F473934
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 668 | 220 | 666 | 178 |
Family's Representative Sequence
| Representative Sequence | 3300031824|Ga0307413_10008914|Ga0307413_100089145 |
| Length | 180 |
| Sequence | VAIDPERAFKPLNIALLTVSDTRTEADDTSGDILAERIAAAGHNLAARAIERDVVPALVARLSNWIDDPAIDCVISTGGTGLTGRDVTPEALERIKESGDSRDIPGFGELFRWLSYQTIGASTVQSRAMAVLARGTYIFALPGSNGAVKDGWDLILAEQLDSRNRPCNFVDLMPRLREQR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2885427238 | Sphingomonas mesophila SYSUP0001 | Isolate | Stem Tuber |
| 2 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 3 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 4 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 5 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 6 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 7 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 8 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 9 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 10 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 17 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 42 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 46 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 50 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 52 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 53 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 54 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 56 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 57 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 58 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 59 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 60 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 61 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 62 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 63 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 64 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 69 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 70 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300015684 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 | Metagenome | Unclassified |
| 95 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 97 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 98 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 147 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 148 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 149 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 150 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 151 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 152 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 153 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 154 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 155 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 156 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 157 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 158 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 159 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 160 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 161 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 162 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 163 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 164 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 165 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 166 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 167 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 168 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 169 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 170 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 171 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 172 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 173 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 174 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 175 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 176 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 177 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 178 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 179 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 180 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 181 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 182 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 183 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 184 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 185 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 186 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 187 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 188 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 189 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 190 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 191 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 192 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 193 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 203 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 204 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 205 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 206 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 207 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 208 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 209 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 210 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 211 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 212 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 213 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 214 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 215 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 216 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 217 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 218 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 219 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 220 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.95 |
| Metatranscriptomes | 0.75 |
| Isolates | 0.3 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.3 |
| Nodule | 0 |
| Rhizoplane | 2.25 |
| Rhizosphere | 96.41 |
| Stem | 0 |
| Stem Tuber | 0.15 |
| Unclassified | 0.9 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1000429 | 3300001904 | Bacteria | 7898 |
| 2 | JGI24740J21852_10034310 | 3300001979 | Bacteria | 1600 |
| 3 | JGI24740J21852_10036549 | 3300001979 | Bacteria | 1525 |
| 4 | JGI24739J22299_10075657 | 3300001989 | Bacteria | 1040 |
| 5 | JGI24739J22299_10081554 | 3300001989 | Bacteria | 993 |
| 6 | JGI24737J22298_10002041 | 3300001990 | Bacteria | 7225 |
| 7 | JGI24737J22298_10012796 | 3300001990 | Bacteria | 2735 |
| 8 | JGI24735J21928_10005786 | 3300002067 | Bacteria | 4090 |
| 9 | JGI24735J21928_10118969 | 3300002067 | Bacteria | 760 |
| 10 | rootH1_10039483 | 3300003323 | Unclassified | 1308 |
| 11 | rootH1_10103011 | 3300003323 | Bacteria | 5509 |
| 12 | Ga0065712_10086820 | 3300005290 | Bacteria | 2602 |
| 13 | Ga0065707_10691866 | 3300005295 | Bacteria | 643 |
| 14 | Ga0070658_10003637 | 3300005327 | Bacteria | 12625 |
| 15 | Ga0070658_10006930 | 3300005327 | Bacteria | 9152 |
| 16 | Ga0070658_10026798 | 3300005327 | Bacteria | 4627 |
| 17 | Ga0070658_10043380 | 3300005327 | Bacteria | 3633 |
| 18 | Ga0070658_10065768 | 3300005327 | Bacteria | 2960 |
| 19 | Ga0070658_10104580 | 3300005327 | Bacteria | 2342 |
| 20 | Ga0070658_10222545 | 3300005327 | Bacteria | 1596 |
| 21 | Ga0070658_10278884 | 3300005327 | Bacteria | 1422 |
