
570 Ga0496112_0205865 3300048915 Bacteria 1926
571 Ga0496112_0324303 3300048915 Bacteria 1484
572 Ga0496113_0411753 3300048916 Bacteria 1086
573 Ga0496113_0508110 3300048916 Bacteria 967
574 Ga0496114_0042890 3300048917 Bacteria 3750
575 Ga0496114_0114398 3300048917 Bacteria 2314
576 Ga0496114_0196302 3300048917 Bacteria 1767
577 Ga0496115_0043376 3300048918 Bacteria 3587
578 Ga0496115_0097503 3300048918 Bacteria 2407
579 Ga0496115_0300779 3300048918 Bacteria 1315
580 Ga0496115_0418620 3300048918 Bacteria 1085
581 Ga0496115_0511437 3300048918 Bacteria 964
582 Ga0496115_0913531 3300048918 Bacteria 676
583 Ga0496115_1069548 3300048918 Bacteria 613
584 Ga0496116_0294912 3300048919 Bacteria 776
585 Ga0496117_0162709 3300048920 Bacteria 1305
586 Ga0496118_0027432 3300048921 Bacteria 4819
587 Ga0496118_0551070 3300048921 Bacteria 562
588 Ga0496119_0059502 3300048922 Bacteria 2294
589 Ga0496119_0062748 3300048922 Bacteria 2213
590 Ga0496119_0167090 3300048922 Bacteria 1165
591 Ga0496121_0000214 3300048924 Bacteria 127349
592 Ga0496121_0004032 3300048924 Bacteria 20180
593 Ga0496121_0258443 3300048924 Bacteria 1204
594 Ga0496121_0288958 3300048924 Bacteria 1118
595 Ga0496121_0296884 3300048924 Bacteria 1098
596 Ga0496121_0823307 3300048924 Bacteria 543
597 Ga0496124_0416664 3300048927 Bacteria 927
598 Ga0496124_0507151 3300048927 Bacteria 807
599 Ga0496124_0893796 3300048927 Bacteria 540
600 Ga0496125_0104958 3300048928 Bacteria 2067
601 Ga0496125_0559300 3300048928 Bacteria 632
602 Ga0496126_0007566 3300048929 Bacteria 11875
603 Ga0496126_0072520 3300048929 Bacteria 3063
604 Ga0496126_0087634 3300048929 Bacteria 2743
605 Ga0496126_0269056 3300048929 Bacteria 1415
606 Ga0496126_0291012 3300048929 Bacteria 1351
607 Ga0496126_0577425 3300048929 Bacteria 888
608 Ga0496126_0664367 3300048929 Bacteria 814
609 Ga0496126_0880732 3300048929 Bacteria 680
610 Ga0496126_1198702 3300048929 Bacteria 558
611 Ga0496126_1298660 3300048929 Bacteria 530
612 Ga0495682_0191647 3300049460 Bacteria 726
613 nmdc:mga00v17_664988_c1 3300050491 Bacteria 669
614 nmdc:mga0yw44_285726_c1 3300050492 Bacteria 1103
615 nmdc:mga0yw44_652479_c1 3300050492 Bacteria 715
616 nmdc:mga0yw44_937617_c1 3300050492 Bacteria 587
617 nmdc:mga06z11_30105_c1 3300050494 Bacteria 2623
618 nmdc:mga06z11_96577_c1 3300050494 Bacteria 1614
619 nmdc:mga04h51_356935_c1 3300050495 Unclassified 605
620 nmdc:mga07m45_680025_c1 3300050496 Bacteria 592
621 nmdc:mga0n895_1083211_c1 3300050512 Bacteria 779
622 nmdc:mga0sz30_428918_c1 3300050516 Bacteria 593
623 Ga0495601_0084762 3300053077 Bacteria 2036
624 Ga0495601_0108481 3300053077 Bacteria 1796
625 Ga0495601_0616018 3300053077 Bacteria 696
626 Ga0495612_0390829 3300053078 Bacteria 631
627 Ga0495655_0201406 3300053083 Bacteria 651
