F473934

General Info

Members Datasets Scaffolds Average Seq Length
668 220 666 178

Family's Representative Sequence

Representative Sequence 3300031824|Ga0307413_10008914|Ga0307413_100089145
Length 180
Sequence VAIDPERAFKPLNIALLTVSDTRTEADDTSGDILAERIAAAGHNLAARAIERDVVPALVARLSNWIDDPAIDCVISTGGTGLTGRDVTPEALERIKESGDSRDIPGFGELFRWLSYQTIGASTVQSRAMAVLARGTYIFALPGSNGAVKDGWDLILAEQLDSRNRPCNFVDLMPRLREQR

Samples

Sample ID Description Type Environment
1 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber
2 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
66 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
147 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
148 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
149 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
150 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
151 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
152 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
153 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
154 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
155 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
156 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
157 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
158 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
159 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
160 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
161 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
162 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
163 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
164 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
165 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
166 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
167 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
168 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
169 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
170 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
171 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
172 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
173 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
174 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
175 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
176 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
177 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
178 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
179 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
180 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
181 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
182 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
183 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
184 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
185 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
186 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
187 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
188 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
189 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
190 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
191 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
192 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
193 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
194 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
195 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
196 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
197 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
198 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
199 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
200 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
201 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
202 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
203 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
204 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
205 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
206 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
207 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
208 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
209 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
210 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
211 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
212 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
213 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
217 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
218 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
219 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
220 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.95
Metatranscriptomes 0.75
Isolates 0.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.3
Nodule 0
Rhizoplane 2.25
Rhizosphere 96.41
Stem 0
Stem Tuber 0.15
Unclassified 0.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1000429 3300001904 Bacteria 7898
2 JGI24740J21852_10034310 3300001979 Bacteria 1600
3 JGI24740J21852_10036549 3300001979 Bacteria 1525
4 JGI24739J22299_10075657 3300001989 Bacteria 1040
5 JGI24739J22299_10081554 3300001989 Bacteria 993
6 JGI24737J22298_10002041 3300001990 Bacteria 7225
7 JGI24737J22298_10012796 3300001990 Bacteria 2735
8 JGI24735J21928_10005786 3300002067 Bacteria 4090
9 JGI24735J21928_10118969 3300002067 Bacteria 760
10 rootH1_10039483 3300003323 Unclassified 1308
11 rootH1_10103011 3300003323 Bacteria 5509
12 Ga0065712_10086820 3300005290 Bacteria 2602
13 Ga0065707_10691866 3300005295 Bacteria 643
14 Ga0070658_10003637 3300005327 Bacteria 12625
15 Ga0070658_10006930 3300005327 Bacteria 9152
16 Ga0070658_10026798 3300005327 Bacteria 4627
17 Ga0070658_10043380 3300005327 Bacteria 3633
18 Ga0070658_10065768 3300005327 Bacteria 2960
19 Ga0070658_10104580 3300005327 Bacteria 2342
20 Ga0070658_10222545 3300005327 Bacteria 1596
21 Ga0070658_10278884 3300005327 Bacteria 1422
22 Ga0070658_10329252 3300005327 Bacteria 1305
23 Ga0070658_10704565 3300005327 Bacteria 876
24 Ga0070676_10063300 3300005328 Bacteria 2203
25 Ga0070676_10077480 3300005328 Bacteria 2009
26 Ga0070676_10086551 3300005328 Bacteria 1911
27 Ga0070676_10191116 3300005328 Bacteria 1337
28 Ga0070676_10196780 3300005328 Bacteria 1319
29 Ga0070683_100011628 3300005329 Bacteria 7618
30 Ga0070683_100014144 3300005329 Bacteria 6971
31 Ga0070683_100084678 3300005329 Bacteria 2971
32 Ga0070690_100020192 3300005330 Bacteria 4057
33 Ga0070670_100047097 3300005331 Bacteria 3709
34 Ga0070670_100352182 3300005331 Bacteria 1294
35 Ga0070670_100419596 3300005331 Bacteria 1183
36 Ga0068869_100551511 3300005334 Bacteria 968
37 Ga0070666_10000205 3300005335 Bacteria 40586
38 Ga0070666_10010766 3300005335 Bacteria 5723
39 Ga0070666_10117471 3300005335 Bacteria 1842
40 Ga0070666_10266774 3300005335 Bacteria 1215
41 Ga0070680_100000229 3300005336 Bacteria 37007
42 Ga0070680_100005897 3300005336 Bacteria 9302
43 Ga0070680_100490581 3300005336 Bacteria 1050
44 Ga0070680_101476148 3300005336 Bacteria 589
45 Ga0068868_100025077 3300005338 Bacteria 4529
46 Ga0068868_100167222 3300005338 Bacteria 1819
47 Ga0068868_100291857 3300005338 Unclassified 1383
48 Ga0070660_100001180 3300005339 Bacteria 17685
49 Ga0070660_100002854 3300005339 Bacteria 11896
50 Ga0070660_100010429 3300005339 Bacteria 6564
51 Ga0070660_100015550 3300005339 Bacteria 5498
52 Ga0070660_100015669 3300005339 Bacteria 5480
53 Ga0070660_100023169 3300005339 Bacteria 4599
54 Ga0070660_100133785 3300005339 Bacteria 1986
55 Ga0070660_100148585 3300005339 Bacteria 1883
56 Ga0070660_100153074 3300005339 Bacteria 1855
57 Ga0070660_100157167 3300005339 Bacteria 1831
58 Ga0070660_100228579 3300005339 Bacteria 1513
59 Ga0070660_100263971 3300005339 Bacteria 1406
60 Ga0070660_100861495 3300005339 Bacteria 763
61 Ga0070689_100644550 3300005340 Bacteria 921
62 Ga0070691_10160898 3300005341 Bacteria 1157
63 Ga0070687_100720546 3300005343 Bacteria 699
64 Ga0070661_100014911 3300005344 Bacteria 5481
65 Ga0070661_100038190 3300005344 Bacteria 3495
66 Ga0070661_100038774 3300005344 Bacteria 3470
67 Ga0070661_100041395 3300005344 Bacteria 3362
68 Ga0070661_100256212 3300005344 Bacteria 1352
69 Ga0070661_100543748 3300005344 Bacteria 934
70 Ga0070661_100577890 3300005344 Bacteria 906
71 Ga0070661_101093944 3300005344 Bacteria 664
72 Ga0070692_10415980 3300005345 Bacteria 852
73 Ga0070668_100000700 3300005347 Bacteria 22895
74 Ga0070668_100591003 3300005347 Bacteria 970
75 Ga0070669_100005914 3300005353 Bacteria 8829
76 Ga0070675_100287515 3300005354 Bacteria 1446
77 Ga0070671_100000133 3300005355 Bacteria 47555
78 Ga0070674_100021297 3300005356 Bacteria 4157
79 Ga0070674_100053278 3300005356 Bacteria 2792
80 Ga0070674_100538326 3300005356 Bacteria 978
81 Ga0070673_100006883 3300005364 Bacteria 7437
82 Ga0070673_100206422 3300005364 Bacteria 1694
83 Ga0070673_100597302 3300005364 Bacteria 1006
84 Ga0070673_100650950 3300005364 Bacteria 964
85 Ga0070673_100717872 3300005364 Bacteria 919
86 Ga0070673_100974843 3300005364 Bacteria 788
87 Ga0070659_100010839 3300005366 Bacteria 6720
88 Ga0070659_100027397 3300005366 Bacteria 4391
89 Ga0070659_100052396 3300005366 Bacteria 3209
90 Ga0070659_100091603 3300005366 Bacteria 2437
91 Ga0070659_100100363 3300005366 Bacteria 2329
92 Ga0070659_100129935 3300005366 Bacteria 2045
93 Ga0070659_100135475 3300005366 Bacteria 2002
94 Ga0070659_100280346 3300005366 Bacteria 1386
95 Ga0070659_100558587 3300005366 Unclassified 980
96 Ga0070659_100892757 3300005366 Bacteria 776
97 Ga0070667_100000117 3300005367 Bacteria 100684
98 Ga0070667_100076907 3300005367 Bacteria 2850
99 Ga0070667_100081100 3300005367 Bacteria 2776
100 Ga0070667_100198814 3300005367 Bacteria 1778
101 Ga0070667_100370723 3300005367 Bacteria 1299
102 Ga0070667_100394795 3300005367 Bacteria 1258
103 Ga0070709_10006547 3300005434 Bacteria 6352
104 Ga0070714_100016021 3300005435 Bacteria 6043
105 Ga0070714_100026448 3300005435 Bacteria 4796
106 Ga0070714_100088232 3300005435 Bacteria 2714
107 Ga0070713_100215799 3300005436 Bacteria 1739
108 Ga0070663_100003630 3300005455 Bacteria 8928
109 Ga0070663_100011822 3300005455 Bacteria 5498
110 Ga0070663_100018751 3300005455 Bacteria 4544
111 Ga0070663_100325918 3300005455 Bacteria 1236
112 Ga0070678_100006084 3300005456 Bacteria 7043
113 Ga0070678_100008440 3300005456 Bacteria 6171
114 Ga0070678_101005326 3300005456 Bacteria 767
115 Ga0070662_100033639 3300005457 Bacteria 3611
116 Ga0070662_100052944 3300005457 Bacteria 2937
117 Ga0070662_100053666 3300005457 Bacteria 2918
118 Ga0070662_100125597 3300005457 Bacteria 1971
119 Ga0070662_100272819 3300005457 Bacteria 1366
120 Ga0070681_10971914 3300005458 Bacteria 769
121 Ga0068867_100025826 3300005459 Bacteria 4213
122 Ga0070685_10169273 3300005466 Bacteria 1399
123 Ga0070679_100020999 3300005530 Bacteria 6372
124 Ga0070679_100413858 3300005530 Bacteria 1294
125 Ga0070679_100738186 3300005530 Bacteria 927
126 Ga0070679_100829586 3300005530 Bacteria 868
127 Ga0070684_100091522 3300005535 Bacteria 2706
128 Ga0070684_100560127 3300005535 Bacteria 1061
129 Ga0068853_100000058 3300005539 Bacteria 78682
130 Ga0068853_100054142 3300005539 Bacteria 3457
131 Ga0068853_100123718 3300005539 Bacteria 2310
132 Ga0068853_100187006 3300005539 Bacteria 1880
133 Ga0068853_100412658 3300005539 Bacteria 1265
134 Ga0070672_100010294 3300005543 Bacteria 6480
135 Ga0070672_100029023 3300005543 Bacteria 4143
136 Ga0070672_100070995 3300005543 Bacteria 2769
137 Ga0070672_100103892 3300005543 Bacteria 2308
138 Ga0070672_100462297 3300005543 Bacteria 1094
139 Ga0070672_100609855 3300005543 Bacteria 951
140 Ga0070686_100012937 3300005544 Bacteria 4765
141 Ga0070665_100084998 3300005548 Bacteria 3169
142 Ga0070665_101000571 3300005548 Unclassified 848
143 Ga0068855_100000348 3300005563 Bacteria 57384
144 Ga0068855_100001283 3300005563 Bacteria 31121
145 Ga0068855_100007269 3300005563 Bacteria 13421
146 Ga0068855_100069229 3300005563 Bacteria 4107
147 Ga0068855_100670192 3300005563 Bacteria 1112
148 Ga0070664_100011148 3300005564 Bacteria 7290
149 Ga0070664_100014737 3300005564 Bacteria 6384
150 Ga0070664_100064168 3300005564 Bacteria 3132
151 Ga0070664_100130761 3300005564 Bacteria 2205
152 Ga0070664_100181732 3300005564 Bacteria 1869