| 22 | Ga0070658_10329252 | 3300005327 | Bacteria | 1305 |
| 23 | Ga0070658_10704565 | 3300005327 | Bacteria | 876 |
| 24 | Ga0070676_10063300 | 3300005328 | Bacteria | 2203 |
| 25 | Ga0070676_10077480 | 3300005328 | Bacteria | 2009 |
| 26 | Ga0070676_10086551 | 3300005328 | Bacteria | 1911 |
| 27 | Ga0070676_10191116 | 3300005328 | Bacteria | 1337 |
| 28 | Ga0070676_10196780 | 3300005328 | Bacteria | 1319 |
| 29 | Ga0070683_100011628 | 3300005329 | Bacteria | 7618 |
| 30 | Ga0070683_100014144 | 3300005329 | Bacteria | 6971 |
| 31 | Ga0070683_100084678 | 3300005329 | Bacteria | 2971 |
| 32 | Ga0070690_100020192 | 3300005330 | Bacteria | 4057 |
| 33 | Ga0070670_100047097 | 3300005331 | Bacteria | 3709 |
| 34 | Ga0070670_100352182 | 3300005331 | Bacteria | 1294 |
| 35 | Ga0070670_100419596 | 3300005331 | Bacteria | 1183 |
| 36 | Ga0068869_100551511 | 3300005334 | Bacteria | 968 |
| 37 | Ga0070666_10000205 | 3300005335 | Bacteria | 40586 |
| 38 | Ga0070666_10010766 | 3300005335 | Bacteria | 5723 |
| 39 | Ga0070666_10117471 | 3300005335 | Bacteria | 1842 |
| 40 | Ga0070666_10266774 | 3300005335 | Bacteria | 1215 |
| 41 | Ga0070680_100000229 | 3300005336 | Bacteria | 37007 |
| 42 | Ga0070680_100005897 | 3300005336 | Bacteria | 9302 |
| 43 | Ga0070680_100490581 | 3300005336 | Bacteria | 1050 |
| 44 | Ga0070680_101476148 | 3300005336 | Bacteria | 589 |
| 45 | Ga0068868_100025077 | 3300005338 | Bacteria | 4529 |
| 46 | Ga0068868_100167222 | 3300005338 | Bacteria | 1819 |
| 47 | Ga0068868_100291857 | 3300005338 | Unclassified | 1383 |
| 48 | Ga0070660_100001180 | 3300005339 | Bacteria | 17685 |
| 49 | Ga0070660_100002854 | 3300005339 | Bacteria | 11896 |
| 50 | Ga0070660_100010429 | 3300005339 | Bacteria | 6564 |
| 51 | Ga0070660_100015550 | 3300005339 | Bacteria | 5498 |
| 52 | Ga0070660_100015669 | 3300005339 | Bacteria | 5480 |
| 53 | Ga0070660_100023169 | 3300005339 | Bacteria | 4599 |
| 54 | Ga0070660_100133785 | 3300005339 | Bacteria | 1986 |
| 55 | Ga0070660_100148585 | 3300005339 | Bacteria | 1883 |
| 56 | Ga0070660_100153074 | 3300005339 | Bacteria | 1855 |
| 57 | Ga0070660_100157167 | 3300005339 | Bacteria | 1831 |
| 58 | Ga0070660_100228579 | 3300005339 | Bacteria | 1513 |
| 59 | Ga0070660_100263971 | 3300005339 | Bacteria | 1406 |
| 60 | Ga0070660_100861495 | 3300005339 | Bacteria | 763 |
| 61 | Ga0070689_100644550 | 3300005340 | Bacteria | 921 |
| 62 | Ga0070691_10160898 | 3300005341 | Bacteria | 1157 |
| 63 | Ga0070687_100720546 | 3300005343 | Bacteria | 699 |
| 64 | Ga0070661_100014911 | 3300005344 | Bacteria | 5481 |
| 65 | Ga0070661_100038190 | 3300005344 | Bacteria | 3495 |
| 66 | Ga0070661_100038774 | 3300005344 | Bacteria | 3470 |
| 67 | Ga0070661_100041395 | 3300005344 | Bacteria | 3362 |
| 68 | Ga0070661_100256212 | 3300005344 | Bacteria | 1352 |
| 69 | Ga0070661_100543748 | 3300005344 | Bacteria | 934 |
| 70 | Ga0070661_100577890 | 3300005344 | Bacteria | 906 |
| 71 | Ga0070661_101093944 | 3300005344 | Bacteria | 664 |
| 72 | Ga0070692_10415980 | 3300005345 | Bacteria | 852 |
| 73 | Ga0070668_100000700 | 3300005347 | Bacteria | 22895 |
| 74 | Ga0070668_100591003 | 3300005347 | Bacteria | 970 |
| 75 | Ga0070669_100005914 | 3300005353 | Bacteria | 8829 |
| 76 | Ga0070675_100287515 | 3300005354 | Bacteria | 1446 |
| 77 | Ga0070671_100000133 | 3300005355 | Bacteria | 47555 |
| 78 | Ga0070674_100021297 | 3300005356 | Bacteria | 4157 |
| 79 | Ga0070674_100053278 | 3300005356 | Bacteria | 2792 |
| 80 | Ga0070674_100538326 | 3300005356 | Bacteria | 978 |
| 81 | Ga0070673_100006883 | 3300005364 | Bacteria | 7437 |
| 82 | Ga0070673_100206422 | 3300005364 | Bacteria | 1694 |
| 83 | Ga0070673_100597302 | 3300005364 | Bacteria | 1006 |
| 84 | Ga0070673_100650950 | 3300005364 | Bacteria | 964 |
| 85 | Ga0070673_100717872 | 3300005364 | Bacteria | 919 |
| 86 | Ga0070673_100974843 | 3300005364 | Bacteria | 788 |
| 87 | Ga0070659_100010839 | 3300005366 | Bacteria | 6720 |
| 88 | Ga0070659_100027397 | 3300005366 | Bacteria | 4391 |
| 89 | Ga0070659_100052396 | 3300005366 | Bacteria | 3209 |
| 90 | Ga0070659_100091603 | 3300005366 | Bacteria | 2437 |
| 91 | Ga0070659_100100363 | 3300005366 | Bacteria | 2329 |
| 92 | Ga0070659_100129935 | 3300005366 | Bacteria | 2045 |
| 93 | Ga0070659_100135475 | 3300005366 | Bacteria | 2002 |
| 94 | Ga0070659_100280346 | 3300005366 | Bacteria | 1386 |
| 95 | Ga0070659_100558587 | 3300005366 | Unclassified | 980 |
| 96 | Ga0070659_100892757 | 3300005366 | Bacteria | 776 |
| 97 | Ga0070667_100000117 | 3300005367 | Bacteria | 100684 |
| 98 | Ga0070667_100076907 | 3300005367 | Bacteria | 2850 |
| 99 | Ga0070667_100081100 | 3300005367 | Bacteria | 2776 |
| 100 | Ga0070667_100198814 | 3300005367 | Bacteria | 1778 |
| 101 | Ga0070667_100370723 | 3300005367 | Bacteria | 1299 |
| 102 | Ga0070667_100394795 | 3300005367 | Bacteria | 1258 |
| 103 | Ga0070709_10006547 | 3300005434 | Bacteria | 6352 |
| 104 | Ga0070714_100016021 | 3300005435 | Bacteria | 6043 |
| 105 | Ga0070714_100026448 | 3300005435 | Bacteria | 4796 |
| 106 | Ga0070714_100088232 | 3300005435 | Bacteria | 2714 |
| 107 | Ga0070713_100215799 | 3300005436 | Bacteria | 1739 |
| 108 | Ga0070663_100003630 | 3300005455 | Bacteria | 8928 |
| 109 | Ga0070663_100011822 | 3300005455 | Bacteria | 5498 |
| 110 | Ga0070663_100018751 | 3300005455 | Bacteria | 4544 |
| 111 | Ga0070663_100325918 | 3300005455 | Bacteria | 1236 |
| 112 | Ga0070678_100006084 | 3300005456 | Bacteria | 7043 |
| 113 | Ga0070678_100008440 | 3300005456 | Bacteria | 6171 |
| 114 | Ga0070678_101005326 | 3300005456 | Bacteria | 767 |
| 115 | Ga0070662_100033639 | 3300005457 | Bacteria | 3611 |
| 116 | Ga0070662_100052944 | 3300005457 | Bacteria | 2937 |
| 117 | Ga0070662_100053666 | 3300005457 | Bacteria | 2918 |
| 118 | Ga0070662_100125597 | 3300005457 | Bacteria | 1971 |
| 119 | Ga0070662_100272819 | 3300005457 | Bacteria | 1366 |
| 120 | Ga0070681_10971914 | 3300005458 | Bacteria | 769 |
| 121 | Ga0068867_100025826 | 3300005459 | Bacteria | 4213 |
| 122 | Ga0070685_10169273 | 3300005466 | Bacteria | 1399 |
| 123 | Ga0070679_100020999 | 3300005530 | Bacteria | 6372 |
| 124 | Ga0070679_100413858 | 3300005530 | Bacteria | 1294 |
| 125 | Ga0070679_100738186 | 3300005530 | Bacteria | 927 |
| 126 | Ga0070679_100829586 | 3300005530 | Bacteria | 868 |
| 127 | Ga0070684_100091522 | 3300005535 | Bacteria | 2706 |
| 128 | Ga0070684_100560127 | 3300005535 | Bacteria | 1061 |
| 129 | Ga0068853_100000058 | 3300005539 | Bacteria | 78682 |
| 130 | Ga0068853_100054142 | 3300005539 | Bacteria | 3457 |
| 131 | Ga0068853_100123718 | 3300005539 | Bacteria | 2310 |
| 132 | Ga0068853_100187006 | 3300005539 | Bacteria | 1880 |
| 133 | Ga0068853_100412658 | 3300005539 | Bacteria | 1265 |
| 134 | Ga0070672_100010294 | 3300005543 | Bacteria | 6480 |
| 135 | Ga0070672_100029023 | 3300005543 | Bacteria | 4143 |
| 136 | Ga0070672_100070995 | 3300005543 | Bacteria | 2769 |
| 137 | Ga0070672_100103892 | 3300005543 | Bacteria | 2308 |
| 138 | Ga0070672_100462297 | 3300005543 | Bacteria | 1094 |
| 139 | Ga0070672_100609855 | 3300005543 | Bacteria | 951 |
| 140 | Ga0070686_100012937 | 3300005544 | Bacteria | 4765 |
| 141 | Ga0070665_100084998 | 3300005548 | Bacteria | 3169 |
| 142 | Ga0070665_101000571 | 3300005548 | Unclassified | 848 |
| 143 | Ga0068855_100000348 | 3300005563 | Bacteria | 57384 |
| 144 | Ga0068855_100001283 | 3300005563 | Bacteria | 31121 |
| 145 | Ga0068855_100007269 | 3300005563 | Bacteria | 13421 |
| 146 | Ga0068855_100069229 | 3300005563 | Bacteria | 4107 |
| 147 | Ga0068855_100670192 | 3300005563 | Bacteria | 1112 |
| 148 | Ga0070664_100011148 | 3300005564 | Bacteria | 7290 |