628 Ga0495595_0002075 3300053084 Bacteria 7796
629 Ga0495595_0091768 3300053084 Bacteria 1458
630 Ga0495595_0211033 3300053084 Bacteria 968
631 Ga0495619_0224410 3300053085 Bacteria 1301
632 Ga0495619_0732760 3300053085 Bacteria 671
633 Ga0495619_1211703 3300053085 Bacteria 500
634 Ga0500578_0341153 3300053086 Bacteria 878
635 Ga0500647_0058237 3300053091 Bacteria 1858
636 Ga0500583_0231463 3300053092 Bacteria 915
637 Ga0500651_0012431 3300053093 Bacteria 5160
638 Ga0500651_0583040 3300053093 Bacteria 608
639 Ga0500566_0002356 3300053094 Bacteria 11186
640 Ga0500640_045834 3300053095 Bacteria 1916
641 Ga0500641_0385284 3300053096 Bacteria 555
642 Ga0500648_277890 3300053097 Bacteria 758
643 Ga0500556_0202273 3300053104 Bacteria 785
644 Ga0500572_003525 3300053111 Bacteria 3567
645 Ga0500591_110324 3300053115 Bacteria 1154
646 Ga0500595_000750 3300053119 Bacteria 19098
647 Ga0500595_050019 3300053119 Bacteria 1299
648 Ga0500595_076672 3300053119 Bacteria 984
649 Ga0500595_124352 3300053119 Bacteria 728
650 Ga0500614_007597 3300053123 Bacteria 2288
651 Ga0500642_0191408 3300053130 Bacteria 954
652 Ga0500559_0034525 3300053136 Bacteria 2181
653 Ga0500559_0360938 3300053136 Bacteria 679
654 Ga0500568_0027565 3300053139 Bacteria 2374
655 Ga0500568_0249295 3300053139 Bacteria 647
656 Ga0500588_0361290 3300053146 Bacteria 552
657 Ga0500603_008356 3300053150 Bacteria 2293
658 Ga0500620_075241 3300053155 Bacteria 1165
659 Ga0500622_0198884 3300053156 Bacteria 913
660 Ga0500627_0072588 3300053158 Bacteria 1526
661 Ga0500630_008710 3300053159 Bacteria 4982
662 Ga0500638_005430 3300053162 Bacteria 5075
663 Ga0500639_002312 3300053163 Bacteria 9561
664 Ga0500636_0017300 3300053177 Bacteria 4256
665 Ga0500636_0116518 3300053177 Bacteria 1503
666 Ga0500637_0020670 3300053178 Bacteria 3569
667 Ga0500576_150756 3300053725 Bacteria 869
668 Ga0500611_044358 3300053727 Bacteria 991
669 Ga0500609_016984 3300053731 Bacteria 988
670 Ga0500596_002233 3300053735 Bacteria 3841
671 Ga0500601_010962 3300053737 Bacteria 1017
672 Ga0265330_10173653
673 JGI24736J21556_1031737
674 JGI24739J22299_10000994
675 JGI24739J22299_10020547
676 JGI24737J22298_10002808
677 JGI24737J22298_10009616
678 JGI24735J21928_10006210
679 JGI25153J46596_10059817
680 Ga0065715_10120325
681 Ga0070658_10306872
682 Ga0070683_100050223
683 Ga0070683_100783139
684 Ga0070683_102313892
685 Ga0070677_10507936
686 Ga0068869_100636811
687 Ga0068869_100966370
688 Ga0070680_100361631
689 Ga0070680_100906893
690 Ga0070682_100865885
691 Ga0068868_100897588
692 Ga0068868_101109224
693 Ga0068868_101963200
694 Ga0070660_100003722
695 Ga0070660_100256463
696 Ga0070660_101547230
697 Ga0070687_101187946
698 Ga0070661_100271222
699 Ga0070661_100315525
700 Ga0070668_101119995