153 Ga0070664_100292712 3300005564 Unclassified 1470
154 Ga0070664_100613787 3300005564 Unclassified 1009
155 Ga0070664_100644929 3300005564 Bacteria 984
156 Ga0068857_100012184 3300005577 Bacteria 7478
157 Ga0068857_100018460 3300005577 Bacteria 6118
158 Ga0068857_100202379 3300005577 Bacteria 1810
159 Ga0068854_100017544 3300005578 Bacteria 4790
160 Ga0068854_100083528 3300005578 Bacteria 2361
161 Ga0068854_100097771 3300005578 Bacteria 2195
162 Ga0068854_100106041 3300005578 Bacteria 2113
163 Ga0068854_100464728 3300005578 Bacteria 1059
164 Ga0068856_100004010 3300005614 Bacteria 14744
165 Ga0068856_100015637 3300005614 Bacteria 7335
166 Ga0068856_100029419 3300005614 Bacteria 5366
167 Ga0068856_100072266 3300005614 Bacteria 3415
168 Ga0068856_100073402 3300005614 Bacteria 3388
169 Ga0068856_100106988 3300005614 Bacteria 2792
170 Ga0068856_100658372 3300005614 Bacteria 1068
171 Ga0070702_100269024 3300005615 Bacteria 1164
172 Ga0070702_100716648 3300005615 Bacteria 764
173 Ga0068852_100007749 3300005616 Bacteria 7856
174 Ga0068852_100013576 3300005616 Bacteria 6235
175 Ga0068852_100590696 3300005616 Bacteria 1114
176 Ga0068852_100679190 3300005616 Bacteria 1039
177 Ga0068852_100988400 3300005616 Bacteria 860
178 Ga0068852_101014038 3300005616 Bacteria 849
179 Ga0068852_101165336 3300005616 Bacteria 791
180 Ga0068859_100080429 3300005617 Bacteria 3299
181 Ga0068859_100091900 3300005617 Bacteria 3086
182 Ga0068859_100246090 3300005617 Bacteria 1878
183 Ga0068864_100007806 3300005618 Bacteria 8814
184 Ga0068864_101899621 3300005618 Bacteria 601
185 Ga0068866_10175585 3300005718 Bacteria 1261
186 Ga0068851_10098093 3300005834 Bacteria 1551
187 Ga0068851_10110499 3300005834 Bacteria 1467
188 Ga0068863_100000055 3300005841 Bacteria 124300
189 Ga0068863_100001458 3300005841 Bacteria 23454
190 Ga0068863_100652043 3300005841 Bacteria 1044
191 Ga0068858_100000980 3300005842 Bacteria 29457
192 Ga0068858_100038150 3300005842 Bacteria 4456
193 Ga0068858_100491907 3300005842 Bacteria 1184
194 Ga0068860_100015091 3300005843 Bacteria 7549
195 Ga0068862_100251333 3300005844 Bacteria 1611
196 Ga0070717_10030870 3300006028 Bacteria 4306
197 Ga0070715_10224231 3300006163 Bacteria 968
198 Ga0070712_100032304 3300006175 Bacteria 3534
199 Ga0097621_100181608 3300006237 Unclassified 1818
200 Ga0068871_100363612 3300006358 Unclassified 1282
201 Ga0068865_100079405 3300006881 Bacteria 2350
202 Ga0097620_100080427 3300006931 Bacteria 3299
203 Ga0097620_100091903 3300006931 Bacteria 3086
204 Ga0097620_100246085 3300006931 Bacteria 1878
205 Ga0105240_10076863 3300009093 Bacteria 4115
206 Ga0105240_10137255 3300009093 Bacteria 2928
207 Ga0105240_10232742 3300009093 Bacteria 2140
208 Ga0105240_10664599 3300009093 Bacteria 1141
209 Ga0105245_10059460 3300009098 Bacteria 3442
210 Ga0105245_10085636 3300009098 Bacteria 2889
211 Ga0105245_10104779 3300009098 Bacteria 2623
212 Ga0105243_11271993 3300009148 Bacteria 752
213 Ga0105241_10121991 3300009174 Bacteria 2100
214 Ga0105241_10921215 3300009174 Bacteria 813
215 Ga0105242_10004126 3300009176 Bacteria 11307
216 Ga0105248_10000390 3300009177 Bacteria 50573
217 Ga0105248_10037274 3300009177 Bacteria 5440
218 Ga0105248_10248704 3300009177 Bacteria 2001
219 Ga0105248_10339606 3300009177 Unclassified 1691
220 Ga0105237_10171582 3300009545 Bacteria 2169
221 Ga0105237_10555137 3300009545 Bacteria 1155
222 Ga0105237_10599276 3300009545 Bacteria 1109
223 Ga0105238_10006826 3300009551 Bacteria 11397
224 Ga0105238_10065141 3300009551 Bacteria 3645
225 Ga0105238_10630096 3300009551 Bacteria 1081
226 Ga0105239_10076898 3300010375 Bacteria 3672
227 Ga0105239_10988155 3300010375 Bacteria 967
228 Ga0105239_12026330 3300010375 Bacteria 668
229 Ga0105246_10100291 3300011119 Bacteria 2107
230 Ga0105246_10329691 3300011119 Unclassified 1243
231 Ga0157373_10032949 3300013100 Bacteria 3729
232 Ga0157373_10059212 3300013100 Bacteria 2714
233 Ga0157373_10075267 3300013100 Bacteria 2382
234 Ga0157373_10079476 3300013100 Bacteria 2313
235 Ga0157373_10432155 3300013100 Bacteria 946
236 Ga0157373_10469705 3300013100 Bacteria 907
237 Ga0157371_10005915 3300013102 Bacteria 10216
238 Ga0157371_10010609 3300013102 Bacteria 7159
239 Ga0157371_10057924 3300013102 Bacteria 2748
240 Ga0157371_10065528 3300013102 Bacteria 2573
241 Ga0157371_10099661 3300013102 Bacteria 2060
242 Ga0157371_10167827 3300013102 Bacteria 1568
243 Ga0157370_10000707 3300013104 Bacteria 41767
244 Ga0157370_10012615 3300013104 Bacteria 8757
245 Ga0157370_10015729 3300013104 Bacteria 7682
246 Ga0157370_10018879 3300013104 Bacteria 6934
247 Ga0157370_10023637 3300013104 Bacteria 6099
248 Ga0157370_10088985 3300013104 Bacteria 2900
249 Ga0157370_10318992 3300013104 Bacteria 1433
250 Ga0157370_10370878 3300013104 Bacteria 1319
251 Ga0157370_10752734 3300013104 Bacteria 888
252 Ga0157370_11256871 3300013104 Unclassified 667
253 Ga0157369_10000137 3300013105 Bacteria 103542
254 Ga0157369_10002106 3300013105 Bacteria 23991
255 Ga0157369_10036957 3300013105 Bacteria 5350
256 Ga0157369_10039374 3300013105 Bacteria 5166
257 Ga0157369_10065692 3300013105 Bacteria 3904
258 Ga0157369_10091987 3300013105 Bacteria 3237
259 Ga0157374_10001339 3300013296 Bacteria 20962
260 Ga0157378_10006347 3300013297 Bacteria 10344
261 Ga0157378_10129939 3300013297 Bacteria 2331
262 Ga0163162_10104187 3300013306 Bacteria 2931
263 Ga0163162_10239930 3300013306 Bacteria 1943
264 Ga0163162_11593364 3300013306 Bacteria 745
265 Ga0157372_10165332 3300013307 Bacteria 2558
266 Ga0157372_10284898 3300013307 Bacteria 1921
267 Ga0157372_10285671 3300013307 Bacteria 1919
268 Ga0157372_10377676 3300013307 Bacteria 1651
269 Ga0157372_12075827 3300013307 Bacteria 653
270 Ga0157372_12538658 3300013307 Bacteria 588
271 Ga0157372_13002186 3300013307 Bacteria 539
272 Ga0157375_10155699 3300013308 Bacteria 2424
273 Ga0157375_10205780 3300013308 Bacteria 2124
274 Ga0157375_10250098 3300013308 Bacteria 1933
275 Ga0157375_11338914 3300013308 Bacteria 842
276 Ga0163163_10015746 3300014325 Bacteria 7002
277 Ga0163163_10669989 3300014325 Bacteria 1101
278 Ga0157377_11245424 3300014745 Bacteria 578
279 Ga0157379_10020058 3300014968 Bacteria 5908
280 Ga0157376_10089097 3300014969 Bacteria 2667
281 Ga0183365_10008 3300015684 Bacteria 74681
282 Ga0163161_10143576 3300017792 Bacteria 1809
283 Ga0163161_10347628 3300017792 Bacteria 1178
284 Ga0163161_10790265 3300017792 Unclassified 797
285 Ga0206354_10753768 3300020081 Bacteria 1032
286 Ga0206354_11008188 3300020081 Bacteria 2906
287 Ga0206353_10094556 3300020082 Bacteria 3188
288 Ga0206353_10123983 3300020082 Bacteria 1733
289 Ga0206353_11094556 3300020082 Bacteria 1759
290 Ga0207697_10019218 3300025315 Bacteria 2799
291 Ga0207656_10224857 3300025321 Bacteria 913
292 Ga0207680_10000414 3300025903 Bacteria 20344
293 Ga0207680_10001382 3300025903 Bacteria 11472
294 Ga0207680_10003973 3300025903 Bacteria 6982
295 Ga0207680_10025601 3300025903 Bacteria 3256
296 Ga0207680_10225350 3300025903 Bacteria 1287
297 Ga0207680_10434638 3300025903 Bacteria 931
298 Ga0207647_10026260 3300025904 Bacteria 3813
299 Ga0207647_10029155 3300025904 Bacteria 3575
300 Ga0207647_10030910 3300025904 Bacteria 3451
301 Ga0207647_10090103 3300025904 Bacteria 1830
302 Ga0207647_10149082 3300025904 Bacteria 1368
303 Ga0207647_10250402 3300025904 Bacteria 1016
304 Ga0207645_10030642 3300025907 Bacteria 3466
305 Ga0207705_10000208 3300025909 Bacteria 59559
306 Ga0207705_10000569 3300025909 Bacteria 30895
307 Ga0207705_10001953 3300025909 Bacteria 16079
308 Ga0207705_10004281 3300025909 Bacteria 10809
309 Ga0207705_10009606 3300025909 Bacteria 7035
310 Ga0207705_10034262 3300025909 Bacteria 3630
311 Ga0207705_10129447 3300025909 Bacteria 1877
312 Ga0207705_10190726 3300025909 Bacteria 1550
313 Ga0207705_10231948 3300025909 Bacteria 1404
314 Ga0207705_10252505 3300025909 Bacteria 1345
315 Ga0207705_10352704 3300025909 Bacteria 1134
316 Ga0207705_10404833 3300025909 Bacteria 1055
317 Ga0207707_10814054 3300025912 Bacteria 777
318 Ga0207695_10057126 3300025913 Bacteria 4056
319 Ga0207695_10332570 3300025913 Bacteria 1407
320 Ga0207695_10407687 3300025913 Bacteria 1243
321 Ga0207695_10663617 3300025913 Bacteria 924
322 Ga0207671_10222140 3300025914 Bacteria 1480
323 Ga0207660_10012190 3300025917 Bacteria 5618
324 Ga0207657_10000284 3300025919 Bacteria 53982
325 Ga0207657_10000675 3300025919 Bacteria 36346
326 Ga0207657_10008334 3300025919 Bacteria 10536
327 Ga0207657_10009137 3300025919 Bacteria 10001
328 Ga0207657_10009904 3300025919 Bacteria 9541
329 Ga0207657_10021076 3300025919 Bacteria 6143
330 Ga0207657_10036695 3300025919 Bacteria 4384
331 Ga0207657_10052475 3300025919 Bacteria 3538
332 Ga0207657_10089674 3300025919 Bacteria 2568
333 Ga0207657_10170312 3300025919 Bacteria 1764
334 Ga0207657_10691925 3300025919 Bacteria 792
335 Ga0207649_10000557 3300025920 Bacteria 25678
336 Ga0207649_10032676 3300025920 Bacteria 3104
337 Ga0207649_10045078 3300025920 Unclassified 2702
338 Ga0207649_10185967 3300025920 Bacteria 1457
339 Ga0207649_10667738 3300025920 Bacteria 804
340 Ga0207649_11055863 3300025920 Bacteria 640
341 Ga0207652_10001035 3300025921 Bacteria 25477
342 Ga0207681_10004130 3300025923 Bacteria 9003
343 Ga0207694_10018805 3300025924 Bacteria 5223
344 Ga0207694_10020530 3300025924 Bacteria 4999
345 Ga0207650_10078405 3300025925 Bacteria 2499
346 Ga0207650_10287878 3300025925 Bacteria 1339
347 Ga0207659_10436108 3300025926 Bacteria 1101
348 Ga0207659_11067294 3300025926 Bacteria 695
349 Ga0207687_10066102 3300025927 Bacteria 2569
350 Ga0207664_10020477 3300025929 Bacteria 4904
351 Ga0207664_10079710 3300025929 Bacteria 2659
352 Ga0207664_10082899 3300025929 Bacteria 2613
353 Ga0207664_10112666 3300025929 Bacteria 2265
354 Ga0207644_10000256 3300025931 Bacteria 35858
355 Ga0207644_10014676 3300025931 Bacteria 5248
356 Ga0207690_10022165 3300025932 Bacteria 3948
357 Ga0207690_10023874 3300025932 Bacteria 3823
358 Ga0207690_10091252 3300025932 Bacteria 2153
359 Ga0207690_10247788 3300025932 Bacteria 1375
360 Ga0207690_10251849 3300025932 Bacteria 1364
361 Ga0207690_10324942 3300025932 Bacteria 1210
362 Ga0207706_10003671 3300025933 Bacteria 14655
363 Ga0207706_10006585 3300025933 Bacteria 10758
364 Ga0207706_10010427 3300025933 Bacteria 8490
365 Ga0207706_10052626 3300025933 Bacteria 3594
366 Ga0207706_10059300 3300025933 Bacteria 3370
367 Ga0207706_10075634 3300025933 Bacteria 2962
368 Ga0207706_10095362 3300025933 Bacteria 2617
369 Ga0207706_10135484 3300025933 Bacteria 2166
370 Ga0207669_10012758 3300025937 Bacteria 4144
371 Ga0207669_10014624 3300025937 Bacteria 3938
372 Ga0207669_10020519 3300025937 Bacteria 3468
373 Ga0207669_10106458 3300025937 Unclassified 1868
374 Ga0207669_11215986 3300025937 Bacteria 638
375 Ga0207704_10010644 3300025938 Bacteria 4495
376 Ga0207704_10105059 3300025938 Bacteria 1893
377 Ga0207691_10008045 3300025940 Bacteria 10136
378 Ga0207691_10083093 3300025940 Unclassified 2875
379 Ga0207691_10090488 3300025940 Bacteria 2743
380 Ga0207691_10099955 3300025940 Bacteria 2590
381 Ga0207691_10453936 3300025940 Bacteria 1090
382 Ga0207711_10000190 3300025941 Bacteria 65723
383 Ga0207711_10105909 3300025941 Bacteria 2494
384 Ga0207661_10045438 3300025944 Bacteria 3476
385 Ga0207679_10064198 3300025945 Bacteria 2743
386 Ga0207679_10183901 3300025945 Bacteria 1731
387 Ga0207679_10190858 3300025945 Bacteria 1703
388 Ga0207679_10260649 3300025945 Bacteria 1478
389 Ga0207679_10517562 3300025945 Bacteria 1067
390 Ga0207667_10004351 3300025949 Bacteria 17344
391 Ga0207667_10007154 3300025949 Bacteria 13474
392 Ga0207667_10010782 3300025949 Bacteria 10661
393 Ga0207667_10074317 3300025949 Bacteria 3531
394 Ga0207667_10427171 3300025949 Bacteria 1348
395 Ga0207667_10541057 3300025949 Bacteria 1178
396 Ga0207651_10001768 3300025960 Bacteria 10020
397 Ga0207651_10036455 3300025960 Bacteria 3210
398 Ga0207651_10132358 3300025960 Bacteria 1911
399 Ga0207651_10133968 3300025960 Unclassified 1902
400 Ga0207651_10650291 3300025960 Bacteria 925
401 Ga0207668_10000373 3300025972 Bacteria 28446
402 Ga0207640_10019668 3300025981 Bacteria 3994
403 Ga0207640_10184268 3300025981 Bacteria 1568
404 Ga0207640_10254002 3300025981 Bacteria 1366
405 Ga0207640_10257768 3300025981 Bacteria 1357
406 Ga0207640_10295782 3300025981 Bacteria 1278
407 Ga0207640_10424317 3300025981 Bacteria 1089