| 149 | Ga0070664_100014737 | 3300005564 | Bacteria | 6384 |
| 150 | Ga0070664_100064168 | 3300005564 | Bacteria | 3132 |
| 151 | Ga0070664_100130761 | 3300005564 | Bacteria | 2205 |
| 152 | Ga0070664_100181732 | 3300005564 | Bacteria | 1869 |
| 153 | Ga0070664_100292712 | 3300005564 | Unclassified | 1470 |
| 154 | Ga0070664_100613787 | 3300005564 | Unclassified | 1009 |
| 155 | Ga0070664_100644929 | 3300005564 | Bacteria | 984 |
| 156 | Ga0068857_100012184 | 3300005577 | Bacteria | 7478 |
| 157 | Ga0068857_100018460 | 3300005577 | Bacteria | 6118 |
| 158 | Ga0068857_100202379 | 3300005577 | Bacteria | 1810 |
| 159 | Ga0068854_100017544 | 3300005578 | Bacteria | 4790 |
| 160 | Ga0068854_100083528 | 3300005578 | Bacteria | 2361 |
| 161 | Ga0068854_100097771 | 3300005578 | Bacteria | 2195 |
| 162 | Ga0068854_100106041 | 3300005578 | Bacteria | 2113 |
| 163 | Ga0068854_100464728 | 3300005578 | Bacteria | 1059 |
| 164 | Ga0068856_100004010 | 3300005614 | Bacteria | 14744 |
| 165 | Ga0068856_100015637 | 3300005614 | Bacteria | 7335 |
| 166 | Ga0068856_100029419 | 3300005614 | Bacteria | 5366 |
| 167 | Ga0068856_100072266 | 3300005614 | Bacteria | 3415 |
| 168 | Ga0068856_100073402 | 3300005614 | Bacteria | 3388 |
| 169 | Ga0068856_100106988 | 3300005614 | Bacteria | 2792 |
| 170 | Ga0068856_100658372 | 3300005614 | Bacteria | 1068 |
| 171 | Ga0070702_100269024 | 3300005615 | Bacteria | 1164 |
| 172 | Ga0070702_100716648 | 3300005615 | Bacteria | 764 |
| 173 | Ga0068852_100007749 | 3300005616 | Bacteria | 7856 |
| 174 | Ga0068852_100013576 | 3300005616 | Bacteria | 6235 |
| 175 | Ga0068852_100590696 | 3300005616 | Bacteria | 1114 |
| 176 | Ga0068852_100679190 | 3300005616 | Bacteria | 1039 |
| 177 | Ga0068852_100988400 | 3300005616 | Bacteria | 860 |
| 178 | Ga0068852_101014038 | 3300005616 | Bacteria | 849 |
| 179 | Ga0068852_101165336 | 3300005616 | Bacteria | 791 |
| 180 | Ga0068859_100080429 | 3300005617 | Bacteria | 3299 |
| 181 | Ga0068859_100091900 | 3300005617 | Bacteria | 3086 |
| 182 | Ga0068859_100246090 | 3300005617 | Bacteria | 1878 |
| 183 | Ga0068864_100007806 | 3300005618 | Bacteria | 8814 |
| 184 | Ga0068864_101899621 | 3300005618 | Bacteria | 601 |
| 185 | Ga0068866_10175585 | 3300005718 | Bacteria | 1261 |
| 186 | Ga0068851_10098093 | 3300005834 | Bacteria | 1551 |
| 187 | Ga0068851_10110499 | 3300005834 | Bacteria | 1467 |
| 188 | Ga0068863_100000055 | 3300005841 | Bacteria | 124300 |
| 189 | Ga0068863_100001458 | 3300005841 | Bacteria | 23454 |
| 190 | Ga0068863_100652043 | 3300005841 | Bacteria | 1044 |
| 191 | Ga0068858_100000980 | 3300005842 | Bacteria | 29457 |
| 192 | Ga0068858_100038150 | 3300005842 | Bacteria | 4456 |
| 193 | Ga0068858_100491907 | 3300005842 | Bacteria | 1184 |
| 194 | Ga0068860_100015091 | 3300005843 | Bacteria | 7549 |
| 195 | Ga0068862_100251333 | 3300005844 | Bacteria | 1611 |
| 196 | Ga0070717_10030870 | 3300006028 | Bacteria | 4306 |
| 197 | Ga0070715_10224231 | 3300006163 | Bacteria | 968 |
| 198 | Ga0070712_100032304 | 3300006175 | Bacteria | 3534 |
| 199 | Ga0097621_100181608 | 3300006237 | Unclassified | 1818 |
| 200 | Ga0068871_100363612 | 3300006358 | Unclassified | 1282 |
| 201 | Ga0068865_100079405 | 3300006881 | Bacteria | 2350 |
| 202 | Ga0097620_100080427 | 3300006931 | Bacteria | 3299 |
| 203 | Ga0097620_100091903 | 3300006931 | Bacteria | 3086 |
| 204 | Ga0097620_100246085 | 3300006931 | Bacteria | 1878 |
| 205 | Ga0105240_10076863 | 3300009093 | Bacteria | 4115 |
| 206 | Ga0105240_10137255 | 3300009093 | Bacteria | 2928 |
| 207 | Ga0105240_10232742 | 3300009093 | Bacteria | 2140 |
| 208 | Ga0105240_10664599 | 3300009093 | Bacteria | 1141 |
| 209 | Ga0105245_10059460 | 3300009098 | Bacteria | 3442 |
| 210 | Ga0105245_10085636 | 3300009098 | Bacteria | 2889 |
| 211 | Ga0105245_10104779 | 3300009098 | Bacteria | 2623 |
| 212 | Ga0105243_11271993 | 3300009148 | Bacteria | 752 |
| 213 | Ga0105241_10121991 | 3300009174 | Bacteria | 2100 |
| 214 | Ga0105241_10921215 | 3300009174 | Bacteria | 813 |
| 215 | Ga0105242_10004126 | 3300009176 | Bacteria | 11307 |
| 216 | Ga0105248_10000390 | 3300009177 | Bacteria | 50573 |
| 217 | Ga0105248_10037274 | 3300009177 | Bacteria | 5440 |
| 218 | Ga0105248_10248704 | 3300009177 | Bacteria | 2001 |
| 219 | Ga0105248_10339606 | 3300009177 | Unclassified | 1691 |
| 220 | Ga0105237_10171582 | 3300009545 | Bacteria | 2169 |
| 221 | Ga0105237_10555137 | 3300009545 | Bacteria | 1155 |
| 222 | Ga0105237_10599276 | 3300009545 | Bacteria | 1109 |
| 223 | Ga0105238_10006826 | 3300009551 | Bacteria | 11397 |
| 224 | Ga0105238_10065141 | 3300009551 | Bacteria | 3645 |
| 225 | Ga0105238_10630096 | 3300009551 | Bacteria | 1081 |
| 226 | Ga0105239_10076898 | 3300010375 | Bacteria | 3672 |
| 227 | Ga0105239_10988155 | 3300010375 | Bacteria | 967 |
| 228 | Ga0105239_12026330 | 3300010375 | Bacteria | 668 |
| 229 | Ga0105246_10100291 | 3300011119 | Bacteria | 2107 |
| 230 | Ga0105246_10329691 | 3300011119 | Unclassified | 1243 |
| 231 | Ga0157373_10032949 | 3300013100 | Bacteria | 3729 |
| 232 | Ga0157373_10059212 | 3300013100 | Bacteria | 2714 |
| 233 | Ga0157373_10075267 | 3300013100 | Bacteria | 2382 |
| 234 | Ga0157373_10079476 | 3300013100 | Bacteria | 2313 |
| 235 | Ga0157373_10432155 | 3300013100 | Bacteria | 946 |
| 236 | Ga0157373_10469705 | 3300013100 | Bacteria | 907 |
| 237 | Ga0157371_10005915 | 3300013102 | Bacteria | 10216 |
| 238 | Ga0157371_10010609 | 3300013102 | Bacteria | 7159 |
| 239 | Ga0157371_10057924 | 3300013102 | Bacteria | 2748 |
| 240 | Ga0157371_10065528 | 3300013102 | Bacteria | 2573 |
| 241 | Ga0157371_10099661 | 3300013102 | Bacteria | 2060 |
| 242 | Ga0157371_10167827 | 3300013102 | Bacteria | 1568 |
| 243 | Ga0157370_10000707 | 3300013104 | Bacteria | 41767 |
| 244 | Ga0157370_10012615 | 3300013104 | Bacteria | 8757 |
| 245 | Ga0157370_10015729 | 3300013104 | Bacteria | 7682 |
| 246 | Ga0157370_10018879 | 3300013104 | Bacteria | 6934 |
| 247 | Ga0157370_10023637 | 3300013104 | Bacteria | 6099 |
| 248 | Ga0157370_10088985 | 3300013104 | Bacteria | 2900 |
| 249 | Ga0157370_10318992 | 3300013104 | Bacteria | 1433 |
| 250 | Ga0157370_10370878 | 3300013104 | Bacteria | 1319 |
| 251 | Ga0157370_10752734 | 3300013104 | Bacteria | 888 |
| 252 | Ga0157370_11256871 | 3300013104 | Unclassified | 667 |
| 253 | Ga0157369_10000137 | 3300013105 | Bacteria | 103542 |
| 254 | Ga0157369_10002106 | 3300013105 | Bacteria | 23991 |
| 255 | Ga0157369_10036957 | 3300013105 | Bacteria | 5350 |
| 256 | Ga0157369_10039374 | 3300013105 | Bacteria | 5166 |
| 257 | Ga0157369_10065692 | 3300013105 | Bacteria | 3904 |
| 258 | Ga0157369_10091987 | 3300013105 | Bacteria | 3237 |
| 259 | Ga0157374_10001339 | 3300013296 | Bacteria | 20962 |
| 260 | Ga0157378_10006347 | 3300013297 | Bacteria | 10344 |
| 261 | Ga0157378_10129939 | 3300013297 | Bacteria | 2331 |
| 262 | Ga0163162_10104187 | 3300013306 | Bacteria | 2931 |
| 263 | Ga0163162_10239930 | 3300013306 | Bacteria | 1943 |
| 264 | Ga0163162_11593364 | 3300013306 | Bacteria | 745 |
| 265 | Ga0157372_10165332 | 3300013307 | Bacteria | 2558 |
| 266 | Ga0157372_10284898 | 3300013307 | Bacteria | 1921 |
| 267 | Ga0157372_10285671 | 3300013307 | Bacteria | 1919 |
| 268 | Ga0157372_10377676 | 3300013307 | Bacteria | 1651 |
| 269 | Ga0157372_12075827 | 3300013307 | Bacteria | 653 |
| 270 | Ga0157372_12538658 | 3300013307 | Bacteria | 588 |
| 271 | Ga0157372_13002186 | 3300013307 | Bacteria | 539 |
| 272 | Ga0157375_10155699 | 3300013308 | Bacteria | 2424 |
| 273 | Ga0157375_10205780 | 3300013308 | Bacteria | 2124 |