701 Ga0070668_101130424
702 Ga0070668_101829452
703 Ga0070675_100602962
704 Ga0070674_101619814
705 Ga0070673_101832984
706 Ga0070659_100233334
707 Ga0070659_100258064
708 Ga0070659_101784772
709 Ga0070667_100317816
710 Ga0070709_10003383
711 Ga0070709_10097254
712 Ga0070709_10353795
713 Ga0070714_100507205
714 Ga0070714_100636630
715 Ga0070714_101925400
716 Ga0070713_100002594
717 Ga0070713_100111204
718 Ga0070713_100251769
719 Ga0070710_10005449
720 Ga0070710_10043834
721 Ga0070711_100023046
722 Ga0070711_100025335
723 Ga0070711_100289792
724 Ga0070711_101446452
725 Ga0070711_101569920
726 Ga0070663_100017501
727 Ga0070663_101074072
728 Ga0070663_101365250
729 Ga0070663_101588143
730 Ga0070678_100079467
731 Ga0070662_100075193
732 Ga0070681_10010223
733 Ga0070681_10057793
734 Ga0070681_10469730
735 Ga0068867_100523272
736 Ga0070706_100330359
737 Ga0070706_100612872
738 Ga0070707_100106096
739 Ga0070698_100842729
740 Ga0070699_101641184
741 Ga0070679_100004045
742 Ga0070679_101021125
743 Ga0070684_100212619
744 Ga0070684_100218336
745 Ga0070684_100684088
746 Ga0070684_101301882
747 Ga0070697_100008732
748 Ga0070697_100424487
749 Ga0070697_101111451
750 Ga0068853_100011965
751 Ga0068853_100044352
752 Ga0068853_100058719
753 Ga0068853_100078277
754 Ga0068853_100106594
755 Ga0068853_102021580
756 Ga0070672_100025342
757 Ga0070672_100448674
758 Ga0070686_100094482
759 Ga0070693_100349127
760 Ga0070693_100652772
761 Ga0070693_100689407
762 Ga0070665_100830823
763 Ga0070665_101452953
764 Ga0070665_101880714
765 Ga0068855_100020255
766 Ga0068855_100020651
767 Ga0068855_100024639
768 Ga0070664_100199805
769 Ga0070664_100392479
770 Ga0068857_100010911
771 Ga0068857_100073096
772 Ga0068857_100185123
773 Ga0068854_100057575
774 Ga0068854_100206793
775 Ga0068854_102057572
776 Ga0068856_100013826
777 Ga0070702_100370414
778 Ga0068852_100275230
779 Ga0068852_100674898
780 Ga0068852_101989409
781 Ga0068852_102210537
782 Ga0068859_100298992
783 Ga0068859_102089109
784 Ga0068866_10389442
785 Ga0068851_10242155
786 Ga0068851_10434412
787 Ga0068851_11044693
788 Ga0068863_100835384
789 Ga0068863_100902150
790 Ga0068858_100177733
791 Ga0068858_100226200
792 Ga0068858_101093175
793 Ga0068860_100993774
794 Ga0068860_101243427
795 Ga0081455_10035923
796 Ga0070717_10067381
797 Ga0070717_10179047
798 Ga0070717_10392678
799 Ga0070717_11596520
800 Ga0075365_10138058
801 Ga0075365_10400926
802 Ga0075365_11322186
803 Ga0075364_10183994
804 Ga0070715_10003754
805 Ga0070715_10094890
806 Ga0070716_100055242
807 Ga0070716_100117844
808 Ga0070716_100498210
809 Ga0070716_101024157
810 Ga0070712_100009607
811 Ga0070712_100039813
812 Ga0070712_100405534
813 Ga0075367_10206761
814 Ga0075367_10268677
815 Ga0075369_10654701
816 Ga0097621_100225663