408 Ga0207658_10000087 3300025986 Bacteria 100698
409 Ga0207658_10002604 3300025986 Bacteria 13094
410 Ga0207658_10237211 3300025986 Bacteria 1543
411 Ga0207658_10315052 3300025986 Bacteria 1352
412 Ga0207677_10005685 3300026023 Bacteria 6785
413 Ga0207677_10006502 3300026023 Bacteria 6421
414 Ga0207677_10054390 3300026023 Bacteria 2731
415 Ga0207703_10000461 3300026035 Bacteria 42797
416 Ga0207703_10026919 3300026035 Bacteria 4529
417 Ga0207639_10000089 3300026041 Bacteria 77190
418 Ga0207639_10072226 3300026041 Bacteria 2701
419 Ga0207639_10161790 3300026041 Bacteria 1887
420 Ga0207639_10225255 3300026041 Bacteria 1622
421 Ga0207678_10000325 3300026067 Bacteria 42910
422 Ga0207678_10004910 3300026067 Bacteria 12012
423 Ga0207678_10018428 3300026067 Bacteria 6130
424 Ga0207678_10042735 3300026067 Bacteria 3924
425 Ga0207678_10523236 3300026067 Unclassified 1035
426 Ga0207702_10015224 3300026078 Bacteria 6376
427 Ga0207702_10022337 3300026078 Bacteria 5244
428 Ga0207702_10032441 3300026078 Bacteria 4358
429 Ga0207702_10068689 3300026078 Bacteria 3045
430 Ga0207702_10070541 3300026078 Unclassified 3005
431 Ga0207702_10312565 3300026078 Bacteria 1494
432 Ga0207702_10383385 3300026078 Bacteria 1352
433 Ga0207702_10456706 3300026078 Bacteria 1240
434 Ga0207702_10553182 3300026078 Bacteria 1126
435 Ga0207702_10823353 3300026078 Bacteria 918
436 Ga0207641_10000110 3300026088 Bacteria 120617
437 Ga0207641_10050188 3300026088 Bacteria 3529
438 Ga0207648_10008490 3300026089 Bacteria 9939
439 Ga0207676_10250357 3300026095 Bacteria 1594
440 Ga0207674_10000271 3300026116 Bacteria 65366
441 Ga0207674_10004818 3300026116 Bacteria 16165
442 Ga0207674_10025787 3300026116 Bacteria 6260
443 Ga0207674_10034276 3300026116 Bacteria 5310
444 Ga0207674_10101061 3300026116 Bacteria 2865
445 Ga0207674_10692424 3300026116 Bacteria 984
446 Ga0207675_100238187 3300026118 Bacteria 1758
447 Ga0207675_100487239 3300026118 Bacteria 1226
448 Ga0207683_10000721 3300026121 Bacteria 30084
449 Ga0207683_10001875 3300026121 Bacteria 18598
450 Ga0207683_11307136 3300026121 Bacteria 671
451 Ga0207698_10007075 3300026142 Bacteria 7027
452 Ga0207698_10080557 3300026142 Bacteria 2623
453 Ga0207698_10109516 3300026142 Bacteria 2311
454 Ga0207698_10431231 3300026142 Bacteria 1268
455 Ga0268266_10044210 3300028379 Bacteria 3807
456 Ga0268266_10172656 3300028379 Bacteria 1963
457 Ga0268265_10040794 3300028380 Bacteria 3430
458 Ga0268264_10017033 3300028381 Bacteria 5950
459 Ga0307408_100044148 3300031548 Bacteria 3175
460 Ga0307408_100213436 3300031548 Bacteria 1570
461 Ga0307408_100566687 3300031548 Bacteria 1004
462 Ga0307408_100729657 3300031548 Bacteria 893
463 Ga0307405_10243942 3300031731 Bacteria 1332
464 Ga0307405_10304030 3300031731 Bacteria 1211
465 Ga0307405_11161715 3300031731 Bacteria 666
466 Ga0307413_10008914 3300031824 Bacteria 4767
467 Ga0307413_10035806 3300031824 Bacteria 2851
468 Ga0307413_10130455 3300031824 Bacteria 1719
469 Ga0307413_10189860 3300031824 Bacteria 1474
470 Ga0307413_10228074 3300031824 Bacteria 1366
471 Ga0307410_10024280 3300031852 Bacteria 3785
472 Ga0307410_10026955 3300031852 Bacteria 3625
473 Ga0307410_10164561 3300031852 Bacteria 1665
474 Ga0307410_10223589 3300031852 Bacteria 1449
475 Ga0307410_10615464 3300031852 Bacteria 907
476 Ga0307410_10793464 3300031852 Bacteria 805
477 Ga0307406_10047607 3300031901 Bacteria 2703
478 Ga0307407_10008712 3300031903 Bacteria 4675
479 Ga0307407_10743834 3300031903 Bacteria 742
480 Ga0307412_10160530 3300031911 Bacteria 1669
481 Ga0307412_10228457 3300031911 Bacteria 1431
482 Ga0307409_100038091 3300031995 Bacteria 3552
483 Ga0307409_100058450 3300031995 Bacteria 2995
484 Ga0307409_100216086 3300031995 Bacteria 1727
485 Ga0307409_100339536 3300031995 Bacteria 1413
486 Ga0307409_100806281 3300031995 Bacteria 947
487 Ga0307416_100008755 3300032002 Bacteria 6558
488 Ga0307416_100124409 3300032002 Bacteria 2307
489 Ga0307416_101319254 3300032002 Bacteria 827
490 Ga0307416_102717469 3300032002 Bacteria 591
491 Ga0307414_10061944 3300032004 Bacteria 2652
492 Ga0307414_10066601 3300032004 Bacteria 2576
493 Ga0307414_10329463 3300032004 Bacteria 1303
494 Ga0307414_10376929 3300032004 Bacteria 1225
495 Ga0307414_10516567 3300032004 Bacteria 1059
496 Ga0307411_10085846 3300032005 Bacteria 2181
497 Ga0307411_10124749 3300032005 Bacteria 1870
498 Ga0307411_10480429 3300032005 Bacteria 1046
499 Ga0307411_10749717 3300032005 Bacteria 855
500 Ga0307415_100001996 3300032126 Bacteria 10039
501 Ga0307415_100286122 3300032126 Bacteria 1358
502 Ga0373940_0105209 3300035088 Bacteria 861
503 Ga0373960_0105963 3300035121 Bacteria 917
504 Ga0373943_0027220 3300035170 Bacteria 2684
505 Ga0373943_0088509 3300035170 Bacteria 1600
506 Ga0373946_0072105 3300035171 Bacteria 1494
507 Ga0373931_0024649 3300035691 Bacteria 3050
508 Ga0373935_0025894 3300035692 Bacteria 3616
509 Ga0373935_0864009 3300035692 Bacteria 669
510 Ga0373927_0073121 3300035695 Bacteria 2220
511 Ga0373937_0706573 3300036401 Bacteria 955
512 Ga0373925_0156912 3300037068 Bacteria 1790
513 Ga0395899_0000162 3300037312 Bacteria 102362
514 Ga0395899_0003851 3300037312 Bacteria 11832
515 Ga0395899_0028386 3300037312 Bacteria 4214
516 Ga0395899_0045105 3300037312 Bacteria 3284
517 Ga0395899_0045872 3300037312 Bacteria 3256
518 Ga0395899_0054694 3300037312 Bacteria 2953
519 Ga0395899_0088836 3300037312 Bacteria 2242
520 Ga0395899_0110059 3300037312 Bacteria 1981
521 Ga0395899_0162586 3300037312 Bacteria 1576
522 Ga0395899_0174444 3300037312 Bacteria 1512
523 Ga0395899_0365590 3300037312 Bacteria 962
524 Ga0395899_0384809 3300037312 Bacteria 931
525 Ga0395899_0413942 3300037312 Bacteria 889
526 Ga0395899_0504765 3300037312 Bacteria 784
527 Ga0395900_0000129 3300037418 Bacteria 126281
528 Ga0395900_0000666 3300037418 Bacteria 45776
529 Ga0395900_0001095 3300037418 Bacteria 34481
530 Ga0395900_0007391 3300037418 Bacteria 11357
531 Ga0395900_0020412 3300037418 Bacteria 6764
532 Ga0395900_0022227 3300037418 Bacteria 6488
533 Ga0395900_0036019 3300037418 Bacteria 5099
534 Ga0395900_0041106 3300037418 Bacteria 4767
535 Ga0395900_0070992 3300037418 Bacteria 3579
536 Ga0395900_0078633 3300037418 Bacteria 3389
537 Ga0395900_0095368 3300037418 Bacteria 3057
538 Ga0395900_0109098 3300037418 Bacteria 2843
539 Ga0395900_0367236 3300037418 Bacteria 1409
540 Ga0395900_0452206 3300037418 Bacteria 1240
541 Ga0395900_0543798 3300037418 Bacteria 1107
542 Ga0395900_1003935 3300037418 Bacteria 754
543 Ga0395900_1005244 3300037418 Bacteria 754
544 Ga0395900_1140250 3300037418 Bacteria 696
545 Ga0395900_1147418 3300037418 Bacteria 693
546 Ga0395898_0001704 3300037466 Bacteria 29248
547 Ga0395898_0009787 3300037466 Bacteria 10046
548 Ga0395898_0041651 3300037466 Bacteria 4535
549 Ga0395898_0045291 3300037466 Bacteria 4325
550 Ga0395898_0055623 3300037466 Bacteria 3859
551 Ga0395898_0059310 3300037466 Bacteria 3723
552 Ga0395898_0062586 3300037466 Bacteria 3613
553 Ga0395898_0073614 3300037466 Bacteria 3300
554 Ga0395898_0083099 3300037466 Bacteria 3086
555 Ga0395898_0085965 3300037466 Bacteria 3031
556 Ga0395898_0088891 3300037466 Bacteria 2973
557 Ga0395898_0176370 3300037466 Bacteria 2043
558 Ga0395898_0712458 3300037466 Bacteria 945
559 Ga0395898_1311499 3300037466 Bacteria 653
560 Ga0395905_0001395 3300037471 Bacteria 29258
561 Ga0395905_0003061 3300037471 Bacteria 18107
562 Ga0395905_0014155 3300037471 Bacteria 7622
563 Ga0395905_0019204 3300037471 Bacteria 6481
564 Ga0395905_0055854 3300037471 Bacteria 3695
565 Ga0395905_0099581 3300037471 Bacteria 2730
566 Ga0395905_0166526 3300037471 Bacteria 2071
567 Ga0395905_0170237 3300037471 Bacteria 2046
568 Ga0395905_0173511 3300037471 Bacteria 2025
569 Ga0395905_0176567 3300037471 Bacteria 2005
570 Ga0395905_0183648 3300037471 Bacteria 1963
571 Ga0395905_0358615 3300037471 Bacteria 1350
572 Ga0395901_0000111 3300038443 Bacteria 112522
573 Ga0395901_0012693 3300038443 Bacteria 8546
574 Ga0395901_0015987 3300038443 Bacteria 7646
575 Ga0395901_0024546 3300038443 Bacteria 6190
576 Ga0395901_0035383 3300038443 Bacteria 5158
577 Ga0395901_0056099 3300038443 Bacteria 4098
578 Ga0395901_0078608 3300038443 Bacteria 3444
579 Ga0395901_0088862 3300038443 Bacteria 3232
580 Ga0395901_0127521 3300038443 Bacteria 2674
581 Ga0395901_0155006 3300038443 Bacteria 2406
582 Ga0395901_0203939 3300038443 Bacteria 2072
583 Ga0395901_0286757 3300038443 Bacteria 1709
584 Ga0395901_0400112 3300038443 Bacteria 1411
585 Ga0395901_0906881 3300038443 Bacteria 863
586 Ga0436363_0451272 3300039450 Bacteria 951
587 Ga0439465_0023521 3300041413 Bacteria 1939
588 Ga0451798_0398690 3300041458 Bacteria 765
589 Ga0451853_2987684 3300041512 Bacteria 823
590 Ga0439445_0003001 3300042004 Bacteria 3778
591 Ga0439458_0000647 3300042157 Bacteria 8989
592 Ga0466969_0008689 3300044656 Bacteria 5388
593 Ga0466969_0082581 3300044656 Bacteria 1531
594 Ga0466972_0023375 3300044658 Bacteria 3075
595 Ga0466972_0027190 3300044658 Bacteria 2831
596 Ga0466965_0125612 3300044683 Bacteria 1327
597 Ga0466966_0000026 3300044684 Bacteria 106896
598 Ga0466966_0018412 3300044684 Bacteria 4607
599 Ga0466966_0020740 3300044684 Bacteria 4319
600 Ga0466966_0073956 3300044684 Bacteria 2131
601 Ga0466966_0077307 3300044684 Bacteria 2077
602 Ga0466966_0092257 3300044684 Unclassified 1879
603 Ga0466961_0111094 3300044693 Bacteria 1724
604 Ga0466961_0140180 3300044693 Bacteria 1514
605 Ga0466961_0153201 3300044693 Bacteria 1438
606 Ga0466961_0173969 3300044693 Bacteria 1338
607 Ga0466963_0023556 3300044694 Bacteria 3911
608 Ga0466963_0101549 3300044694 Bacteria 1969
609 Ga0466964_0624972 3300044706 Unclassified 593
610 Ga0466971_0057327 3300044719 Bacteria 1757
611 Ga0466968_0013379 3300044735 Bacteria 3226
612 Ga0466970_0036825 3300044765 Bacteria 2592
613 Ga0466970_0089168 3300044765 Bacteria 1673
614 Ga0466970_0142602 3300044765 Bacteria 1320
615 Ga0466970_0390442 3300044765 Bacteria 793
616 Ga0466970_0443736 3300044765 Bacteria 743
617 Ga0466957_0048990 3300044842 Bacteria 2568
618 Ga0466957_0132580 3300044842 Bacteria 1598
619 Ga0466960_0176726 3300044901 Bacteria 1155
620 Ga0466959_0056375 3300045049 Bacteria 2867
621 Ga0466959_0060828 3300045049 Bacteria 2747
622 Ga0466959_0112786 3300045049 Bacteria 1939
623 Ga0466959_0185950 3300045049 Bacteria 1451
624 Ga0466958_0029167 3300045836 Bacteria 3273
625 Ga0466958_0037711 3300045836 Bacteria 2896
626 Ga0466958_0088413 3300045836 Bacteria 1914
627 Ga0466967_0040164 3300045976 Bacteria 4027
628 Ga0466967_0071169 3300045976 Bacteria 3113
629 Ga0466967_0129433 3300045976 Bacteria 2341
630 Ga0466967_0145350 3300045976 Bacteria 2212
631 Ga0466967_0240234 3300045976 Bacteria 1728
632 Ga0495650_0000759 3300046471 Bacteria 40294
633 Ga0495663_0007104 3300046525 Bacteria 3091
634 Ga0495663_0037337 3300046525 Bacteria 1465
635 Ga0495642_0010946 3300046528 Bacteria 3477
636 Ga0495642_0156517 3300046528 Bacteria 987
637 Ga0495598_0000126 3300046537 Bacteria 12859
638 Ga0495621_0000046 3300046539 Bacteria 24616
639 Ga0495669_0000394 3300046684 Bacteria 21743
640 Ga0495669_0093934 3300046684 Bacteria 1388
641 Ga0495670_0043527 3300046691 Bacteria 2240
642 Ga0495649_0117601 3300046694 Bacteria 1407
643 Ga0495677_0007021 3300047445 Bacteria 4220
644 Ga0496100_0001483 3300048903 Bacteria 11478
645 Ga0496102_0414065 3300048905 Bacteria 1266
646 Ga0496104_0126715 3300048907 Bacteria 2452
647 Ga0496105_0457882 3300048908 Bacteria 1006
648 Ga0496107_0035183 3300048910 Bacteria 3590
649 Ga0496108_0006078 3300048911 Bacteria 9762
650 Ga0496109_0951873 3300048912 Bacteria 796
651 Ga0496110_0002522 3300048913 Bacteria 13754
652 Ga0496111_0025728 3300048914 Bacteria 4152
653 Ga0496111_0356084 3300048914 Unclassified 1083
654 Ga0496112_0027081 3300048915 Bacteria 5525
655 Ga0496112_0179822 3300048915 Bacteria 2079
656 Ga0496112_0548645 3300048915 Bacteria 1090
657 Ga0496114_0000016 3300048917 Bacteria 274656
658 Ga0501031_0686881 3300049568 Bacteria 657
659 Ga0501033_0063644 3300049570 Bacteria 2715
660 Ga0501047_0995895 3300049581 Bacteria 651
661 Ga0501080_0253872 3300049742 Bacteria 1603
662 Ga0501035_0002613 3300049822 Bacteria 17571
663 Ga0500608_000251 3300053122 Bacteria 21005
664 Ga0500614_069827 3300053123 Bacteria 962
665 Ga0466962_0043867 3300061719 Bacteria 2140
666 Ga0466962_0328353 3300061719 Unclassified 759