| 274 | Ga0157375_10250098 | 3300013308 | Bacteria | 1933 |
| 275 | Ga0157375_11338914 | 3300013308 | Bacteria | 842 |
| 276 | Ga0163163_10015746 | 3300014325 | Bacteria | 7002 |
| 277 | Ga0163163_10669989 | 3300014325 | Bacteria | 1101 |
| 278 | Ga0157377_11245424 | 3300014745 | Bacteria | 578 |
| 279 | Ga0157379_10020058 | 3300014968 | Bacteria | 5908 |
| 280 | Ga0157376_10089097 | 3300014969 | Bacteria | 2667 |
| 281 | Ga0183365_10008 | 3300015684 | Bacteria | 74681 |
| 282 | Ga0163161_10143576 | 3300017792 | Bacteria | 1809 |
| 283 | Ga0163161_10347628 | 3300017792 | Bacteria | 1178 |
| 284 | Ga0163161_10790265 | 3300017792 | Unclassified | 797 |
| 285 | Ga0206354_10753768 | 3300020081 | Bacteria | 1032 |
| 286 | Ga0206354_11008188 | 3300020081 | Bacteria | 2906 |
| 287 | Ga0206353_10094556 | 3300020082 | Bacteria | 3188 |
| 288 | Ga0206353_10123983 | 3300020082 | Bacteria | 1733 |
| 289 | Ga0206353_11094556 | 3300020082 | Bacteria | 1759 |
| 290 | Ga0207697_10019218 | 3300025315 | Bacteria | 2799 |
| 291 | Ga0207656_10224857 | 3300025321 | Bacteria | 913 |
| 292 | Ga0207680_10000414 | 3300025903 | Bacteria | 20344 |
| 293 | Ga0207680_10001382 | 3300025903 | Bacteria | 11472 |
| 294 | Ga0207680_10003973 | 3300025903 | Bacteria | 6982 |
| 295 | Ga0207680_10025601 | 3300025903 | Bacteria | 3256 |
| 296 | Ga0207680_10225350 | 3300025903 | Bacteria | 1287 |
| 297 | Ga0207680_10434638 | 3300025903 | Bacteria | 931 |
| 298 | Ga0207647_10026260 | 3300025904 | Bacteria | 3813 |
| 299 | Ga0207647_10029155 | 3300025904 | Bacteria | 3575 |
| 300 | Ga0207647_10030910 | 3300025904 | Bacteria | 3451 |
| 301 | Ga0207647_10090103 | 3300025904 | Bacteria | 1830 |
| 302 | Ga0207647_10149082 | 3300025904 | Bacteria | 1368 |
| 303 | Ga0207647_10250402 | 3300025904 | Bacteria | 1016 |
| 304 | Ga0207645_10030642 | 3300025907 | Bacteria | 3466 |
| 305 | Ga0207705_10000208 | 3300025909 | Bacteria | 59559 |
| 306 | Ga0207705_10000569 | 3300025909 | Bacteria | 30895 |
| 307 | Ga0207705_10001953 | 3300025909 | Bacteria | 16079 |
| 308 | Ga0207705_10004281 | 3300025909 | Bacteria | 10809 |
| 309 | Ga0207705_10009606 | 3300025909 | Bacteria | 7035 |
| 310 | Ga0207705_10034262 | 3300025909 | Bacteria | 3630 |
| 311 | Ga0207705_10129447 | 3300025909 | Bacteria | 1877 |
| 312 | Ga0207705_10190726 | 3300025909 | Bacteria | 1550 |
| 313 | Ga0207705_10231948 | 3300025909 | Bacteria | 1404 |
| 314 | Ga0207705_10252505 | 3300025909 | Bacteria | 1345 |
| 315 | Ga0207705_10352704 | 3300025909 | Bacteria | 1134 |
| 316 | Ga0207705_10404833 | 3300025909 | Bacteria | 1055 |
| 317 | Ga0207707_10814054 | 3300025912 | Bacteria | 777 |
| 318 | Ga0207695_10057126 | 3300025913 | Bacteria | 4056 |
| 319 | Ga0207695_10332570 | 3300025913 | Bacteria | 1407 |
| 320 | Ga0207695_10407687 | 3300025913 | Bacteria | 1243 |
| 321 | Ga0207695_10663617 | 3300025913 | Bacteria | 924 |
| 322 | Ga0207671_10222140 | 3300025914 | Bacteria | 1480 |
| 323 | Ga0207660_10012190 | 3300025917 | Bacteria | 5618 |
| 324 | Ga0207657_10000284 | 3300025919 | Bacteria | 53982 |
| 325 | Ga0207657_10000675 | 3300025919 | Bacteria | 36346 |
| 326 | Ga0207657_10008334 | 3300025919 | Bacteria | 10536 |
| 327 | Ga0207657_10009137 | 3300025919 | Bacteria | 10001 |
| 328 | Ga0207657_10009904 | 3300025919 | Bacteria | 9541 |
| 329 | Ga0207657_10021076 | 3300025919 | Bacteria | 6143 |
| 330 | Ga0207657_10036695 | 3300025919 | Bacteria | 4384 |
| 331 | Ga0207657_10052475 | 3300025919 | Bacteria | 3538 |
| 332 | Ga0207657_10089674 | 3300025919 | Bacteria | 2568 |
| 333 | Ga0207657_10170312 | 3300025919 | Bacteria | 1764 |
| 334 | Ga0207657_10691925 | 3300025919 | Bacteria | 792 |
| 335 | Ga0207649_10000557 | 3300025920 | Bacteria | 25678 |
| 336 | Ga0207649_10032676 | 3300025920 | Bacteria | 3104 |
| 337 | Ga0207649_10045078 | 3300025920 | Unclassified | 2702 |
| 338 | Ga0207649_10185967 | 3300025920 | Bacteria | 1457 |
| 339 | Ga0207649_10667738 | 3300025920 | Bacteria | 804 |
| 340 | Ga0207649_11055863 | 3300025920 | Bacteria | 640 |
| 341 | Ga0207652_10001035 | 3300025921 | Bacteria | 25477 |
| 342 | Ga0207681_10004130 | 3300025923 | Bacteria | 9003 |
| 343 | Ga0207694_10018805 | 3300025924 | Bacteria | 5223 |
| 344 | Ga0207694_10020530 | 3300025924 | Bacteria | 4999 |
| 345 | Ga0207650_10078405 | 3300025925 | Bacteria | 2499 |
| 346 | Ga0207650_10287878 | 3300025925 | Bacteria | 1339 |
| 347 | Ga0207659_10436108 | 3300025926 | Bacteria | 1101 |
| 348 | Ga0207659_11067294 | 3300025926 | Bacteria | 695 |
| 349 | Ga0207687_10066102 | 3300025927 | Bacteria | 2569 |
| 350 | Ga0207664_10020477 | 3300025929 | Bacteria | 4904 |
| 351 | Ga0207664_10079710 | 3300025929 | Bacteria | 2659 |
| 352 | Ga0207664_10082899 | 3300025929 | Bacteria | 2613 |
| 353 | Ga0207664_10112666 | 3300025929 | Bacteria | 2265 |
| 354 | Ga0207644_10000256 | 3300025931 | Bacteria | 35858 |
| 355 | Ga0207644_10014676 | 3300025931 | Bacteria | 5248 |
| 356 | Ga0207690_10022165 | 3300025932 | Bacteria | 3948 |
| 357 | Ga0207690_10023874 | 3300025932 | Bacteria | 3823 |
| 358 | Ga0207690_10091252 | 3300025932 | Bacteria | 2153 |
| 359 | Ga0207690_10247788 | 3300025932 | Bacteria | 1375 |
| 360 | Ga0207690_10251849 | 3300025932 | Bacteria | 1364 |
| 361 | Ga0207690_10324942 | 3300025932 | Bacteria | 1210 |
| 362 | Ga0207706_10003671 | 3300025933 | Bacteria | 14655 |
| 363 | Ga0207706_10006585 | 3300025933 | Bacteria | 10758 |
| 364 | Ga0207706_10010427 | 3300025933 | Bacteria | 8490 |
| 365 | Ga0207706_10052626 | 3300025933 | Bacteria | 3594 |
| 366 | Ga0207706_10059300 | 3300025933 | Bacteria | 3370 |
| 367 | Ga0207706_10075634 | 3300025933 | Bacteria | 2962 |
| 368 | Ga0207706_10095362 | 3300025933 | Bacteria | 2617 |
| 369 | Ga0207706_10135484 | 3300025933 | Bacteria | 2166 |
| 370 | Ga0207669_10012758 | 3300025937 | Bacteria | 4144 |
| 371 | Ga0207669_10014624 | 3300025937 | Bacteria | 3938 |
| 372 | Ga0207669_10020519 | 3300025937 | Bacteria | 3468 |
| 373 | Ga0207669_10106458 | 3300025937 | Unclassified | 1868 |
| 374 | Ga0207669_11215986 | 3300025937 | Bacteria | 638 |
| 375 | Ga0207704_10010644 | 3300025938 | Bacteria | 4495 |
| 376 | Ga0207704_10105059 | 3300025938 | Bacteria | 1893 |
| 377 | Ga0207691_10008045 | 3300025940 | Bacteria | 10136 |
| 378 | Ga0207691_10083093 | 3300025940 | Unclassified | 2875 |
| 379 | Ga0207691_10090488 | 3300025940 | Bacteria | 2743 |
| 380 | Ga0207691_10099955 | 3300025940 | Bacteria | 2590 |
| 381 | Ga0207691_10453936 | 3300025940 | Bacteria | 1090 |
| 382 | Ga0207711_10000190 | 3300025941 | Bacteria | 65723 |
| 383 | Ga0207711_10105909 | 3300025941 | Bacteria | 2494 |
| 384 | Ga0207661_10045438 | 3300025944 | Bacteria | 3476 |
| 385 | Ga0207679_10064198 | 3300025945 | Bacteria | 2743 |
| 386 | Ga0207679_10183901 | 3300025945 | Bacteria | 1731 |
| 387 | Ga0207679_10190858 | 3300025945 | Bacteria | 1703 |
| 388 | Ga0207679_10260649 | 3300025945 | Bacteria | 1478 |
| 389 | Ga0207679_10517562 | 3300025945 | Bacteria | 1067 |
| 390 | Ga0207667_10004351 | 3300025949 | Bacteria | 17344 |
| 391 | Ga0207667_10007154 | 3300025949 | Bacteria | 13474 |
| 392 | Ga0207667_10010782 | 3300025949 | Bacteria | 10661 |
| 393 | Ga0207667_10074317 | 3300025949 | Bacteria | 3531 |
| 394 | Ga0207667_10427171 | 3300025949 | Bacteria | 1348 |
| 395 | Ga0207667_10541057 | 3300025949 | Bacteria | 1178 |
| 396 | Ga0207651_10001768 | 3300025960 | Bacteria | 10020 |
| 397 | Ga0207651_10036455 | 3300025960 | Bacteria | 3210 |
| 398 | Ga0207651_10132358 | 3300025960 | Bacteria | 1911 |
| 399 | Ga0207651_10133968 | 3300025960 | Unclassified | 1902 |
| 400 | Ga0207651_10650291 | 3300025960 | Bacteria | 925 |