817 Ga0097621_100815406
818 Ga0097621_102323818
819 Ga0097621_102335592
820 Ga0068865_100338136
821 Ga0097620_100298996
822 Ga0097620_102089854
823 Ga0099794_10585178
824 Ga0099794_10671529
825 Ga0099794_10726870
826 Ga0099794_10730020
827 Ga0099795_10021022
828 Ga0099795_10027813
829 Ga0099795_10148003
830 Ga0099795_10654860
831 Ga0105240_10031140
832 Ga0105240_10035863
833 Ga0105240_10197718
834 Ga0105240_10398156
835 Ga0105240_10402848
836 Ga0105240_10523887
837 Ga0105247_10158870
838 Ga0105247_10287949
839 Ga0105247_10448835
840 Ga0105247_11862777
841 Ga0105243_10370078
842 Ga0105243_11257933
843 Ga0105241_10055041
844 Ga0105241_10200352
845 Ga0105241_11454213
846 Ga0105241_11601032
847 Ga0105242_10630021
848 Ga0105248_10025081
849 Ga0105248_10305891
850 Ga0105248_12988661
851 Ga0105237_10009459
852 Ga0105237_10009470
853 Ga0105237_10123402
854 Ga0105237_10255007
855 Ga0105237_10275301
856 Ga0105237_10758847
857 Ga0105237_11182669
858 Ga0105237_11723665
859 Ga0105238_10009011
860 Ga0105238_10017548
861 Ga0105238_10156359
862 Ga0105238_10390752
863 Ga0105249_10219056
864 Ga0105249_10251662
865 Ga0099796_10075009
866 Ga0099796_10160526
867 Ga0099796_10308289
868 Ga0105239_10015132
869 Ga0105239_10027064
870 Ga0105239_10149385
871 Ga0105239_10253658
872 Ga0105239_10464963
873 Ga0105239_11447518
874 Ga0105239_12527561
875 Ga0105246_10331686
876 Ga0105246_10488858
877 Ga0105246_10805062
878 Ga0105246_12329422
879 Ga0157370_10033076
880 Ga0157369_10020222
881 Ga0157369_12204306
882 Ga0157374_10460966
883 Ga0157374_11793989
884 Ga0163162_10484505
885 Ga0157372_10166903
886 Ga0157375_12882046
887 Ga0163163_10963761
888 Ga0163163_11128721
889 Ga0163163_11673690
890 Ga0163163_12214358
891 Ga0157380_13161504
892 Ga0182008_10110458
893 Ga0157377_10281129
894 Ga0157379_10209148
895 Ga0157379_10939541
896 Ga0157376_10319065
897 Ga0157376_12611199
898 Ga0163161_10095370
899 Ga0163161_11457037
900 Ga0209758_1004067
901 Ga0207697_10007283
902 Ga0207656_10083290
903 Ga0207656_10216650
904 Ga0207692_10032424
905 Ga0207692_10129017
906 Ga0207710_10473186
907 Ga0207710_10549819
908 Ga0207688_10149914
909 Ga0207647_10006000
910 Ga0207647_10022741
911 Ga0207647_10156001
912 Ga0207647_10344404
913 Ga0207685_10027964
914 Ga0207699_10018080
915 Ga0207699_10030363
916 Ga0207699_10172022
917 Ga0207699_10713003
918 Ga0207705_10295032
919 Ga0207684_10568814
920 Ga0207654_10876709
921 Ga0207707_10005343
922 Ga0207707_10051455
923 Ga0207707_10088161
924 Ga0207695_10047109
925 Ga0207695_10096550
926 Ga0207695_10223701
927 Ga0207695_10252428
928 Ga0207695_10299191
929 Ga0207695_10475279
930 Ga0207695_10883556
931 Ga0207671_10084211
932 Ga0207671_10126647
933 Ga0207671_10723876
934 Ga0207671_10776972
935 Ga0207671_11437910
936 Ga0207693_10015799