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005344 Ga0070661_101093944 Ga0070661_1010939441 149
2 3300031731 Ga0307405_10304030 Ga0307405_103040302 150
3 3300031824 Ga0307413_10130455 Ga0307413_101304552 150
4 3300031852 Ga0307410_10223589 Ga0307410_102235892 150
5 3300031901 Ga0307406_10047607 Ga0307406_100476073 150
6 3300031995 Ga0307409_100058450 Ga0307409_1000584503 150
7 3300038443 Ga0395901_0906881 Ga0395901_0906881_232_732 155
8 3300025933 Ga0207706_10075634 Ga0207706_100756344 159
9 3300046471 Ga0495650_0000759 Ga0495650_0000759_8604_9140 159
10 3300044656 Ga0466969_0082581 Ga0466969_0082581_26_511 161
11 3300005347 Ga0070668_100000700 Ga0070668_1000007005 162
12 3300026118 Ga0207675_100238187 Ga0207675_1002381872 162
13 3300044706 Ga0466964_0624972 Ga0466964_0624972_15_503 162
14 3300005327 Ga0070658_10006930 Ga0070658_100069305 166
15 3300005339 Ga0070660_100001180 Ga0070660_1000011809 166
16 3300005563 Ga0068855_100000348 Ga0068855_10000034842 166
17 3300013102 Ga0157371_10005915 Ga0157371_100059156 166
18 3300013307 Ga0157372_13002186 Ga0157372_130021861 166
19 3300025909 Ga0207705_10000208 Ga0207705_1000020858 166
20 3300025919 Ga0207657_10009904 Ga0207657_100099046 166
21 3300025949 Ga0207667_10004351 Ga0207667_100043518 166
22 3300048915 Ga0496112_0548645 Ga0496112_0548645_20_520 166
23 3300031548 Ga0307408_100044148 Ga0307408_1000441481 167
24 3300032004 Ga0307414_10329463 Ga0307414_103294631 167
25 3300026116 Ga0207674_10692424 Ga0207674_106924242 168
26 3300005615 Ga0070702_100269024 Ga0070702_1002690242 169
27 iso_pu_bacteria 2885427238 2885429570 174
28 iso_pu_bacteria 2895880812 2895883340 174
29 3300005295 Ga0065707_10691866 Ga0065707_106918661 175
30 3300005343 Ga0070687_100720546 Ga0070687_1007205461 175
31 3300005841 Ga0068863_100652043 Ga0068863_1006520431 175
32 3300025912 Ga0207707_10814054 Ga0207707_108140542 176
33 3300031824 Ga0307413_10008914 Ga0307413_100089145 176
34 3300031852 Ga0307410_10793464 Ga0307410_107934642 176
35 3300005339 Ga0070660_100228579 Ga0070660_1002285792 177
36 3300032004 Ga0307414_10376929 Ga0307414_103769292 177
37 3300032004 Ga0307414_10516567 Ga0307414_105165672 177
38 3300032005 Ga0307411_10480429 Ga0307411_104804292 177
39 3300046694 Ga0495649_0117601 Ga0495649_0117601_294_839 177
40 3300001904 JGI24736J21556_1000429 JGI24736J21556_10004299 178
41 3300001979 JGI24740J21852_10034310 JGI24740J21852_100343102 178
42 3300001979 JGI24740J21852_10036549 JGI24740J21852_100365493 178
43 3300001989 JGI24739J22299_10075657 JGI24739J22299_100756572 178
44 3300001989 JGI24739J22299_10081554 JGI24739J22299_100815542 178
45 3300001990 JGI24737J22298_10002041 JGI24737J22298_100020416 178
46 3300001990 JGI24737J22298_10012796 JGI24737J22298_100127964 178
47 3300002067 JGI24735J21928_10005786 JGI24735J21928_100057864 178
48 3300002067 JGI24735J21928_10118969 JGI24735J21928_101189692 178
49 3300003323 rootH1_10039483 rootH1_100394832 178
50 3300003323 rootH1_10103011 rootH1_101030112 178
51 3300005290 Ga0065712_10086820 Ga0065712_100868204 178
52 3300005327 Ga0070658_10003637 Ga0070658_100036373 178
53 3300005327 Ga0070658_10026798 Ga0070658_100267983 178
54 3300005327 Ga0070658_10043380 Ga0070658_100433801 178
55 3300005327 Ga0070658_10065768 Ga0070658_100657685 178
56 3300005327 Ga0070658_10104580 Ga0070658_101045804 178
57 3300005327 Ga0070658_10222545 Ga0070658_102225452 178
58 3300005327 Ga0070658_10278884 Ga0070658_102788842 178
59 3300005327 Ga0070658_10329252 Ga0070658_103292523 178
60 3300005327 Ga0070658_10704565 Ga0070658_107045652 178
61 3300005328 Ga0070676_10063300 Ga0070676_100633004 178
62 3300005328 Ga0070676_10077480 Ga0070676_100774804 178
63 3300005328 Ga0070676_10086551 Ga0070676_100865511 178
64 3300005328 Ga0070676_10191116 Ga0070676_101911162 178
65 3300005328 Ga0070676_10196780 Ga0070676_101967802 178
66 3300005329 Ga0070683_100011628 Ga0070683_10001162812 178
67 3300005329 Ga0070683_100014144 Ga0070683_1000141448 178
68 3300005329 Ga0070683_100084678 Ga0070683_1000846783 178
69 3300005330 Ga0070690_100020192 Ga0070690_1000201923 178
70 3300005331 Ga0070670_100047097 Ga0070670_1000470973 178
71 3300005331 Ga0070670_100352182 Ga0070670_1003521822 178
72 3300005331 Ga0070670_100419596 Ga0070670_1004195962 178
73 3300005334 Ga0068869_100551511 Ga0068869_1005515112 178
74 3300005335 Ga0070666_10000205 Ga0070666_1000020531 178
75 3300005335 Ga0070666_10010766 Ga0070666_100107663 178
76 3300005335 Ga0070666_10117471 Ga0070666_101174712 178
77 3300005335 Ga0070666_10266774 Ga0070666_102667743 178
78 3300005336 Ga0070680_100000229 Ga0070680_10000022915 178
79 3300005336 Ga0070680_100005897 Ga0070680_10000589711 178
80 3300005336 Ga0070680_100490581 Ga0070680_1004905812 178
81 3300005336 Ga0070680_101476148 Ga0070680_1014761481 178
82 3300005338 Ga0068868_100025077 Ga0068868_1000250775 178
83 3300005338 Ga0068868_100167222 Ga0068868_1001672222 178
84 3300005338 Ga0068868_100291857 Ga0068868_1002918572 178
85 3300005339 Ga0070660_100002854 Ga0070660_1000028542 178
86 3300005339 Ga0070660_100010429 Ga0070660_1000104296 178
87 3300005339 Ga0070660_100015550 Ga0070660_1000155503 178
88 3300005339 Ga0070660_100015669 Ga0070660_1000156692 178
89 3300005339 Ga0070660_100023169 Ga0070660_1000231693 178
90 3300005339 Ga0070660_100133785 Ga0070660_1001337854 178
91 3300005339 Ga0070660_100148585 Ga0070660_1001485854 178
92 3300005339 Ga0070660_100153074 Ga0070660_1001530743 178
93 3300005339 Ga0070660_100157167 Ga0070660_1001571671 178
94 3300005339 Ga0070660_100263971 Ga0070660_1002639713 178
95 3300005339 Ga0070660_100861495 Ga0070660_1008614952 178
96 3300005340 Ga0070689_100644550 Ga0070689_1006445501 178
97 3300005341 Ga0070691_10160898 Ga0070691_101608983 178
98 3300005344 Ga0070661_100014911 Ga0070661_1000149114 178
99 3300005344 Ga0070661_100038190 Ga0070661_1000381902 178
100 3300005344 Ga0070661_100038774 Ga0070661_1000387743 178
101 3300005344 Ga0070661_100041395 Ga0070661_1000413953 178
102 3300005344 Ga0070661_100256212 Ga0070661_1002562122 178
103 3300005344 Ga0070661_100543748 Ga0070661_1005437482 178
104 3300005344 Ga0070661_100577890 Ga0070661_1005778902 178
105 3300005345 Ga0070692_10415980 Ga0070692_104159801 178
106 3300005347 Ga0070668_100591003 Ga0070668_1005910032 178
107 3300005353 Ga0070669_100005914 Ga0070669_10000591410 178
108 3300005354 Ga0070675_100287515 Ga0070675_1002875152 178
109 3300005355 Ga0070671_100000133 Ga0070671_10000013328 178
110 3300005356 Ga0070674_100021297 Ga0070674_1000212975 178
111 3300005356 Ga0070674_100053278 Ga0070674_1000532785 178
112 3300005356 Ga0070674_100538326 Ga0070674_1005383262 178
113 3300005364 Ga0070673_100006883 Ga0070673_1000068834 178
114 3300005364 Ga0070673_100206422 Ga0070673_1002064221 178
115 3300005364 Ga0070673_100597302 Ga0070673_1005973022 178
116 3300005364 Ga0070673_100650950 Ga0070673_1006509501 178
117 3300005364 Ga0070673_100717872 Ga0070673_1007178721 178
118 3300005364 Ga0070673_100974843 Ga0070673_1009748431 178
119 3300005366 Ga0070659_100010839 Ga0070659_1000108398 178
120 3300005366 Ga0070659_100027397 Ga0070659_1000273974 178
121 3300005366 Ga0070659_100052396 Ga0070659_1000523966 178
122 3300005366 Ga0070659_100091603 Ga0070659_1000916032 178
123 3300005366 Ga0070659_100100363 Ga0070659_1001003631 178
124 3300005366 Ga0070659_100129935 Ga0070659_1001299353 178
125 3300005366 Ga0070659_100135475 Ga0070659_1001354754 178
126 3300005366 Ga0070659_100280346 Ga0070659_1002803462 178
127 3300005366 Ga0070659_100558587 Ga0070659_1005585872 178
128 3300005366 Ga0070659_100892757 Ga0070659_1008927572 178
129 3300005367 Ga0070667_100000117 Ga0070667_10000011724 178
130 3300005367 Ga0070667_100076907 Ga0070667_1000769074 178
131 3300005367 Ga0070667_100081100 Ga0070667_1000811002 178
132 3300005367 Ga0070667_100198814 Ga0070667_1001988143 178
133 3300005367 Ga0070667_100370723 Ga0070667_1003707231 178
134 3300005367 Ga0070667_100394795 Ga0070667_1003947952 178
135 3300005434 Ga0070709_10006547 Ga0070709_100065478 178
136 3300005435 Ga0070714_100016021 Ga0070714_1000160216 178
137 3300005435 Ga0070714_100026448 Ga0070714_1000264483 178
138 3300005435 Ga0070714_100088232 Ga0070714_1000882323 178
139 3300005436 Ga0070713_100215799 Ga0070713_1002157993 178
140 3300005455 Ga0070663_100003630 Ga0070663_1000036304 178
141 3300005455 Ga0070663_100011822 Ga0070663_1000118225 178
142 3300005455 Ga0070663_100018751 Ga0070663_1000187516 178
143 3300005455 Ga0070663_100325918 Ga0070663_1003259181 178
144 3300005456 Ga0070678_100006084 Ga0070678_1000060846 178
145 3300005456 Ga0070678_100008440 Ga0070678_1000084403 178
146 3300005456 Ga0070678_101005326 Ga0070678_1010053262 178
147 3300005457 Ga0070662_100033639 Ga0070662_1000336394 178
148 3300005457 Ga0070662_100052944 Ga0070662_1000529443 178
149 3300005457 Ga0070662_100053666 Ga0070662_1000536664 178
150 3300005457 Ga0070662_100125597 Ga0070662_1001255972 178
151 3300005457 Ga0070662_100272819 Ga0070662_1002728191 178
152 3300005458 Ga0070681_10971914 Ga0070681_109719141 178
153 3300005459 Ga0068867_100025826 Ga0068867_1000258267 178
154 3300005466 Ga0070685_10169273 Ga0070685_101692733 178
155 3300005530 Ga0070679_100020999 Ga0070679_1000209998 178
156 3300005530 Ga0070679_100413858 Ga0070679_1004138582 178
157 3300005530 Ga0070679_100738186 Ga0070679_1007381862 178
158 3300005530 Ga0070679_100829586 Ga0070679_1008295861 178
159 3300005535 Ga0070684_100091522 Ga0070684_1000915225 178
160 3300005535 Ga0070684_100560127 Ga0070684_1005601272 178
161 3300005539 Ga0068853_100000058 Ga0068853_10000005840 178
162 3300005539 Ga0068853_100054142 Ga0068853_1000541424 178
163 3300005539 Ga0068853_100123718 Ga0068853_1001237185 178
164 3300005539 Ga0068853_100187006 Ga0068853_1001870061 178
165 3300005539 Ga0068853_100412658 Ga0068853_1004126582 178
166 3300005543 Ga0070672_100010294 Ga0070672_1000102947 178
167 3300005543 Ga0070672_100029023 Ga0070672_1000290235 178
168 3300005543 Ga0070672_100070995 Ga0070672_1000709954 178
169 3300005543 Ga0070672_100103892 Ga0070672_1001038921 178