| 401 | Ga0207668_10000373 | 3300025972 | Bacteria | 28446 |
| 402 | Ga0207640_10019668 | 3300025981 | Bacteria | 3994 |
| 403 | Ga0207640_10184268 | 3300025981 | Bacteria | 1568 |
| 404 | Ga0207640_10254002 | 3300025981 | Bacteria | 1366 |
| 405 | Ga0207640_10257768 | 3300025981 | Bacteria | 1357 |
| 406 | Ga0207640_10295782 | 3300025981 | Bacteria | 1278 |
| 407 | Ga0207640_10424317 | 3300025981 | Bacteria | 1089 |
| 408 | Ga0207658_10000087 | 3300025986 | Bacteria | 100698 |
| 409 | Ga0207658_10002604 | 3300025986 | Bacteria | 13094 |
| 410 | Ga0207658_10237211 | 3300025986 | Bacteria | 1543 |
| 411 | Ga0207658_10315052 | 3300025986 | Bacteria | 1352 |
| 412 | Ga0207677_10005685 | 3300026023 | Bacteria | 6785 |
| 413 | Ga0207677_10006502 | 3300026023 | Bacteria | 6421 |
| 414 | Ga0207677_10054390 | 3300026023 | Bacteria | 2731 |
| 415 | Ga0207703_10000461 | 3300026035 | Bacteria | 42797 |
| 416 | Ga0207703_10026919 | 3300026035 | Bacteria | 4529 |
| 417 | Ga0207639_10000089 | 3300026041 | Bacteria | 77190 |
| 418 | Ga0207639_10072226 | 3300026041 | Bacteria | 2701 |
| 419 | Ga0207639_10161790 | 3300026041 | Bacteria | 1887 |
| 420 | Ga0207639_10225255 | 3300026041 | Bacteria | 1622 |
| 421 | Ga0207678_10000325 | 3300026067 | Bacteria | 42910 |
| 422 | Ga0207678_10004910 | 3300026067 | Bacteria | 12012 |
| 423 | Ga0207678_10018428 | 3300026067 | Bacteria | 6130 |
| 424 | Ga0207678_10042735 | 3300026067 | Bacteria | 3924 |
| 425 | Ga0207678_10523236 | 3300026067 | Unclassified | 1035 |
| 426 | Ga0207702_10015224 | 3300026078 | Bacteria | 6376 |
| 427 | Ga0207702_10022337 | 3300026078 | Bacteria | 5244 |
| 428 | Ga0207702_10032441 | 3300026078 | Bacteria | 4358 |
| 429 | Ga0207702_10068689 | 3300026078 | Bacteria | 3045 |
| 430 | Ga0207702_10070541 | 3300026078 | Unclassified | 3005 |
| 431 | Ga0207702_10312565 | 3300026078 | Bacteria | 1494 |
| 432 | Ga0207702_10383385 | 3300026078 | Bacteria | 1352 |
| 433 | Ga0207702_10456706 | 3300026078 | Bacteria | 1240 |
| 434 | Ga0207702_10553182 | 3300026078 | Bacteria | 1126 |
| 435 | Ga0207702_10823353 | 3300026078 | Bacteria | 918 |
| 436 | Ga0207641_10000110 | 3300026088 | Bacteria | 120617 |
| 437 | Ga0207641_10050188 | 3300026088 | Bacteria | 3529 |
| 438 | Ga0207648_10008490 | 3300026089 | Bacteria | 9939 |
| 439 | Ga0207676_10250357 | 3300026095 | Bacteria | 1594 |
| 440 | Ga0207674_10000271 | 3300026116 | Bacteria | 65366 |
| 441 | Ga0207674_10004818 | 3300026116 | Bacteria | 16165 |
| 442 | Ga0207674_10025787 | 3300026116 | Bacteria | 6260 |
| 443 | Ga0207674_10034276 | 3300026116 | Bacteria | 5310 |
| 444 | Ga0207674_10101061 | 3300026116 | Bacteria | 2865 |
| 445 | Ga0207674_10692424 | 3300026116 | Bacteria | 984 |
| 446 | Ga0207675_100238187 | 3300026118 | Bacteria | 1758 |
| 447 | Ga0207675_100487239 | 3300026118 | Bacteria | 1226 |
| 448 | Ga0207683_10000721 | 3300026121 | Bacteria | 30084 |
| 449 | Ga0207683_10001875 | 3300026121 | Bacteria | 18598 |
| 450 | Ga0207683_11307136 | 3300026121 | Bacteria | 671 |
| 451 | Ga0207698_10007075 | 3300026142 | Bacteria | 7027 |
| 452 | Ga0207698_10080557 | 3300026142 | Bacteria | 2623 |
| 453 | Ga0207698_10109516 | 3300026142 | Bacteria | 2311 |
| 454 | Ga0207698_10431231 | 3300026142 | Bacteria | 1268 |
| 455 | Ga0268266_10044210 | 3300028379 | Bacteria | 3807 |
| 456 | Ga0268266_10172656 | 3300028379 | Bacteria | 1963 |
| 457 | Ga0268265_10040794 | 3300028380 | Bacteria | 3430 |
| 458 | Ga0268264_10017033 | 3300028381 | Bacteria | 5950 |
| 459 | Ga0307408_100044148 | 3300031548 | Bacteria | 3175 |
| 460 | Ga0307408_100213436 | 3300031548 | Bacteria | 1570 |
| 461 | Ga0307408_100566687 | 3300031548 | Bacteria | 1004 |
| 462 | Ga0307408_100729657 | 3300031548 | Bacteria | 893 |
| 463 | Ga0307405_10243942 | 3300031731 | Bacteria | 1332 |
| 464 | Ga0307405_10304030 | 3300031731 | Bacteria | 1211 |
| 465 | Ga0307405_11161715 | 3300031731 | Bacteria | 666 |
| 466 | Ga0307413_10008914 | 3300031824 | Bacteria | 4767 |
| 467 | Ga0307413_10035806 | 3300031824 | Bacteria | 2851 |
| 468 | Ga0307413_10130455 | 3300031824 | Bacteria | 1719 |
| 469 | Ga0307413_10189860 | 3300031824 | Bacteria | 1474 |
| 470 | Ga0307413_10228074 | 3300031824 | Bacteria | 1366 |
| 471 | Ga0307410_10024280 | 3300031852 | Bacteria | 3785 |
| 472 | Ga0307410_10026955 | 3300031852 | Bacteria | 3625 |
| 473 | Ga0307410_10164561 | 3300031852 | Bacteria | 1665 |
| 474 | Ga0307410_10223589 | 3300031852 | Bacteria | 1449 |
| 475 | Ga0307410_10615464 | 3300031852 | Bacteria | 907 |
| 476 | Ga0307410_10793464 | 3300031852 | Bacteria | 805 |
| 477 | Ga0307406_10047607 | 3300031901 | Bacteria | 2703 |
| 478 | Ga0307407_10008712 | 3300031903 | Bacteria | 4675 |
| 479 | Ga0307407_10743834 | 3300031903 | Bacteria | 742 |
| 480 | Ga0307412_10160530 | 3300031911 | Bacteria | 1669 |
| 481 | Ga0307412_10228457 | 3300031911 | Bacteria | 1431 |
| 482 | Ga0307409_100038091 | 3300031995 | Bacteria | 3552 |
| 483 | Ga0307409_100058450 | 3300031995 | Bacteria | 2995 |
| 484 | Ga0307409_100216086 | 3300031995 | Bacteria | 1727 |
| 485 | Ga0307409_100339536 | 3300031995 | Bacteria | 1413 |
| 486 | Ga0307409_100806281 | 3300031995 | Bacteria | 947 |
| 487 | Ga0307416_100008755 | 3300032002 | Bacteria | 6558 |
| 488 | Ga0307416_100124409 | 3300032002 | Bacteria | 2307 |
| 489 | Ga0307416_101319254 | 3300032002 | Bacteria | 827 |
| 490 | Ga0307416_102717469 | 3300032002 | Bacteria | 591 |
| 491 | Ga0307414_10061944 | 3300032004 | Bacteria | 2652 |
| 492 | Ga0307414_10066601 | 3300032004 | Bacteria | 2576 |
| 493 | Ga0307414_10329463 | 3300032004 | Bacteria | 1303 |
| 494 | Ga0307414_10376929 | 3300032004 | Bacteria | 1225 |
| 495 | Ga0307414_10516567 | 3300032004 | Bacteria | 1059 |
| 496 | Ga0307411_10085846 | 3300032005 | Bacteria | 2181 |
| 497 | Ga0307411_10124749 | 3300032005 | Bacteria | 1870 |
| 498 | Ga0307411_10480429 | 3300032005 | Bacteria | 1046 |
| 499 | Ga0307411_10749717 | 3300032005 | Bacteria | 855 |
| 500 | Ga0307415_100001996 | 3300032126 | Bacteria | 10039 |
| 501 | Ga0307415_100286122 | 3300032126 | Bacteria | 1358 |
| 502 | Ga0373940_0105209 | 3300035088 | Bacteria | 861 |
| 503 | Ga0373960_0105963 | 3300035121 | Bacteria | 917 |
| 504 | Ga0373943_0027220 | 3300035170 | Bacteria | 2684 |
| 505 | Ga0373943_0088509 | 3300035170 | Bacteria | 1600 |
| 506 | Ga0373946_0072105 | 3300035171 | Bacteria | 1494 |
| 507 | Ga0373931_0024649 | 3300035691 | Bacteria | 3050 |
| 508 | Ga0373935_0025894 | 3300035692 | Bacteria | 3616 |
| 509 | Ga0373935_0864009 | 3300035692 | Bacteria | 669 |
| 510 | Ga0373927_0073121 | 3300035695 | Bacteria | 2220 |
| 511 | Ga0373937_0706573 | 3300036401 | Bacteria | 955 |
| 512 | Ga0373925_0156912 | 3300037068 | Bacteria | 1790 |
| 513 | Ga0395899_0000162 | 3300037312 | Bacteria | 102362 |
| 514 | Ga0395899_0003851 | 3300037312 | Bacteria | 11832 |
| 515 | Ga0395899_0028386 | 3300037312 | Bacteria | 4214 |
| 516 | Ga0395899_0045105 | 3300037312 | Bacteria | 3284 |
| 517 | Ga0395899_0045872 | 3300037312 | Bacteria | 3256 |
| 518 | Ga0395899_0054694 | 3300037312 | Bacteria | 2953 |
| 519 | Ga0395899_0088836 | 3300037312 | Bacteria | 2242 |
| 520 | Ga0395899_0110059 | 3300037312 | Bacteria | 1981 |
| 521 | Ga0395899_0162586 | 3300037312 | Bacteria | 1576 |
| 522 | Ga0395899_0174444 | 3300037312 | Bacteria | 1512 |
| 523 | Ga0395899_0365590 | 3300037312 | Bacteria | 962 |
| 524 | Ga0395899_0384809 | 3300037312 | Bacteria | 931 |
| 525 | Ga0395899_0413942 | 3300037312 | Bacteria | 889 |
| 526 | Ga0395899_0504765 | 3300037312 | Bacteria | 784 |
| 527 | Ga0395900_0000129 | 3300037418 | Bacteria | 126281 |