937 Ga0207693_10184408
938 Ga0207693_10233469
939 Ga0207663_10055078
940 Ga0207663_10212756
941 Ga0207663_10300981
942 Ga0207663_10349887
943 Ga0207660_10018171
944 Ga0207660_10053074
945 Ga0207662_10941031
946 Ga0207657_10006315
947 Ga0207657_11238234
948 Ga0207649_10125903
949 Ga0207649_11688191
950 Ga0207652_10116431
951 Ga0207652_10145273
952 Ga0207652_10857866
953 Ga0207694_10043027
954 Ga0207694_10105853
955 Ga0207694_10118535
956 Ga0207694_10415166
957 Ga0207659_10724391
958 Ga0207700_10003371
959 Ga0207700_10056874
960 Ga0207700_10090527
961 Ga0207664_10020128
962 Ga0207664_10146209
963 Ga0207664_10548180
964 Ga0207690_10080187
965 Ga0207690_11675302
966 Ga0207706_10101488
967 Ga0207706_10229253
968 Ga0207686_10586344
969 Ga0207686_11329049
970 Ga0207709_11047440
971 Ga0207670_10180841
972 Ga0207669_10419467
973 Ga0207669_11132619
974 Ga0207669_11622139
975 Ga0207665_10033272
976 Ga0207665_10938287
977 Ga0207711_10109583
978 Ga0207711_10324839
979 Ga0207711_10911551
980 Ga0207661_10032322
981 Ga0207661_10051711
982 Ga0207661_11155184
983 Ga0207661_11311935
984 Ga0207667_10014461
985 Ga0207667_10023959
986 Ga0207667_10044250
987 Ga0207667_10867583
988 Ga0207667_10878231
989 Ga0207712_10375695
990 Ga0207712_10873808
991 Ga0207712_11090285
992 Ga0207640_10015094
993 Ga0207640_10420404
994 Ga0207640_12017685
995 Ga0207658_10807077
996 Ga0207703_10371248
997 Ga0207703_12133922
998 Ga0207639_10031182
999 Ga0207639_10088708
1000 Ga0207639_10134662
1001 Ga0207639_10656871
1002 Ga0207639_10702688
1003 Ga0207639_11961514
1004 Ga0207678_10135485
1005 Ga0207678_10510941
1006 Ga0207678_10535077
1007 Ga0207702_10026782
1008 Ga0207702_10693403
1009 Ga0207641_10265154
1010 Ga0207641_10405586
1011 Ga0207674_10006945
1012 Ga0207674_10017516
1013 Ga0207674_10078005
1014 Ga0207675_101843607
1015 Ga0207683_10351773
1016 Ga0207683_11201608
1017 Ga0207698_10139373
1018 Ga0207698_10355981
1019 Ga0207698_10885328
1020 Ga0209179_1019280
1021 Ga0209179_1058124
1022 Ga0209179_1074138
1023 Ga0209179_1093384
1024 Ga0209588_1079305
1025 Ga0209813_10323648
1026 Ga0268266_11795174
1027 Ga0268264_11223208
1028 Ga0268264_11249358
1029 Ga0265334_10066879
1030 Ga0307517_10000483
1031 Ga0307517_10544396
1032 Ga0307515_10035400
1033 Ga0307515_10393518
1034 Ga0307515_10867000
1035 Ga0265762_1015148
1036 Ga0265763_1011726
1037 Ga0265760_10052842
1038 Ga0265330_10003310
1039 Ga0265330_10020070
1040 Ga0265330_10056010
1041 Ga0265332_10329663
1042 Ga0265328_10260667
1043 Ga0265325_10066080
1044 Ga0265340_10000504
1045 Ga0265340_10044772
1046 Ga0265331_10289362
1047 Ga0265316_10134732
1048 Ga0265316_10324436
1049 Ga0307513_10211720
1050 Ga0307408_100433661
1051 Ga0307408_100800787
1052 Ga0265313_10053565
1053 Ga0307508_10091451
1054 Ga0307508_10124169