170 3300005543 Ga0070672_100462297 Ga0070672_1004622972 178
171 3300005543 Ga0070672_100609855 Ga0070672_1006098551 178
172 3300005544 Ga0070686_100012937 Ga0070686_1000129373 178
173 3300005548 Ga0070665_100084998 Ga0070665_1000849984 178
174 3300005548 Ga0070665_101000571 Ga0070665_1010005712 178
175 3300005563 Ga0068855_100001283 Ga0068855_10000128323 178
176 3300005563 Ga0068855_100007269 Ga0068855_1000072699 178
177 3300005563 Ga0068855_100069229 Ga0068855_1000692295 178
178 3300005563 Ga0068855_100670192 Ga0068855_1006701922 178
179 3300005564 Ga0070664_100011148 Ga0070664_1000111484 178
180 3300005564 Ga0070664_100014737 Ga0070664_1000147376 178
181 3300005564 Ga0070664_100064168 Ga0070664_1000641684 178
182 3300005564 Ga0070664_100130761 Ga0070664_1001307612 178
183 3300005564 Ga0070664_100181732 Ga0070664_1001817323 178
184 3300005564 Ga0070664_100292712 Ga0070664_1002927122 178
185 3300005564 Ga0070664_100613787 Ga0070664_1006137872 178
186 3300005564 Ga0070664_100644929 Ga0070664_1006449292 178
187 3300005577 Ga0068857_100012184 Ga0068857_1000121844 178
188 3300005577 Ga0068857_100018460 Ga0068857_1000184606 178
189 3300005577 Ga0068857_100202379 Ga0068857_1002023792 178
190 3300005578 Ga0068854_100017544 Ga0068854_1000175444 178
191 3300005578 Ga0068854_100083528 Ga0068854_1000835284 178
192 3300005578 Ga0068854_100097771 Ga0068854_1000977712 178
193 3300005578 Ga0068854_100106041 Ga0068854_1001060411 178
194 3300005578 Ga0068854_100464728 Ga0068854_1004647281 178
195 3300005614 Ga0068856_100004010 Ga0068856_1000040106 178
196 3300005614 Ga0068856_100015637 Ga0068856_1000156377 178
197 3300005614 Ga0068856_100029419 Ga0068856_1000294196 178
198 3300005614 Ga0068856_100072266 Ga0068856_1000722666 178
199 3300005614 Ga0068856_100073402 Ga0068856_1000734023 178
200 3300005614 Ga0068856_100106988 Ga0068856_1001069884 178
201 3300005614 Ga0068856_100658372 Ga0068856_1006583722 178
202 3300005615 Ga0070702_100716648 Ga0070702_1007166481 178
203 3300005616 Ga0068852_100007749 Ga0068852_1000077496 178
204 3300005616 Ga0068852_100013576 Ga0068852_1000135768 178
205 3300005616 Ga0068852_100590696 Ga0068852_1005906962 178
206 3300005616 Ga0068852_100679190 Ga0068852_1006791902 178
207 3300005616 Ga0068852_100988400 Ga0068852_1009884002 178
208 3300005616 Ga0068852_101014038 Ga0068852_1010140382 178
209 3300005616 Ga0068852_101165336 Ga0068852_1011653362 178
210 3300005617 Ga0068859_100080429 Ga0068859_1000804295 178
211 3300005617 Ga0068859_100091900 Ga0068859_1000919005 178
212 3300005617 Ga0068859_100246090 Ga0068859_1002460904 178
213 3300005618 Ga0068864_100007806 Ga0068864_1000078068 178
214 3300005618 Ga0068864_101899621 Ga0068864_1018996211 178
215 3300005718 Ga0068866_10175585 Ga0068866_101755852 178
216 3300005834 Ga0068851_10098093 Ga0068851_100980932 178
217 3300005834 Ga0068851_10110499 Ga0068851_101104993 178
218 3300005841 Ga0068863_100000055 Ga0068863_10000005556 178
219 3300005841 Ga0068863_100001458 Ga0068863_10000145817 178
220 3300005842 Ga0068858_100000980 Ga0068858_10000098015 178
221 3300005842 Ga0068858_100038150 Ga0068858_1000381504 178
222 3300005842 Ga0068858_100491907 Ga0068858_1004919072 178
223 3300005843 Ga0068860_100015091 Ga0068860_1000150913 178
224 3300005844 Ga0068862_100251333 Ga0068862_1002513332 178
225 3300006028 Ga0070717_10030870 Ga0070717_100308703 178
226 3300006163 Ga0070715_10224231 Ga0070715_102242312 178
227 3300006175 Ga0070712_100032304 Ga0070712_1000323042 178
228 3300006237 Ga0097621_100181608 Ga0097621_1001816083 178
229 3300006358 Ga0068871_100363612 Ga0068871_1003636122 178
230 3300006881 Ga0068865_100079405 Ga0068865_1000794051 178
231 3300006931 Ga0097620_100080427 Ga0097620_1000804275 178
232 3300006931 Ga0097620_100091903 Ga0097620_1000919035 178
233 3300006931 Ga0097620_100246085 Ga0097620_1002460852 178
234 3300009093 Ga0105240_10076863 Ga0105240_100768634 178
235 3300009093 Ga0105240_10137255 Ga0105240_101372554 178
236 3300009093 Ga0105240_10232742 Ga0105240_102327424 178
237 3300009093 Ga0105240_10664599 Ga0105240_106645992 178
238 3300009098 Ga0105245_10059460 Ga0105245_100594606 178
239 3300009098 Ga0105245_10085636 Ga0105245_100856364 178
240 3300009098 Ga0105245_10104779 Ga0105245_101047794 178
241 3300009148 Ga0105243_11271993 Ga0105243_112719931 178
242 3300009174 Ga0105241_10121991 Ga0105241_101219912 178
243 3300009174 Ga0105241_10921215 Ga0105241_109212152 178
244 3300009176 Ga0105242_10004126 Ga0105242_1000412611 178
245 3300009177 Ga0105248_10000390 Ga0105248_1000039039 178
246 3300009177 Ga0105248_10037274 Ga0105248_100372743 178
247 3300009177 Ga0105248_10248704 Ga0105248_102487044 178
248 3300009177 Ga0105248_10339606 Ga0105248_103396063 178
249 3300009545 Ga0105237_10171582 Ga0105237_101715822 178
250 3300009545 Ga0105237_10555137 Ga0105237_105551372 178
251 3300009545 Ga0105237_10599276 Ga0105237_105992761 178
252 3300009551 Ga0105238_10006826 Ga0105238_100068263 178
253 3300009551 Ga0105238_10065141 Ga0105238_100651414 178
254 3300009551 Ga0105238_10630096 Ga0105238_106300962 178
255 3300010375 Ga0105239_10076898 Ga0105239_100768985 178
256 3300010375 Ga0105239_10988155 Ga0105239_109881552 178
257 3300010375 Ga0105239_12026330 Ga0105239_120263301 178
258 3300011119 Ga0105246_10100291 Ga0105246_101002914 178
259 3300011119 Ga0105246_10329691 Ga0105246_103296911 178
260 3300013100 Ga0157373_10032949 Ga0157373_100329495 178
261 3300013100 Ga0157373_10059212 Ga0157373_100592123 178
262 3300013100 Ga0157373_10075267 Ga0157373_100752672 178
263 3300013100 Ga0157373_10079476 Ga0157373_100794763 178
264 3300013100 Ga0157373_10432155 Ga0157373_104321552 178
265 3300013100 Ga0157373_10469705 Ga0157373_104697051 178
266 3300013102 Ga0157371_10010609 Ga0157371_100106095 178
267 3300013102 Ga0157371_10057924 Ga0157371_100579245 178
268 3300013102 Ga0157371_10065528 Ga0157371_100655281 178
269 3300013102 Ga0157371_10099661 Ga0157371_100996614 178
270 3300013102 Ga0157371_10167827 Ga0157371_101678272 178
271 3300013104 Ga0157370_10000707 Ga0157370_1000070744 178
272 3300013104 Ga0157370_10012615 Ga0157370_100126158 178
273 3300013104 Ga0157370_10015729 Ga0157370_100157299 178
274 3300013104 Ga0157370_10018879 Ga0157370_100188797 178
275 3300013104 Ga0157370_10023637 Ga0157370_100236374 178
276 3300013104 Ga0157370_10088985 Ga0157370_100889852 178
277 3300013104 Ga0157370_10318992 Ga0157370_103189922 178
278 3300013104 Ga0157370_10370878 Ga0157370_103708783 178
279 3300013104 Ga0157370_10752734 Ga0157370_107527341 178
280 3300013104 Ga0157370_11256871 Ga0157370_112568711 178
281 3300013105 Ga0157369_10000137 Ga0157369_1000013733 178
282 3300013105 Ga0157369_10002106 Ga0157369_1000210627 178
283 3300013105 Ga0157369_10036957 Ga0157369_100369576 178
284 3300013105 Ga0157369_10039374 Ga0157369_100393743 178
285 3300013105 Ga0157369_10065692 Ga0157369_100656924 178
286 3300013105 Ga0157369_10091987 Ga0157369_100919872 178
287 3300013296 Ga0157374_10001339 Ga0157374_100013393 178
288 3300013297 Ga0157378_10006347 Ga0157378_100063478 178
289 3300013297 Ga0157378_10129939 Ga0157378_101299393 178
290 3300013306 Ga0163162_10104187 Ga0163162_101041874 178
291 3300013306 Ga0163162_10239930 Ga0163162_102399304 178
292 3300013306 Ga0163162_11593364 Ga0163162_115933642 178
293 3300013307 Ga0157372_10165332 Ga0157372_101653323 178
294 3300013307 Ga0157372_10284898 Ga0157372_102848982 178
295 3300013307 Ga0157372_10285671 Ga0157372_102856713 178
296 3300013307 Ga0157372_10377676 Ga0157372_103776762 178
297 3300013307 Ga0157372_12075827 Ga0157372_120758271 178
298 3300013307 Ga0157372_12538658 Ga0157372_125386581 178
299 3300013308 Ga0157375_10155699 Ga0157375_101556993 178
300 3300013308 Ga0157375_10205780 Ga0157375_102057803 178
301 3300013308 Ga0157375_10250098 Ga0157375_102500982 178
302 3300013308 Ga0157375_11338914 Ga0157375_113389142 178
303 3300014325 Ga0163163_10015746 Ga0163163_100157466 178
304 3300014325 Ga0163163_10669989 Ga0163163_106699892 178
305 3300014745 Ga0157377_11245424 Ga0157377_112454241 178
306 3300014968 Ga0157379_10020058 Ga0157379_100200582 178
307 3300014969 Ga0157376_10089097 Ga0157376_100890972 178
308 3300015684 Ga0183365_10008 Ga0183365_1000859 178
309 3300017792 Ga0163161_10143576 Ga0163161_101435764 178
310 3300017792 Ga0163161_10347628 Ga0163161_103476282 178
311 3300017792 Ga0163161_10790265 Ga0163161_107902652 178
312 3300020081 Ga0206354_10753768 Ga0206354_107537682 178
313 3300020081 Ga0206354_11008188 Ga0206354_110081882 178
314 3300020082 Ga0206353_10094556 Ga0206353_100945565 178
315 3300020082 Ga0206353_10123983 Ga0206353_101239833 178
316 3300020082 Ga0206353_11094556 Ga0206353_110945562 178
317 3300025315 Ga0207697_10019218 Ga0207697_100192183 178
318 3300025321 Ga0207656_10224857 Ga0207656_102248572 178
319 3300025903 Ga0207680_10000414 Ga0207680_1000041411 178
320 3300025903 Ga0207680_10001382 Ga0207680_100013826 178
321 3300025903 Ga0207680_10003973 Ga0207680_100039738 178
322 3300025903 Ga0207680_10025601 Ga0207680_100256014 178
323 3300025903 Ga0207680_10225350 Ga0207680_102253502 178
324 3300025903 Ga0207680_10434638 Ga0207680_104346382 178
325 3300025904 Ga0207647_10026260 Ga0207647_100262603 178
326 3300025904 Ga0207647_10029155 Ga0207647_100291556 178
327 3300025904 Ga0207647_10030910 Ga0207647_100309104 178
328 3300025904 Ga0207647_10090103 Ga0207647_100901033 178
329 3300025904 Ga0207647_10149082 Ga0207647_101490822 178
330 3300025904 Ga0207647_10250402 Ga0207647_102504022 178
331 3300025907 Ga0207645_10030642 Ga0207645_100306425 178
332 3300025909 Ga0207705_10000569 Ga0207705_1000056930 178
333 3300025909 Ga0207705_10001953 Ga0207705_100019538 178
334 3300025909 Ga0207705_10004281 Ga0207705_1000428110 178
335 3300025909 Ga0207705_10009606 Ga0207705_100096063 178
336 3300025909 Ga0207705_10034262 Ga0207705_100342623 178
337 3300025909 Ga0207705_10129447 Ga0207705_101294473 178
338 3300025909 Ga0207705_10190726 Ga0207705_101907262 178
339 3300025909 Ga0207705_10231948 Ga0207705_102319482 178
340 3300025909 Ga0207705_10252505 Ga0207705_102525053 178