| 528 | Ga0395900_0000666 | 3300037418 | Bacteria | 45776 |
| 529 | Ga0395900_0001095 | 3300037418 | Bacteria | 34481 |
| 530 | Ga0395900_0007391 | 3300037418 | Bacteria | 11357 |
| 531 | Ga0395900_0020412 | 3300037418 | Bacteria | 6764 |
| 532 | Ga0395900_0022227 | 3300037418 | Bacteria | 6488 |
| 533 | Ga0395900_0036019 | 3300037418 | Bacteria | 5099 |
| 534 | Ga0395900_0041106 | 3300037418 | Bacteria | 4767 |
| 535 | Ga0395900_0070992 | 3300037418 | Bacteria | 3579 |
| 536 | Ga0395900_0078633 | 3300037418 | Bacteria | 3389 |
| 537 | Ga0395900_0095368 | 3300037418 | Bacteria | 3057 |
| 538 | Ga0395900_0109098 | 3300037418 | Bacteria | 2843 |
| 539 | Ga0395900_0367236 | 3300037418 | Bacteria | 1409 |
| 540 | Ga0395900_0452206 | 3300037418 | Bacteria | 1240 |
| 541 | Ga0395900_0543798 | 3300037418 | Bacteria | 1107 |
| 542 | Ga0395900_1003935 | 3300037418 | Bacteria | 754 |
| 543 | Ga0395900_1005244 | 3300037418 | Bacteria | 754 |
| 544 | Ga0395900_1140250 | 3300037418 | Bacteria | 696 |
| 545 | Ga0395900_1147418 | 3300037418 | Bacteria | 693 |
| 546 | Ga0395898_0001704 | 3300037466 | Bacteria | 29248 |
| 547 | Ga0395898_0009787 | 3300037466 | Bacteria | 10046 |
| 548 | Ga0395898_0041651 | 3300037466 | Bacteria | 4535 |
| 549 | Ga0395898_0045291 | 3300037466 | Bacteria | 4325 |
| 550 | Ga0395898_0055623 | 3300037466 | Bacteria | 3859 |
| 551 | Ga0395898_0059310 | 3300037466 | Bacteria | 3723 |
| 552 | Ga0395898_0062586 | 3300037466 | Bacteria | 3613 |
| 553 | Ga0395898_0073614 | 3300037466 | Bacteria | 3300 |
| 554 | Ga0395898_0083099 | 3300037466 | Bacteria | 3086 |
| 555 | Ga0395898_0085965 | 3300037466 | Bacteria | 3031 |
| 556 | Ga0395898_0088891 | 3300037466 | Bacteria | 2973 |
| 557 | Ga0395898_0176370 | 3300037466 | Bacteria | 2043 |
| 558 | Ga0395898_0712458 | 3300037466 | Bacteria | 945 |
| 559 | Ga0395898_1311499 | 3300037466 | Bacteria | 653 |
| 560 | Ga0395905_0001395 | 3300037471 | Bacteria | 29258 |
| 561 | Ga0395905_0003061 | 3300037471 | Bacteria | 18107 |
| 562 | Ga0395905_0014155 | 3300037471 | Bacteria | 7622 |
| 563 | Ga0395905_0019204 | 3300037471 | Bacteria | 6481 |
| 564 | Ga0395905_0055854 | 3300037471 | Bacteria | 3695 |
| 565 | Ga0395905_0099581 | 3300037471 | Bacteria | 2730 |
| 566 | Ga0395905_0166526 | 3300037471 | Bacteria | 2071 |
| 567 | Ga0395905_0170237 | 3300037471 | Bacteria | 2046 |
| 568 | Ga0395905_0173511 | 3300037471 | Bacteria | 2025 |
| 569 | Ga0395905_0176567 | 3300037471 | Bacteria | 2005 |
| 570 | Ga0395905_0183648 | 3300037471 | Bacteria | 1963 |
| 571 | Ga0395905_0358615 | 3300037471 | Bacteria | 1350 |
| 572 | Ga0395901_0000111 | 3300038443 | Bacteria | 112522 |
| 573 | Ga0395901_0012693 | 3300038443 | Bacteria | 8546 |
| 574 | Ga0395901_0015987 | 3300038443 | Bacteria | 7646 |
| 575 | Ga0395901_0024546 | 3300038443 | Bacteria | 6190 |
| 576 | Ga0395901_0035383 | 3300038443 | Bacteria | 5158 |
| 577 | Ga0395901_0056099 | 3300038443 | Bacteria | 4098 |
| 578 | Ga0395901_0078608 | 3300038443 | Bacteria | 3444 |
| 579 | Ga0395901_0088862 | 3300038443 | Bacteria | 3232 |
| 580 | Ga0395901_0127521 | 3300038443 | Bacteria | 2674 |
| 581 | Ga0395901_0155006 | 3300038443 | Bacteria | 2406 |
| 582 | Ga0395901_0203939 | 3300038443 | Bacteria | 2072 |
| 583 | Ga0395901_0286757 | 3300038443 | Bacteria | 1709 |
| 584 | Ga0395901_0400112 | 3300038443 | Bacteria | 1411 |
| 585 | Ga0395901_0906881 | 3300038443 | Bacteria | 863 |
| 586 | Ga0436363_0451272 | 3300039450 | Bacteria | 951 |
| 587 | Ga0439465_0023521 | 3300041413 | Bacteria | 1939 |
| 588 | Ga0451798_0398690 | 3300041458 | Bacteria | 765 |
| 589 | Ga0451853_2987684 | 3300041512 | Bacteria | 823 |
| 590 | Ga0439445_0003001 | 3300042004 | Bacteria | 3778 |
| 591 | Ga0439458_0000647 | 3300042157 | Bacteria | 8989 |
| 592 | Ga0466969_0008689 | 3300044656 | Bacteria | 5388 |
| 593 | Ga0466969_0082581 | 3300044656 | Bacteria | 1531 |
| 594 | Ga0466972_0023375 | 3300044658 | Bacteria | 3075 |
| 595 | Ga0466972_0027190 | 3300044658 | Bacteria | 2831 |
| 596 | Ga0466965_0125612 | 3300044683 | Bacteria | 1327 |
| 597 | Ga0466966_0000026 | 3300044684 | Bacteria | 106896 |
| 598 | Ga0466966_0018412 | 3300044684 | Bacteria | 4607 |
| 599 | Ga0466966_0020740 | 3300044684 | Bacteria | 4319 |
| 600 | Ga0466966_0073956 | 3300044684 | Bacteria | 2131 |
| 601 | Ga0466966_0077307 | 3300044684 | Bacteria | 2077 |
| 602 | Ga0466966_0092257 | 3300044684 | Unclassified | 1879 |
| 603 | Ga0466961_0111094 | 3300044693 | Bacteria | 1724 |
| 604 | Ga0466961_0140180 | 3300044693 | Bacteria | 1514 |
| 605 | Ga0466961_0153201 | 3300044693 | Bacteria | 1438 |
| 606 | Ga0466961_0173969 | 3300044693 | Bacteria | 1338 |
| 607 | Ga0466963_0023556 | 3300044694 | Bacteria | 3911 |
| 608 | Ga0466963_0101549 | 3300044694 | Bacteria | 1969 |
| 609 | Ga0466964_0624972 | 3300044706 | Unclassified | 593 |
| 610 | Ga0466971_0057327 | 3300044719 | Bacteria | 1757 |
| 611 | Ga0466968_0013379 | 3300044735 | Bacteria | 3226 |
| 612 | Ga0466970_0036825 | 3300044765 | Bacteria | 2592 |
| 613 | Ga0466970_0089168 | 3300044765 | Bacteria | 1673 |
| 614 | Ga0466970_0142602 | 3300044765 | Bacteria | 1320 |
| 615 | Ga0466970_0390442 | 3300044765 | Bacteria | 793 |
| 616 | Ga0466970_0443736 | 3300044765 | Bacteria | 743 |
| 617 | Ga0466957_0048990 | 3300044842 | Bacteria | 2568 |
| 618 | Ga0466957_0132580 | 3300044842 | Bacteria | 1598 |
| 619 | Ga0466960_0176726 | 3300044901 | Bacteria | 1155 |
| 620 | Ga0466959_0056375 | 3300045049 | Bacteria | 2867 |
| 621 | Ga0466959_0060828 | 3300045049 | Bacteria | 2747 |
| 622 | Ga0466959_0112786 | 3300045049 | Bacteria | 1939 |
| 623 | Ga0466959_0185950 | 3300045049 | Bacteria | 1451 |
| 624 | Ga0466958_0029167 | 3300045836 | Bacteria | 3273 |
| 625 | Ga0466958_0037711 | 3300045836 | Bacteria | 2896 |
| 626 | Ga0466958_0088413 | 3300045836 | Bacteria | 1914 |
| 627 | Ga0466967_0040164 | 3300045976 | Bacteria | 4027 |
| 628 | Ga0466967_0071169 | 3300045976 | Bacteria | 3113 |
| 629 | Ga0466967_0129433 | 3300045976 | Bacteria | 2341 |
| 630 | Ga0466967_0145350 | 3300045976 | Bacteria | 2212 |
| 631 | Ga0466967_0240234 | 3300045976 | Bacteria | 1728 |
| 632 | Ga0495650_0000759 | 3300046471 | Bacteria | 40294 |
| 633 | Ga0495663_0007104 | 3300046525 | Bacteria | 3091 |
| 634 | Ga0495663_0037337 | 3300046525 | Bacteria | 1465 |
| 635 | Ga0495642_0010946 | 3300046528 | Bacteria | 3477 |
| 636 | Ga0495642_0156517 | 3300046528 | Bacteria | 987 |
| 637 | Ga0495598_0000126 | 3300046537 | Bacteria | 12859 |
| 638 | Ga0495621_0000046 | 3300046539 | Bacteria | 24616 |
| 639 | Ga0495669_0000394 | 3300046684 | Bacteria | 21743 |
| 640 | Ga0495669_0093934 | 3300046684 | Bacteria | 1388 |
| 641 | Ga0495670_0043527 | 3300046691 | Bacteria | 2240 |
| 642 | Ga0495649_0117601 | 3300046694 | Bacteria | 1407 |
| 643 | Ga0495677_0007021 | 3300047445 | Bacteria | 4220 |
| 644 | Ga0496100_0001483 | 3300048903 | Bacteria | 11478 |
| 645 | Ga0496102_0414065 | 3300048905 | Bacteria | 1266 |
| 646 | Ga0496104_0126715 | 3300048907 | Bacteria | 2452 |
| 647 | Ga0496105_0457882 | 3300048908 | Bacteria | 1006 |
| 648 | Ga0496107_0035183 | 3300048910 | Bacteria | 3590 |
| 649 | Ga0496108_0006078 | 3300048911 | Bacteria | 9762 |
| 650 | Ga0496109_0951873 | 3300048912 | Bacteria | 796 |
| 651 | Ga0496110_0002522 | 3300048913 | Bacteria | 13754 |
| 652 | Ga0496111_0025728 | 3300048914 | Bacteria | 4152 |
| 653 | Ga0496111_0356084 | 3300048914 | Unclassified | 1083 |
| 654 | Ga0496112_0027081 | 3300048915 | Bacteria | 5525 |
| 655 | Ga0496112_0179822 | 3300048915 | Bacteria | 2079 |
| 656 | Ga0496112_0548645 | 3300048915 | Bacteria | 1090 |