1055 Ga0307508_10179322
1056 Ga0265314_10005362
1057 Ga0265342_10087734
1058 Ga0265342_10160817
1059 Ga0307516_10032161
1060 Ga0307516_10195303
1061 Ga0307516_10620178
1062 Ga0307516_10990182
1063 Ga0307405_10710768
1064 Ga0307413_10679583
1065 Ga0307406_10090174
1066 Ga0307412_10635582
1067 Ga0307416_100340528
1068 Ga0307416_100984081
1069 Ga0307411_10409545
1070 Ga0307411_10523279
1071 Ga0307411_12120760
1072 Ga0307415_102017136
1073 Ga0373930_0029012
1074 Ga0373948_0070034
1075 Ga0373958_0202952
1076 Ga0373929_0129057
1077 Ga0373934_0018773
1078 Ga0373952_0009417
1079 Ga0373923_0026612
1080 Ga0373932_0428040
1081 Ga0373936_0089798
1082 Ga0373939_0225005
1083 Ga0373939_0468383
1084 Ga0373941_0019211
1085 Ga0373953_0036598
1086 Ga0373954_0000167
1087 Ga0373954_0010236
1088 Ga0373956_0008200
1089 Ga0373957_0010346
1090 Ga0373943_0514682
1091 Ga0373946_0121518
1092 Ga0373955_0036864
1093 Ga0373942_0252111
1094 Ga0373961_0340611
1095 Ga0373931_0046226
1096 Ga0373931_1031291
1097 Ga0373935_0064843
1098 Ga0373935_0189332
1099 Ga0373927_0030244
1100 Ga0373927_0054833
1101 Ga0373927_0137605
1102 Ga0373933_0000007
1103 Ga0373933_0167420
1104 Ga0373933_0813823
1105 Ga0373947_0007264
1106 Ga0373947_0026147
1107 Ga0373947_0315040
1108 Ga0373937_0109431
1109 Ga0373937_1354069
1110 Ga0373925_0054927
1111 Ga0373925_0321310
1112 Ga0373925_0406969
1113 Ga0373925_0853740
1114 Ga0395905_0108267
1115 Ga0439465_0164620
1116 Ga0451797_0927315
1117 Ga0451807_0729203
1118 Ga0451807_2732070
1119 Ga0451843_1558469
1120 Ga0451853_1829236
1121 Ga0451853_3880663
1122 Ga0495592_0098584
1123 Ga0495592_0347980
1124 Ga0495603_0044822
1125 Ga0495603_0182585
1126 Ga0495603_0203838
1127 Ga0495629_0007517
1128 Ga0495629_0598971
1129 Ga0495638_0146764
1130 Ga0495638_0206863
1131 Ga0495641_0276798
1132 Ga0495651_0070399
1133 Ga0495651_0237577
1134 Ga0495651_0396542
1135 Ga0495653_0046964
1136 Ga0495580_0380064
1137 Ga0495582_0821511
1138 Ga0495639_0219630
1139 Ga0495639_0418016
1140 Ga0495664_0141838
1141 Ga0495585_0195454
1142 Ga0495594_0179064
1143 Ga0495608_0020550
1144 Ga0495608_0356938
1145 Ga0495618_0099410
1146 Ga0495618_0468346
1147 Ga0495628_0075427
1148 Ga0495628_0948014
1149 Ga0495628_1202165
1150 Ga0495630_0111792
1151 Ga0495630_1082726
1152 Ga0495631_0200633
1153 Ga0495632_0146203
1154 Ga0495652_0519930
1155 Ga0495652_0678237
1156 Ga0495652_1108562
1157 Ga0495640_0478595
1158 Ga0495640_0806888
1159 Ga0495640_0809797
1160 Ga0495587_0091601
1161 Ga0495587_0746320
1162 Ga0495609_0140149
1163 Ga0495645_0010229
1164 Ga0495633_0163374
1165 Ga0495667_0526317
1166 Ga0495668_0063371
1167 Ga0495668_0208938
1168 Ga0495668_0293011
1169 Ga0495668_0369223
1170 Ga0495634_0014308
1171 Ga0495625_0281457
1172 Ga0495625_0455891
1173 Ga0495635_0003274