341 3300025909 Ga0207705_10352704 Ga0207705_103527042 178
342 3300025909 Ga0207705_10404833 Ga0207705_104048332 178
343 3300025913 Ga0207695_10057126 Ga0207695_100571264 178
344 3300025913 Ga0207695_10332570 Ga0207695_103325702 178
345 3300025913 Ga0207695_10407687 Ga0207695_104076872 178
346 3300025913 Ga0207695_10663617 Ga0207695_106636172 178
347 3300025914 Ga0207671_10222140 Ga0207671_102221403 178
348 3300025917 Ga0207660_10012190 Ga0207660_100121906 178
349 3300025919 Ga0207657_10000284 Ga0207657_1000028448 178
350 3300025919 Ga0207657_10000675 Ga0207657_1000067525 178
351 3300025919 Ga0207657_10008334 Ga0207657_100083347 178
352 3300025919 Ga0207657_10009137 Ga0207657_100091375 178
353 3300025919 Ga0207657_10021076 Ga0207657_100210764 178
354 3300025919 Ga0207657_10036695 Ga0207657_100366955 178
355 3300025919 Ga0207657_10052475 Ga0207657_100524753 178
356 3300025919 Ga0207657_10089674 Ga0207657_100896743 178
357 3300025919 Ga0207657_10170312 Ga0207657_101703123 178
358 3300025919 Ga0207657_10691925 Ga0207657_106919252 178
359 3300025920 Ga0207649_10000557 Ga0207649_100005575 178
360 3300025920 Ga0207649_10032676 Ga0207649_100326764 178
361 3300025920 Ga0207649_10045078 Ga0207649_100450784 178
362 3300025920 Ga0207649_10185967 Ga0207649_101859672 178
363 3300025920 Ga0207649_10667738 Ga0207649_106677381 178
364 3300025920 Ga0207649_11055863 Ga0207649_110558631 178
365 3300025921 Ga0207652_10001035 Ga0207652_100010357 178
366 3300025923 Ga0207681_10004130 Ga0207681_100041305 178
367 3300025924 Ga0207694_10018805 Ga0207694_100188057 178
368 3300025924 Ga0207694_10020530 Ga0207694_100205305 178
369 3300025925 Ga0207650_10078405 Ga0207650_100784053 178
370 3300025925 Ga0207650_10287878 Ga0207650_102878783 178
371 3300025926 Ga0207659_10436108 Ga0207659_104361082 178
372 3300025926 Ga0207659_11067294 Ga0207659_110672942 178
373 3300025927 Ga0207687_10066102 Ga0207687_100661023 178
374 3300025929 Ga0207664_10020477 Ga0207664_100204774 178
375 3300025929 Ga0207664_10079710 Ga0207664_100797103 178
376 3300025929 Ga0207664_10082899 Ga0207664_100828993 178
377 3300025929 Ga0207664_10112666 Ga0207664_101126663 178
378 3300025931 Ga0207644_10000256 Ga0207644_100002563 178
379 3300025931 Ga0207644_10014676 Ga0207644_100146766 178
380 3300025932 Ga0207690_10022165 Ga0207690_100221653 178
381 3300025932 Ga0207690_10023874 Ga0207690_100238744 178
382 3300025932 Ga0207690_10091252 Ga0207690_100912521 178
383 3300025932 Ga0207690_10247788 Ga0207690_102477882 178
384 3300025932 Ga0207690_10251849 Ga0207690_102518492 178
385 3300025932 Ga0207690_10324942 Ga0207690_103249422 178
386 3300025933 Ga0207706_10003671 Ga0207706_1000367116 178
387 3300025933 Ga0207706_10006585 Ga0207706_100065859 178
388 3300025933 Ga0207706_10010427 Ga0207706_100104276 178
389 3300025933 Ga0207706_10052626 Ga0207706_100526263 178
390 3300025933 Ga0207706_10059300 Ga0207706_100593005 178
391 3300025933 Ga0207706_10095362 Ga0207706_100953624 178
392 3300025933 Ga0207706_10135484 Ga0207706_101354843 178
393 3300025937 Ga0207669_10012758 Ga0207669_100127582 178
394 3300025937 Ga0207669_10014624 Ga0207669_100146247 178
395 3300025937 Ga0207669_10020519 Ga0207669_100205192 178
396 3300025937 Ga0207669_10106458 Ga0207669_101064581 178
397 3300025937 Ga0207669_11215986 Ga0207669_112159861 178
398 3300025938 Ga0207704_10010644 Ga0207704_100106442 178
399 3300025938 Ga0207704_10105059 Ga0207704_101050592 178
400 3300025940 Ga0207691_10008045 Ga0207691_1000804512 178
401 3300025940 Ga0207691_10083093 Ga0207691_100830934 178
402 3300025940 Ga0207691_10090488 Ga0207691_100904883 178
403 3300025940 Ga0207691_10099955 Ga0207691_100999555 178
404 3300025940 Ga0207691_10453936 Ga0207691_104539362 178
405 3300025941 Ga0207711_10000190 Ga0207711_1000019072 178
406 3300025941 Ga0207711_10105909 Ga0207711_101059094 178
407 3300025944 Ga0207661_10045438 Ga0207661_100454386 178
408 3300025945 Ga0207679_10064198 Ga0207679_100641984 178
409 3300025945 Ga0207679_10183901 Ga0207679_101839013 178
410 3300025945 Ga0207679_10190858 Ga0207679_101908583 178
411 3300025945 Ga0207679_10260649 Ga0207679_102606492 178
412 3300025945 Ga0207679_10517562 Ga0207679_105175622 178
413 3300025949 Ga0207667_10007154 Ga0207667_100071546 178
414 3300025949 Ga0207667_10010782 Ga0207667_100107824 178
415 3300025949 Ga0207667_10074317 Ga0207667_100743173 178
416 3300025949 Ga0207667_10427171 Ga0207667_104271711 178
417 3300025949 Ga0207667_10541057 Ga0207667_105410572 178
418 3300025960 Ga0207651_10001768 Ga0207651_100017688 178
419 3300025960 Ga0207651_10036455 Ga0207651_100364554 178
420 3300025960 Ga0207651_10132358 Ga0207651_101323583 178
421 3300025960 Ga0207651_10133968 Ga0207651_101339684 178
422 3300025960 Ga0207651_10650291 Ga0207651_106502912 178
423 3300025972 Ga0207668_10000373 Ga0207668_100003735 178
424 3300025981 Ga0207640_10019668 Ga0207640_100196684 178
425 3300025981 Ga0207640_10184268 Ga0207640_101842683 178
426 3300025981 Ga0207640_10254002 Ga0207640_102540023 178
427 3300025981 Ga0207640_10257768 Ga0207640_102577681 178
428 3300025981 Ga0207640_10295782 Ga0207640_102957822 178
429 3300025981 Ga0207640_10424317 Ga0207640_104243172 178
430 3300025986 Ga0207658_10000087 Ga0207658_1000008722 178
431 3300025986 Ga0207658_10002604 Ga0207658_100026044 178
432 3300025986 Ga0207658_10237211 Ga0207658_102372112 178
433 3300025986 Ga0207658_10315052 Ga0207658_103150522 178
434 3300026023 Ga0207677_10005685 Ga0207677_100056854 178
435 3300026023 Ga0207677_10006502 Ga0207677_100065028 178
436 3300026023 Ga0207677_10054390 Ga0207677_100543902 178
437 3300026035 Ga0207703_10000461 Ga0207703_1000046141 178
438 3300026035 Ga0207703_10026919 Ga0207703_100269194 178
439 3300026041 Ga0207639_10000089 Ga0207639_1000008953 178
440 3300026041 Ga0207639_10072226 Ga0207639_100722263 178
441 3300026041 Ga0207639_10161790 Ga0207639_101617904 178
442 3300026041 Ga0207639_10225255 Ga0207639_102252552 178
443 3300026067 Ga0207678_10000325 Ga0207678_1000032533 178
444 3300026067 Ga0207678_10004910 Ga0207678_100049106 178
445 3300026067 Ga0207678_10018428 Ga0207678_100184283 178
446 3300026067 Ga0207678_10042735 Ga0207678_100427355 178
447 3300026067 Ga0207678_10523236 Ga0207678_105232362 178
448 3300026078 Ga0207702_10015224 Ga0207702_100152247 178
449 3300026078 Ga0207702_10022337 Ga0207702_100223377 178
450 3300026078 Ga0207702_10032441 Ga0207702_100324412 178
451 3300026078 Ga0207702_10068689 Ga0207702_100686894 178
452 3300026078 Ga0207702_10070541 Ga0207702_100705416 178
453 3300026078 Ga0207702_10312565 Ga0207702_103125652 178
454 3300026078 Ga0207702_10383385 Ga0207702_103833851 178
455 3300026078 Ga0207702_10456706 Ga0207702_104567062 178
456 3300026078 Ga0207702_10553182 Ga0207702_105531822 178
457 3300026078 Ga0207702_10823353 Ga0207702_108233532 178
458 3300026088 Ga0207641_10000110 Ga0207641_1000011022 178
459 3300026088 Ga0207641_10050188 Ga0207641_100501882 178
460 3300026089 Ga0207648_10008490 Ga0207648_1000849011 178
461 3300026095 Ga0207676_10250357 Ga0207676_102503571 178
462 3300026116 Ga0207674_10000271 Ga0207674_100002715 178
463 3300026116 Ga0207674_10004818 Ga0207674_1000481813 178
464 3300026116 Ga0207674_10025787 Ga0207674_100257873 178
465 3300026116 Ga0207674_10034276 Ga0207674_100342766 178
466 3300026116 Ga0207674_10101061 Ga0207674_101010614 178
467 3300026118 Ga0207675_100487239 Ga0207675_1004872391 178
468 3300026121 Ga0207683_10000721 Ga0207683_1000072115 178
469 3300026121 Ga0207683_10001875 Ga0207683_100018755 178
470 3300026121 Ga0207683_11307136 Ga0207683_113071362 178
471 3300026142 Ga0207698_10007075 Ga0207698_100070754 178
472 3300026142 Ga0207698_10080557 Ga0207698_100805574 178
473 3300026142 Ga0207698_10109516 Ga0207698_101095163 178
474 3300026142 Ga0207698_10431231 Ga0207698_104312313 178
475 3300028379 Ga0268266_10044210 Ga0268266_100442104 178
476 3300028379 Ga0268266_10172656 Ga0268266_101726564 178
477 3300028380 Ga0268265_10040794 Ga0268265_100407942 178
478 3300028381 Ga0268264_10017033 Ga0268264_100170333 178
479 3300031548 Ga0307408_100213436 Ga0307408_1002134363 178
480 3300031548 Ga0307408_100566687 Ga0307408_1005666872 178
481 3300031548 Ga0307408_100729657 Ga0307408_1007296572 178
482 3300031731 Ga0307405_10243942 Ga0307405_102439421 178
483 3300031731 Ga0307405_11161715 Ga0307405_111617151 178
484 3300031824 Ga0307413_10035806 Ga0307413_100358064 178
485 3300031824 Ga0307413_10189860 Ga0307413_101898602 178
486 3300031824 Ga0307413_10228074 Ga0307413_102280742 178
487 3300031852 Ga0307410_10024280 Ga0307410_100242804 178
488 3300031852 Ga0307410_10026955 Ga0307410_100269552 178
489 3300031852 Ga0307410_10164561 Ga0307410_101645611 178
490 3300031852 Ga0307410_10615464 Ga0307410_106154642 178
491 3300031903 Ga0307407_10008712 Ga0307407_100087125 178
492 3300031903 Ga0307407_10743834 Ga0307407_107438342 178
493 3300031911 Ga0307412_10160530 Ga0307412_101605303 178
494 3300031911 Ga0307412_10228457 Ga0307412_102284572 178
495 3300031995 Ga0307409_100038091 Ga0307409_1000380914 178
496 3300031995 Ga0307409_100216086 Ga0307409_1002160862 178
497 3300031995 Ga0307409_100339536 Ga0307409_1003395361 178
498 3300031995 Ga0307409_100806281 Ga0307409_1008062811 178
499 3300032002 Ga0307416_100008755 Ga0307416_1000087559 178
500 3300032002 Ga0307416_100124409 Ga0307416_1001244094 178
501 3300032002 Ga0307416_101319254 Ga0307416_1013192542 178
502 3300032002 Ga0307416_102717469 Ga0307416_1027174691 178
503 3300032004 Ga0307414_10061944 Ga0307414_100619446 178
504 3300032004 Ga0307414_10066601 Ga0307414_100666012 178
505 3300032005 Ga0307411_10085846 Ga0307411_100858464 178
506 3300032005 Ga0307411_10124749 Ga0307411_101247493 178
507 3300032005 Ga0307411_10749717 Ga0307411_107497172 178
508 3300032126 Ga0307415_100001996 Ga0307415_1000019968 178
509 3300032126 Ga0307415_100286122 Ga0307415_1002861222 178
510 3300035088 Ga0373940_0105209 Ga0373940_0105209_296_835 178
511 3300035121 Ga0373960_0105963 Ga0373960_0105963_197_736 178
512 3300035170 Ga0373943_0027220 Ga0373943_0027220_1779_2315 178