| 657 | Ga0496114_0000016 | 3300048917 | Bacteria | 274656 |
| 658 | Ga0501031_0686881 | 3300049568 | Bacteria | 657 |
| 659 | Ga0501033_0063644 | 3300049570 | Bacteria | 2715 |
| 660 | Ga0501047_0995895 | 3300049581 | Bacteria | 651 |
| 661 | Ga0501080_0253872 | 3300049742 | Bacteria | 1603 |
| 662 | Ga0501035_0002613 | 3300049822 | Bacteria | 17571 |
| 663 | Ga0500608_000251 | 3300053122 | Bacteria | 21005 |
| 664 | Ga0500614_069827 | 3300053123 | Bacteria | 962 |
| 665 | Ga0466962_0043867 | 3300061719 | Bacteria | 2140 |
| 666 | Ga0466962_0328353 | 3300061719 | Unclassified | 759 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005344 | Ga0070661_101093944 | Ga0070661_1010939441 | 149 |
| 2 | 3300031731 | Ga0307405_10304030 | Ga0307405_103040302 | 150 |
| 3 | 3300031824 | Ga0307413_10130455 | Ga0307413_101304552 | 150 |
| 4 | 3300031852 | Ga0307410_10223589 | Ga0307410_102235892 | 150 |
| 5 | 3300031901 | Ga0307406_10047607 | Ga0307406_100476073 | 150 |
| 6 | 3300031995 | Ga0307409_100058450 | Ga0307409_1000584503 | 150 |
| 7 | 3300038443 | Ga0395901_0906881 | Ga0395901_0906881_232_732 | 155 |
| 8 | 3300025933 | Ga0207706_10075634 | Ga0207706_100756344 | 159 |
| 9 | 3300046471 | Ga0495650_0000759 | Ga0495650_0000759_8604_9140 | 159 |
| 10 | 3300044656 | Ga0466969_0082581 | Ga0466969_0082581_26_511 | 161 |
| 11 | 3300005347 | Ga0070668_100000700 | Ga0070668_1000007005 | 162 |
| 12 | 3300026118 | Ga0207675_100238187 | Ga0207675_1002381872 | 162 |
| 13 | 3300044706 | Ga0466964_0624972 | Ga0466964_0624972_15_503 | 162 |
| 14 | 3300005327 | Ga0070658_10006930 | Ga0070658_100069305 | 166 |
| 15 | 3300005339 | Ga0070660_100001180 | Ga0070660_1000011809 | 166 |
| 16 | 3300005563 | Ga0068855_100000348 | Ga0068855_10000034842 | 166 |
| 17 | 3300013102 | Ga0157371_10005915 | Ga0157371_100059156 | 166 |
| 18 | 3300013307 | Ga0157372_13002186 | Ga0157372_130021861 | 166 |
| 19 | 3300025909 | Ga0207705_10000208 | Ga0207705_1000020858 | 166 |
| 20 | 3300025919 | Ga0207657_10009904 | Ga0207657_100099046 | 166 |
| 21 | 3300025949 | Ga0207667_10004351 | Ga0207667_100043518 | 166 |
| 22 | 3300048915 | Ga0496112_0548645 | Ga0496112_0548645_20_520 | 166 |
| 23 | 3300031548 | Ga0307408_100044148 | Ga0307408_1000441481 | 167 |
| 24 | 3300032004 | Ga0307414_10329463 | Ga0307414_103294631 | 167 |
| 25 | 3300026116 | Ga0207674_10692424 | Ga0207674_106924242 | 168 |
| 26 | 3300005615 | Ga0070702_100269024 | Ga0070702_1002690242 | 169 |
| 27 | iso_pu_bacteria | 2885427238 | 2885429570 | 174 |
| 28 | iso_pu_bacteria | 2895880812 | 2895883340 | 174 |
| 29 | 3300005295 | Ga0065707_10691866 | Ga0065707_106918661 | 175 |
| 30 | 3300005343 | Ga0070687_100720546 | Ga0070687_1007205461 | 175 |
| 31 | 3300005841 | Ga0068863_100652043 | Ga0068863_1006520431 | 175 |
| 32 | 3300025912 | Ga0207707_10814054 | Ga0207707_108140542 | 176 |
| 33 | 3300031824 | Ga0307413_10008914 | Ga0307413_100089145 | 176 |
| 34 | 3300031852 | Ga0307410_10793464 | Ga0307410_107934642 | 176 |
| 35 | 3300005339 | Ga0070660_100228579 | Ga0070660_1002285792 | 177 |
| 36 | 3300032004 | Ga0307414_10376929 | Ga0307414_103769292 | 177 |
| 37 | 3300032004 | Ga0307414_10516567 | Ga0307414_105165672 | 177 |
| 38 | 3300032005 | Ga0307411_10480429 | Ga0307411_104804292 | 177 |
| 39 | 3300046694 | Ga0495649_0117601 | Ga0495649_0117601_294_839 | 177 |
| 40 | 3300001904 | JGI24736J21556_1000429 | JGI24736J21556_10004299 | 178 |
| 41 | 3300001979 | JGI24740J21852_10034310 | JGI24740J21852_100343102 | 178 |
| 42 | 3300001979 | JGI24740J21852_10036549 | JGI24740J21852_100365493 | 178 |
| 43 | 3300001989 | JGI24739J22299_10075657 | JGI24739J22299_100756572 | 178 |
| 44 | 3300001989 | JGI24739J22299_10081554 | JGI24739J22299_100815542 | 178 |
| 45 | 3300001990 | JGI24737J22298_10002041 | JGI24737J22298_100020416 | 178 |
| 46 | 3300001990 | JGI24737J22298_10012796 | JGI24737J22298_100127964 | 178 |
| 47 | 3300002067 | JGI24735J21928_10005786 | JGI24735J21928_100057864 | 178 |
| 48 | 3300002067 | JGI24735J21928_10118969 | JGI24735J21928_101189692 | 178 |
| 49 | 3300003323 | rootH1_10039483 | rootH1_100394832 | 178 |
| 50 | 3300003323 | rootH1_10103011 | rootH1_101030112 | 178 |
| 51 | 3300005290 | Ga0065712_10086820 | Ga0065712_100868204 | 178 |
| 52 | 3300005327 | Ga0070658_10003637 | Ga0070658_100036373 | 178 |
| 53 | 3300005327 | Ga0070658_10026798 | Ga0070658_100267983 | 178 |
| 54 | 3300005327 | Ga0070658_10043380 | Ga0070658_100433801 | 178 |
| 55 | 3300005327 | Ga0070658_10065768 | Ga0070658_100657685 | 178 |
| 56 | 3300005327 | Ga0070658_10104580 | Ga0070658_101045804 | 178 |
| 57 | 3300005327 | Ga0070658_10222545 | Ga0070658_102225452 | 178 |
| 58 | 3300005327 | Ga0070658_10278884 | Ga0070658_102788842 | 178 |
| 59 | 3300005327 | Ga0070658_10329252 | Ga0070658_103292523 | 178 |
| 60 | 3300005327 | Ga0070658_10704565 | Ga0070658_107045652 | 178 |
| 61 | 3300005328 | Ga0070676_10063300 | Ga0070676_100633004 | 178 |
| 62 | 3300005328 | Ga0070676_10077480 | Ga0070676_100774804 | 178 |
| 63 | 3300005328 | Ga0070676_10086551 | Ga0070676_100865511 | 178 |
| 64 | 3300005328 | Ga0070676_10191116 | Ga0070676_101911162 | 178 |
| 65 | 3300005328 | Ga0070676_10196780 | Ga0070676_101967802 | 178 |
| 66 | 3300005329 | Ga0070683_100011628 | Ga0070683_10001162812 | 178 |
| 67 | 3300005329 | Ga0070683_100014144 | Ga0070683_1000141448 | 178 |
| 68 | 3300005329 | Ga0070683_100084678 | Ga0070683_1000846783 | 178 |
| 69 | 3300005330 | Ga0070690_100020192 | Ga0070690_1000201923 | 178 |
| 70 | 3300005331 | Ga0070670_100047097 | Ga0070670_1000470973 | 178 |
| 71 | 3300005331 | Ga0070670_100352182 | Ga0070670_1003521822 | 178 |
| 72 | 3300005331 | Ga0070670_100419596 | Ga0070670_1004195962 | 178 |
| 73 | 3300005334 | Ga0068869_100551511 | Ga0068869_1005515112 | 178 |
| 74 | 3300005335 | Ga0070666_10000205 | Ga0070666_1000020531 | 178 |
| 75 | 3300005335 | Ga0070666_10010766 | Ga0070666_100107663 | 178 |
| 76 | 3300005335 | Ga0070666_10117471 | Ga0070666_101174712 | 178 |
| 77 | 3300005335 | Ga0070666_10266774 | Ga0070666_102667743 | 178 |
| 78 | 3300005336 | Ga0070680_100000229 | Ga0070680_10000022915 | 178 |
| 79 | 3300005336 | Ga0070680_100005897 | Ga0070680_10000589711 | 178 |
| 80 | 3300005336 | Ga0070680_100490581 | Ga0070680_1004905812 | 178 |
| 81 | 3300005336 | Ga0070680_101476148 | Ga0070680_1014761481 | 178 |
| 82 | 3300005338 | Ga0068868_100025077 | Ga0068868_1000250775 | 178 |
| 83 | 3300005338 | Ga0068868_100167222 | Ga0068868_1001672222 | 178 |
| 84 | 3300005338 | Ga0068868_100291857 | Ga0068868_1002918572 | 178 |
| 85 | 3300005339 | Ga0070660_100002854 | Ga0070660_1000028542 | 178 |
| 86 | 3300005339 | Ga0070660_100010429 | Ga0070660_1000104296 | 178 |
| 87 | 3300005339 | Ga0070660_100015550 | Ga0070660_1000155503 | 178 |
| 88 | 3300005339 | Ga0070660_100015669 | Ga0070660_1000156692 | 178 |
| 89 | 3300005339 | Ga0070660_100023169 | Ga0070660_1000231693 | 178 |
| 90 | 3300005339 | Ga0070660_100133785 | Ga0070660_1001337854 | 178 |
| 91 | 3300005339 | Ga0070660_100148585 | Ga0070660_1001485854 | 178 |
| 92 | 3300005339 | Ga0070660_100153074 | Ga0070660_1001530743 | 178 |
| 93 | 3300005339 | Ga0070660_100157167 | Ga0070660_1001571671 | 178 |
| 94 | 3300005339 | Ga0070660_100263971 | Ga0070660_1002639713 | 178 |
| 95 | 3300005339 | Ga0070660_100861495 | Ga0070660_1008614952 | 178 |
| 96 | 3300005340 | Ga0070689_100644550 | Ga0070689_1006445501 | 178 |
| 97 | 3300005341 | Ga0070691_10160898 | Ga0070691_101608983 | 178 |
| 98 | 3300005344 | Ga0070661_100014911 | Ga0070661_1000149114 | 178 |
| 99 | 3300005344 | Ga0070661_100038190 | Ga0070661_1000381902 | 178 |