1174 Ga0495635_0995604
1175 Ga0495588_0089468
1176 Ga0495657_0080130
1177 Ga0495657_0282121
1178 Ga0495599_0151751
1179 Ga0495623_0030686
1180 Ga0495623_0257122
1181 Ga0495646_0056840
1182 Ga0495658_0342121
1183 Ga0495669_0144623
1184 Ga0495613_0434284
1185 Ga0495613_0485165
1186 Ga0495624_0157474
1187 Ga0495624_0480984
1188 Ga0495600_0277534
1189 Ga0495600_0408815
1190 Ga0495581_0197796
1191 Ga0495604_0336399
1192 Ga0495604_0443849
1193 Ga0495604_0743782
1194 Ga0495674_0059246
1195 Ga0495674_0693374
1196 Ga0495674_1244652
1197 Ga0495672_0043133
1198 Ga0495672_0051539
1199 Ga0495680_0628819
1200 Ga0495680_0727409
1201 Ga0495683_0457694
1202 Ga0495675_0336293
1203 Ga0495675_0812056
1204 Ga0495684_0004169
1205 Ga0495684_0488731
1206 Ga0495686_0684323
1207 Ga0495593_0000677
1208 Ga0495602_0128374
1209 Ga0495602_0165923
1210 Ga0496100_0121130
1211 Ga0496100_0777672
1212 Ga0496101_0351167
1213 Ga0496101_0553801
1214 Ga0496101_0800897
1215 Ga0496102_0041504
1216 Ga0496102_0886682
1217 Ga0496102_1048929
1218 Ga0496103_0044738
1219 Ga0496103_0682323
1220 Ga0496103_0782969
1221 Ga0496104_0049725
1222 Ga0496104_0796277
1223 Ga0496105_0279096
1224 Ga0496105_0624893
1225 Ga0496106_0037402
1226 Ga0496106_0427881
1227 Ga0496106_0469218
1228 Ga0496107_0018511
1229 Ga0496108_0183820
1230 Ga0496108_0226278
1231 Ga0496108_0813113
1232 Ga0496109_0043350
1233 Ga0496110_0042751
1234 Ga0496110_0189253
1235 Ga0496110_0326242
1236 Ga0496110_0753317
1237 Ga0496110_1255030
1238 Ga0496111_0260331
1239 Ga0496112_0163417
1240 Ga0496112_0166716
1241 Ga0496112_0205865
1242 Ga0496112_0324303
1243 Ga0496113_0411753
1244 Ga0496113_0508110
1245 Ga0496114_0042890
1246 Ga0496114_0114398
1247 Ga0496114_0196302
1248 Ga0496115_0043376
1249 Ga0496115_0097503
1250 Ga0496115_0300779
1251 Ga0496115_0418620
1252 Ga0496115_0511437
1253 Ga0496115_0913531
1254 Ga0496115_1069548
1255 Ga0496116_0294912
1256 Ga0496117_0162709
1257 Ga0496118_0027432
1258 Ga0496118_0551070
1259 Ga0496119_0059502
1260 Ga0496119_0062748
1261 Ga0496119_0167090
1262 Ga0496121_0000214
1263 Ga0496121_0004032
1264 Ga0496121_0258443
1265 Ga0496121_0288958
1266 Ga0496121_0296884
1267 Ga0496121_0823307
1268 Ga0496124_0416664
1269 Ga0496124_0507151
1270 Ga0496124_0893796
1271 Ga0496125_0104958
1272 Ga0496125_0559300
1273 Ga0496126_0007566
1274 Ga0496126_0072520
1275 Ga0496126_0087634
1276 Ga0496126_0269056
1277 Ga0496126_0291012
1278 Ga0496126_0577425
1279 Ga0496126_0664367
1280 Ga0496126_0880732
1281 Ga0496126_1198702
1282 Ga0496126_1298660
1283 Ga0495682_0191647
1284 nmdc:mga00v17_664988_c1
1285 nmdc:mga0yw44_285726_c1
1286 nmdc:mga0yw44_652479_c1
1287 nmdc:mga0yw44_937617_c1
1288 nmdc:mga06z11_30105_c1
1289 nmdc:mga06z11_96577_c1
1290 nmdc:mga04h51_356935_c1
1291 nmdc:mga07m45_680025_c1