513 3300035170 Ga0373943_0088509 Ga0373943_0088509_536_1075 178
514 3300035171 Ga0373946_0072105 Ga0373946_0072105_258_794 178
515 3300035691 Ga0373931_0024649 Ga0373931_0024649_64_603 178
516 3300035692 Ga0373935_0025894 Ga0373935_0025894_1687_2226 178
517 3300035692 Ga0373935_0864009 Ga0373935_0864009_55_594 178
518 3300035695 Ga0373927_0073121 Ga0373927_0073121_974_1510 178
519 3300036401 Ga0373937_0706573 Ga0373937_0706573_208_747 178
520 3300037068 Ga0373925_0156912 Ga0373925_0156912_1165_1701 178
521 3300037312 Ga0395899_0000162 Ga0395899_0000162_57252_57788 178
522 3300037312 Ga0395899_0003851 Ga0395899_0003851_9734_10270 178
523 3300037312 Ga0395899_0028386 Ga0395899_0028386_847_1383 178
524 3300037312 Ga0395899_0045105 Ga0395899_0045105_1182_1718 178
525 3300037312 Ga0395899_0045872 Ga0395899_0045872_1105_1641 178
526 3300037312 Ga0395899_0054694 Ga0395899_0054694_2050_2586 178
527 3300037312 Ga0395899_0088836 Ga0395899_0088836_584_1120 178
528 3300037312 Ga0395899_0110059 Ga0395899_0110059_1009_1575 178
529 3300037312 Ga0395899_0162586 Ga0395899_0162586_978_1526 178
530 3300037312 Ga0395899_0174444 Ga0395899_0174444_375_911 178
531 3300037312 Ga0395899_0365590 Ga0395899_0365590_168_704 178
532 3300037312 Ga0395899_0384809 Ga0395899_0384809_347_883 178
533 3300037312 Ga0395899_0413942 Ga0395899_0413942_270_806 178
534 3300037312 Ga0395899_0504765 Ga0395899_0504765_26_565 178
535 3300037418 Ga0395900_0000129 Ga0395900_0000129_68518_69054 178
536 3300037418 Ga0395900_0000666 Ga0395900_0000666_40622_41158 178
537 3300037418 Ga0395900_0001095 Ga0395900_0001095_1181_1717 178
538 3300037418 Ga0395900_0007391 Ga0395900_0007391_4550_5086 178
539 3300037418 Ga0395900_0020412 Ga0395900_0020412_4025_4561 178
540 3300037418 Ga0395900_0022227 Ga0395900_0022227_2060_2596 178
541 3300037418 Ga0395900_0036019 Ga0395900_0036019_2581_3117 178
542 3300037418 Ga0395900_0041106 Ga0395900_0041106_2802_3368 178
543 3300037418 Ga0395900_0070992 Ga0395900_0070992_2409_2975 178
544 3300037418 Ga0395900_0078633 Ga0395900_0078633_2182_2718 178
545 3300037418 Ga0395900_0095368 Ga0395900_0095368_318_854 178
546 3300037418 Ga0395900_0109098 Ga0395900_0109098_1502_2041 178
547 3300037418 Ga0395900_0367236 Ga0395900_0367236_198_734 178
548 3300037418 Ga0395900_0452206 Ga0395900_0452206_368_904 178
549 3300037418 Ga0395900_0543798 Ga0395900_0543798_410_946 178
550 3300037418 Ga0395900_1003935 Ga0395900_1003935_148_684 178
551 3300037418 Ga0395900_1005244 Ga0395900_1005244_194_730 178
552 3300037418 Ga0395900_1140250 Ga0395900_1140250_74_610 178
553 3300037418 Ga0395900_1147418 Ga0395900_1147418_132_671 178
554 3300037466 Ga0395898_0001704 Ga0395898_0001704_3778_4314 178
555 3300037466 Ga0395898_0009787 Ga0395898_0009787_7977_8513 178
556 3300037466 Ga0395898_0041651 Ga0395898_0041651_590_1138 178
557 3300037466 Ga0395898_0045291 Ga0395898_0045291_535_1071 178
558 3300037466 Ga0395898_0055623 Ga0395898_0055623_1983_2519 178
559 3300037466 Ga0395898_0059310 Ga0395898_0059310_2314_2880 178
560 3300037466 Ga0395898_0062586 Ga0395898_0062586_1897_2433 178
561 3300037466 Ga0395898_0073614 Ga0395898_0073614_36_602 178
562 3300037466 Ga0395898_0083099 Ga0395898_0083099_2295_2831 178
563 3300037466 Ga0395898_0085965 Ga0395898_0085965_2060_2596 178
564 3300037466 Ga0395898_0088891 Ga0395898_0088891_2362_2898 178
565 3300037466 Ga0395898_0176370 Ga0395898_0176370_113_652 178
566 3300037466 Ga0395898_0712458 Ga0395898_0712458_47_586 178
567 3300037466 Ga0395898_1311499 Ga0395898_1311499_94_633 178
568 3300037471 Ga0395905_0001395 Ga0395905_0001395_5678_6214 178
569 3300037471 Ga0395905_0003061 Ga0395905_0003061_1181_1717 178
570 3300037471 Ga0395905_0014155 Ga0395905_0014155_6704_7240 178
571 3300037471 Ga0395905_0019204 Ga0395905_0019204_395_931 178
572 3300037471 Ga0395905_0055854 Ga0395905_0055854_2283_2849 178
573 3300037471 Ga0395905_0099581 Ga0395905_0099581_298_846 178
574 3300037471 Ga0395905_0166526 Ga0395905_0166526_695_1231 178
575 3300037471 Ga0395905_0170237 Ga0395905_0170237_1491_2030 178
576 3300037471 Ga0395905_0173511 Ga0395905_0173511_740_1276 178
577 3300037471 Ga0395905_0176567 Ga0395905_0176567_801_1337 178
578 3300037471 Ga0395905_0183648 Ga0395905_0183648_551_1117 178
579 3300037471 Ga0395905_0358615 Ga0395905_0358615_114_680 178
580 3300038443 Ga0395901_0000111 Ga0395901_0000111_54743_55279 178
581 3300038443 Ga0395901_0012693 Ga0395901_0012693_5628_6164 178
582 3300038443 Ga0395901_0015987 Ga0395901_0015987_2249_2785 178
583 3300038443 Ga0395901_0024546 Ga0395901_0024546_899_1438 178
584 3300038443 Ga0395901_0035383 Ga0395901_0035383_3442_3978 178
585 3300038443 Ga0395901_0056099 Ga0395901_0056099_2150_2686 178
586 3300038443 Ga0395901_0078608 Ga0395901_0078608_512_1048 178
587 3300038443 Ga0395901_0088862 Ga0395901_0088862_847_1383 178
588 3300038443 Ga0395901_0127521 Ga0395901_0127521_188_724 178
589 3300038443 Ga0395901_0155006 Ga0395901_0155006_1645_2181 178
590 3300038443 Ga0395901_0203939 Ga0395901_0203939_267_806 178
591 3300038443 Ga0395901_0286757 Ga0395901_0286757_290_826 178
592 3300038443 Ga0395901_0400112 Ga0395901_0400112_184_720 178
593 3300039450 Ga0436363_0451272 Ga0436363_0451272_347_883 178
594 3300041413 Ga0439465_0023521 Ga0439465_0023521_277_813 178
595 3300041458 Ga0451798_0398690 Ga0451798_0398690_191_727 178
596 3300041512 Ga0451853_2987684 Ga0451853_2987684_124_663 178
597 3300042004 Ga0439445_0003001 Ga0439445_0003001_2687_3223 178
598 3300042157 Ga0439458_0000647 Ga0439458_0000647_1862_2398 178
599 3300044656 Ga0466969_0008689 Ga0466969_0008689_3595_4131 178
600 3300044658 Ga0466972_0023375 Ga0466972_0023375_503_1039 178
601 3300044658 Ga0466972_0027190 Ga0466972_0027190_1460_1999 178
602 3300044683 Ga0466965_0125612 Ga0466965_0125612_483_1019 178
603 3300044684 Ga0466966_0000026 Ga0466966_0000026_68273_68821 178
604 3300044684 Ga0466966_0018412 Ga0466966_0018412_2109_2651 178
605 3300044684 Ga0466966_0020740 Ga0466966_0020740_2710_3246 178
606 3300044684 Ga0466966_0073956 Ga0466966_0073956_1482_2018 178
607 3300044684 Ga0466966_0077307 Ga0466966_0077307_676_1212 178
608 3300044684 Ga0466966_0092257 Ga0466966_0092257_1332_1868 178
609 3300044693 Ga0466961_0111094 Ga0466961_0111094_140_676 178
610 3300044693 Ga0466961_0140180 Ga0466961_0140180_421_963 178
611 3300044693 Ga0466961_0153201 Ga0466961_0153201_612_1148 178
612 3300044693 Ga0466961_0173969 Ga0466961_0173969_582_1118 178
613 3300044694 Ga0466963_0023556 Ga0466963_0023556_2880_3428 178
614 3300044694 Ga0466963_0101549 Ga0466963_0101549_983_1519 178
615 3300044719 Ga0466971_0057327 Ga0466971_0057327_132_668 178
616 3300044735 Ga0466968_0013379 Ga0466968_0013379_1546_2082 178
617 3300044765 Ga0466970_0036825 Ga0466970_0036825_912_1448 178
618 3300044765 Ga0466970_0089168 Ga0466970_0089168_577_1113 178
619 3300044765 Ga0466970_0142602 Ga0466970_0142602_688_1230 178
620 3300044765 Ga0466970_0390442 Ga0466970_0390442_233_772 178
621 3300044765 Ga0466970_0443736 Ga0466970_0443736_134_670 178
622 3300044842 Ga0466957_0048990 Ga0466957_0048990_559_1095 178
623 3300044842 Ga0466957_0132580 Ga0466957_0132580_918_1454 178
624 3300044901 Ga0466960_0176726 Ga0466960_0176726_338_877 178
625 3300045049 Ga0466959_0056375 Ga0466959_0056375_1933_2469 178
626 3300045049 Ga0466959_0060828 Ga0466959_0060828_1018_1554 178
627 3300045049 Ga0466959_0112786 Ga0466959_0112786_604_1140 178
628 3300045049 Ga0466959_0185950 Ga0466959_0185950_789_1325 178
629 3300045836 Ga0466958_0029167 Ga0466958_0029167_1349_1885 178
630 3300045836 Ga0466958_0037711 Ga0466958_0037711_1168_1704 178
631 3300045836 Ga0466958_0088413 Ga0466958_0088413_580_1116 178
632 3300045976 Ga0466967_0040164 Ga0466967_0040164_647_1189 178
633 3300045976 Ga0466967_0071169 Ga0466967_0071169_1636_2172 178
634 3300045976 Ga0466967_0129433 Ga0466967_0129433_170_712 178
635 3300045976 Ga0466967_0145350 Ga0466967_0145350_1223_1759 178
636 3300045976 Ga0466967_0240234 Ga0466967_0240234_106_654 178
637 3300046525 Ga0495663_0007104 Ga0495663_0007104_1907_2446 178
638 3300046525 Ga0495663_0037337 Ga0495663_0037337_646_1185 178
639 3300046528 Ga0495642_0010946 Ga0495642_0010946_2601_3140 178
640 3300046528 Ga0495642_0156517 Ga0495642_0156517_224_763 178
641 3300046537 Ga0495598_0000126 Ga0495598_0000126_4668_5207 178
642 3300046539 Ga0495621_0000046 Ga0495621_0000046_884_1423 178
643 3300046684 Ga0495669_0000394 Ga0495669_0000394_16140_16679 178
644 3300046684 Ga0495669_0093934 Ga0495669_0093934_577_1116 178
645 3300046691 Ga0495670_0043527 Ga0495670_0043527_989_1528 178
646 3300047445 Ga0495677_0007021 Ga0495677_0007021_557_1096 178
647 3300048903 Ga0496100_0001483 Ga0496100_0001483_1680_2219 178
648 3300048905 Ga0496102_0414065 Ga0496102_0414065_227_766 178
649 3300048907 Ga0496104_0126715 Ga0496104_0126715_200_739 178
650 3300048908 Ga0496105_0457882 Ga0496105_0457882_216_755 178
651 3300048910 Ga0496107_0035183 Ga0496107_0035183_2583_3122 178
652 3300048911 Ga0496108_0006078 Ga0496108_0006078_495_1034 178
653 3300048912 Ga0496109_0951873 Ga0496109_0951873_86_625 178
654 3300048913 Ga0496110_0002522 Ga0496110_0002522_11790_12329 178
655 3300048914 Ga0496111_0025728 Ga0496111_0025728_972_1511 178
656 3300048914 Ga0496111_0356084 Ga0496111_0356084_135_701 178
657 3300048915 Ga0496112_0027081 Ga0496112_0027081_108_647 178
658 3300048915 Ga0496112_0179822 Ga0496112_0179822_317_856 178
659 3300048917 Ga0496114_0000016 Ga0496114_0000016_112723_113262 178
660 3300049568 Ga0501031_0686881 Ga0501031_0686881_56_592 178
661 3300049570 Ga0501033_0063644 Ga0501033_0063644_1228_1764 178
662 3300049581 Ga0501047_0995895 Ga0501047_0995895_18_554 178
663 3300049742 Ga0501080_0253872 Ga0501080_0253872_977_1513 178
664 3300049822 Ga0501035_0002613 Ga0501035_0002613_10316_10852 178
665 3300053122 Ga0500608_000251 Ga0500608_000251_15790_16326 178
666 3300053123 Ga0500614_069827 Ga0500614_069827_403_939 178
667 3300061719 Ga0466962_0043867 Ga0466962_0043867_937_1473 178
668 3300061719 Ga0466962_0328353 Ga0466962_0328353_36_572 178