1292 nmdc:mga0n895_1083211_c1
1293 nmdc:mga0sz30_428918_c1
1294 Ga0495601_0084762
1295 Ga0495601_0108481
1296 Ga0495601_0616018
1297 Ga0495612_0390829
1298 Ga0495655_0201406
1299 Ga0495595_0002075
1300 Ga0495595_0091768
1301 Ga0495595_0211033
1302 Ga0495619_0224410
1303 Ga0495619_0732760
1304 Ga0495619_1211703
1305 Ga0500578_0341153
1306 Ga0500647_0058237
1307 Ga0500583_0231463
1308 Ga0500651_0012431
1309 Ga0500651_0583040
1310 Ga0500566_0002356
1311 Ga0500640_045834
1312 Ga0500641_0385284
1313 Ga0500648_277890
1314 Ga0500556_0202273
1315 Ga0500572_003525
1316 Ga0500591_110324
1317 Ga0500595_000750
1318 Ga0500595_050019
1319 Ga0500595_076672
1320 Ga0500595_124352
1321 Ga0500614_007597
1322 Ga0500642_0191408
1323 Ga0500559_0034525
1324 Ga0500559_0360938
1325 Ga0500568_0027565
1326 Ga0500568_0249295
1327 Ga0500588_0361290
1328 Ga0500603_008356
1329 Ga0500620_075241
1330 Ga0500622_0198884
1331 Ga0500627_0072588
1332 Ga0500630_008710
1333 Ga0500638_005430
1334 Ga0500639_002312
1335 Ga0500636_0017300
1336 Ga0500636_0116518
1337 Ga0500637_0020670
1338 Ga0500576_150756
1339 Ga0500611_044358
1340 Ga0500609_016984
1341 Ga0500596_002233
1342 Ga0500601_010962

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
8gqo-assembly1.cif.gz_A solution nmr structure of vaccinia virus protein a28: an entry-fusion complex component 0.5661 2 49
7aoi-assembly1.cif.gz_AY trypanosoma brucei mitochondrial ribosome large subunit assembly intermediate 0.5496 1 40
6tgv-assembly1.cif.gz_A-3 crystal structure of mycobacterium smegmatis coabc in complex with ctp and fmn 0.5465 24 50
5xfa-assembly2.cif.gz_H crystal structure of nad+-reducing [nife]-hydrogenase in the h2-reduced state 0.5395 1 38
5int-assembly1.cif.gz_A crystal structure of the c-terminal domain of coenzyme a biosynthesis bifunctional protein coabc 0.5346 21 50
ID Description Score Start End Superfamily
af_A0A2R8QCJ3_2_77_2.60.40.60 Mainly Beta;Sandwich;Immunoglobulin-like;Cadherins 0.6495 22 39 2.60.40.60
af_Q4W5T0_135_269_3.30.980.10 Alpha Beta;2-Layer Sandwich;Threonyl-tRNA Synthetase; Chain A, domain 2;Threonyl-trna Synthetase; Chain A, domain 2 0.6241 2 38 3.30.980.10
1nrwA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.6152 12 50 3.40.50.1000
3fkfD00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.5461 9 51 3.40.30.10
af_G5ECV3_236_352_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.5406 9 50 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A537L3Y8-F1-model_v4 Uncharacterized protein 1.002 1 50
AF-A0A2V5XVS4-F1-model_v4 Uncharacterized protein 0.9567 1 58
AF-A0A7Z0TRP6-F1-model_v4 DUF2188 domain-containing protein 0.9465 1 58
AF-A0A6N6ZMF4-F1-model_v4 deleted 0.9431 2 50
AF-A0A537PXX7-F1-model_v4 Uncharacterized protein 0.9424 1 61

Map