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00994

MoCF_biosynth

Probable molybdopterin binding domain

15

162

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
1mkz-assembly1.cif.gz_A crystal structure of moab protein at 1.6 a resolution. 0.9712 3 170
1r2k-assembly1.cif.gz_B crystal structure of moab from escherichia coli 0.9681 3 165
1y5e-assembly1.cif.gz_C crystal structure of molybdenum cofactor biosynthesis protein b 0.9622 11 157
3iwt-assembly1.cif.gz_A structure of hypothetical molybdenum cofactor biosynthesis protein b from sulfolobus tokodaii 0.9556 11 157
1mkz-assembly1.cif.gz_A crystal structure of moab protein at 1.6 a resolution. 0.9431 3 170
ID Description Score Start End Superfamily
1r2kA00 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.9696 3 170 3.40.980.10
2pjkA00 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.9553 11 157 3.40.980.10
1r2kA00 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.9524 3 170 3.40.980.10
1y5eB00 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.9494 11 154 3.40.980.10
af_P39205_1_179_3.40.980.10 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.9345 12 155 3.40.980.10
ID Description Score Start End GO Terms
AF-A0A059G262-F1-model_v4 Molybdenum cofactor biosynthesis protein B 0.9963 1 178 GO:0005829
GO:0006777
AF-A0A0F2QJ17-F1-model_v4 Molybdenum cofactor biosynthesis protein B 0.9961 1 178 GO:0005829
GO:0006777
AF-A0A1D2TUU4-F1-model_v4 Molybdenum cofactor biosynthesis protein B 0.996 1 178 GO:0005829
GO:0006777
AF-A0A521PIW7-F1-model_v4 Molybdenum cofactor biosynthesis protein B 0.9945 1 178 GO:0005829
GO:0006777
AF-A0A3S9VBC5-F1-model_v4 Molybdenum cofactor biosynthesis protein B 0.9927 1 178 GO:0005829
GO:0006777

Feature Viewer

pLDDT pTM Quality
96.01 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map