| 100 | 3300005344 | Ga0070661_100038774 | Ga0070661_1000387743 | 178 |
| 101 | 3300005344 | Ga0070661_100041395 | Ga0070661_1000413953 | 178 |
| 102 | 3300005344 | Ga0070661_100256212 | Ga0070661_1002562122 | 178 |
| 103 | 3300005344 | Ga0070661_100543748 | Ga0070661_1005437482 | 178 |
| 104 | 3300005344 | Ga0070661_100577890 | Ga0070661_1005778902 | 178 |
| 105 | 3300005345 | Ga0070692_10415980 | Ga0070692_104159801 | 178 |
| 106 | 3300005347 | Ga0070668_100591003 | Ga0070668_1005910032 | 178 |
| 107 | 3300005353 | Ga0070669_100005914 | Ga0070669_10000591410 | 178 |
| 108 | 3300005354 | Ga0070675_100287515 | Ga0070675_1002875152 | 178 |
| 109 | 3300005355 | Ga0070671_100000133 | Ga0070671_10000013328 | 178 |
| 110 | 3300005356 | Ga0070674_100021297 | Ga0070674_1000212975 | 178 |
| 111 | 3300005356 | Ga0070674_100053278 | Ga0070674_1000532785 | 178 |
| 112 | 3300005356 | Ga0070674_100538326 | Ga0070674_1005383262 | 178 |
| 113 | 3300005364 | Ga0070673_100006883 | Ga0070673_1000068834 | 178 |
| 114 | 3300005364 | Ga0070673_100206422 | Ga0070673_1002064221 | 178 |
| 115 | 3300005364 | Ga0070673_100597302 | Ga0070673_1005973022 | 178 |
| 116 | 3300005364 | Ga0070673_100650950 | Ga0070673_1006509501 | 178 |
| 117 | 3300005364 | Ga0070673_100717872 | Ga0070673_1007178721 | 178 |
| 118 | 3300005364 | Ga0070673_100974843 | Ga0070673_1009748431 | 178 |
| 119 | 3300005366 | Ga0070659_100010839 | Ga0070659_1000108398 | 178 |
| 120 | 3300005366 | Ga0070659_100027397 | Ga0070659_1000273974 | 178 |
| 121 | 3300005366 | Ga0070659_100052396 | Ga0070659_1000523966 | 178 |
| 122 | 3300005366 | Ga0070659_100091603 | Ga0070659_1000916032 | 178 |
| 123 | 3300005366 | Ga0070659_100100363 | Ga0070659_1001003631 | 178 |
| 124 | 3300005366 | Ga0070659_100129935 | Ga0070659_1001299353 | 178 |
| 125 | 3300005366 | Ga0070659_100135475 | Ga0070659_1001354754 | 178 |
| 126 | 3300005366 | Ga0070659_100280346 | Ga0070659_1002803462 | 178 |
| 127 | 3300005366 | Ga0070659_100558587 | Ga0070659_1005585872 | 178 |
| 128 | 3300005366 | Ga0070659_100892757 | Ga0070659_1008927572 | 178 |
| 129 | 3300005367 | Ga0070667_100000117 | Ga0070667_10000011724 | 178 |
| 130 | 3300005367 | Ga0070667_100076907 | Ga0070667_1000769074 | 178 |
| 131 | 3300005367 | Ga0070667_100081100 | Ga0070667_1000811002 | 178 |
| 132 | 3300005367 | Ga0070667_100198814 | Ga0070667_1001988143 | 178 |
| 133 | 3300005367 | Ga0070667_100370723 | Ga0070667_1003707231 | 178 |
| 134 | 3300005367 | Ga0070667_100394795 | Ga0070667_1003947952 | 178 |
| 135 | 3300005434 | Ga0070709_10006547 | Ga0070709_100065478 | 178 |
| 136 | 3300005435 | Ga0070714_100016021 | Ga0070714_1000160216 | 178 |
| 137 | 3300005435 | Ga0070714_100026448 | Ga0070714_1000264483 | 178 |
| 138 | 3300005435 | Ga0070714_100088232 | Ga0070714_1000882323 | 178 |
| 139 | 3300005436 | Ga0070713_100215799 | Ga0070713_1002157993 | 178 |
| 140 | 3300005455 | Ga0070663_100003630 | Ga0070663_1000036304 | 178 |
| 141 | 3300005455 | Ga0070663_100011822 | Ga0070663_1000118225 | 178 |
| 142 | 3300005455 | Ga0070663_100018751 | Ga0070663_1000187516 | 178 |
| 143 | 3300005455 | Ga0070663_100325918 | Ga0070663_1003259181 | 178 |
| 144 | 3300005456 | Ga0070678_100006084 | Ga0070678_1000060846 | 178 |
| 145 | 3300005456 | Ga0070678_100008440 | Ga0070678_1000084403 | 178 |
| 146 | 3300005456 | Ga0070678_101005326 | Ga0070678_1010053262 | 178 |
| 147 | 3300005457 | Ga0070662_100033639 | Ga0070662_1000336394 | 178 |
| 148 | 3300005457 | Ga0070662_100052944 | Ga0070662_1000529443 | 178 |
| 149 | 3300005457 | Ga0070662_100053666 | Ga0070662_1000536664 | 178 |
| 150 | 3300005457 | Ga0070662_100125597 | Ga0070662_1001255972 | 178 |
| 151 | 3300005457 | Ga0070662_100272819 | Ga0070662_1002728191 | 178 |
| 152 | 3300005458 | Ga0070681_10971914 | Ga0070681_109719141 | 178 |
| 153 | 3300005459 | Ga0068867_100025826 | Ga0068867_1000258267 | 178 |
| 154 | 3300005466 | Ga0070685_10169273 | Ga0070685_101692733 | 178 |
| 155 | 3300005530 | Ga0070679_100020999 | Ga0070679_1000209998 | 178 |
| 156 | 3300005530 | Ga0070679_100413858 | Ga0070679_1004138582 | 178 |
| 157 | 3300005530 | Ga0070679_100738186 | Ga0070679_1007381862 | 178 |
| 158 | 3300005530 | Ga0070679_100829586 | Ga0070679_1008295861 | 178 |
| 159 | 3300005535 | Ga0070684_100091522 | Ga0070684_1000915225 | 178 |
| 160 | 3300005535 | Ga0070684_100560127 | Ga0070684_1005601272 | 178 |
| 161 | 3300005539 | Ga0068853_100000058 | Ga0068853_10000005840 | 178 |
| 162 | 3300005539 | Ga0068853_100054142 | Ga0068853_1000541424 | 178 |
| 163 | 3300005539 | Ga0068853_100123718 | Ga0068853_1001237185 | 178 |
| 164 | 3300005539 | Ga0068853_100187006 | Ga0068853_1001870061 | 178 |
| 165 | 3300005539 | Ga0068853_100412658 | Ga0068853_1004126582 | 178 |
| 166 | 3300005543 | Ga0070672_100010294 | Ga0070672_1000102947 | 178 |
| 167 | 3300005543 | Ga0070672_100029023 | Ga0070672_1000290235 | 178 |
| 168 | 3300005543 | Ga0070672_100070995 | Ga0070672_1000709954 | 178 |
| 169 | 3300005543 | Ga0070672_100103892 | Ga0070672_1001038921 | 178 |
| 170 | 3300005543 | Ga0070672_100462297 | Ga0070672_1004622972 | 178 |
| 171 | 3300005543 | Ga0070672_100609855 | Ga0070672_1006098551 | 178 |
| 172 | 3300005544 | Ga0070686_100012937 | Ga0070686_1000129373 | 178 |
| 173 | 3300005548 | Ga0070665_100084998 | Ga0070665_1000849984 | 178 |
| 174 | 3300005548 | Ga0070665_101000571 | Ga0070665_1010005712 | 178 |
| 175 | 3300005563 | Ga0068855_100001283 | Ga0068855_10000128323 | 178 |
| 176 | 3300005563 | Ga0068855_100007269 | Ga0068855_1000072699 | 178 |
| 177 | 3300005563 | Ga0068855_100069229 | Ga0068855_1000692295 | 178 |
| 178 | 3300005563 | Ga0068855_100670192 | Ga0068855_1006701922 | 178 |
| 179 | 3300005564 | Ga0070664_100011148 | Ga0070664_1000111484 | 178 |
| 180 | 3300005564 | Ga0070664_100014737 | Ga0070664_1000147376 | 178 |
| 181 | 3300005564 | Ga0070664_100064168 | Ga0070664_1000641684 | 178 |
| 182 | 3300005564 | Ga0070664_100130761 | Ga0070664_1001307612 | 178 |
| 183 | 3300005564 | Ga0070664_100181732 | Ga0070664_1001817323 | 178 |
| 184 | 3300005564 | Ga0070664_100292712 | Ga0070664_1002927122 | 178 |
| 185 | 3300005564 | Ga0070664_100613787 | Ga0070664_1006137872 | 178 |
| 186 | 3300005564 | Ga0070664_100644929 | Ga0070664_1006449292 | 178 |
| 187 | 3300005577 | Ga0068857_100012184 | Ga0068857_1000121844 | 178 |
| 188 | 3300005577 | Ga0068857_100018460 | Ga0068857_1000184606 | 178 |
| 189 | 3300005577 | Ga0068857_100202379 | Ga0068857_1002023792 | 178 |
| 190 | 3300005578 | Ga0068854_100017544 | Ga0068854_1000175444 | 178 |
| 191 | 3300005578 | Ga0068854_100083528 | Ga0068854_1000835284 | 178 |
| 192 | 3300005578 | Ga0068854_100097771 | Ga0068854_1000977712 | 178 |
| 193 | 3300005578 | Ga0068854_100106041 | Ga0068854_1001060411 | 178 |
| 194 | 3300005578 | Ga0068854_100464728 | Ga0068854_1004647281 | 178 |
| 195 | 3300005614 | Ga0068856_100004010 | Ga0068856_1000040106 | 178 |
| 196 | 3300005614 | Ga0068856_100015637 | Ga0068856_1000156377 | 178 |
| 197 | 3300005614 | Ga0068856_100029419 | Ga0068856_1000294196 | 178 |
| 198 | 3300005614 | Ga0068856_100072266 | Ga0068856_1000722666 | 178 |
| 199 | 3300005614 | Ga0068856_100073402 | Ga0068856_1000734023 | 178 |
| 200 | 3300005614 | Ga0068856_100106988 | Ga0068856_1001069884 | 178 |
| 201 | 3300005614 | Ga0068856_100658372 | Ga0068856_1006583722 | 178 |
| 202 | 3300005615 | Ga0070702_100716648 | Ga0070702_1007166481 | 178 |
| 203 | 3300005616 | Ga0068852_100007749 | Ga0068852_1000077496 | 178 |
| 204 | 3300005616 | Ga0068852_100013576 | Ga0068852_1000135768 | 178 |
| 205 | 3300005616 | Ga0068852_100590696 | Ga0068852_1005906962 | 178 |
| 206 | 3300005616 | Ga0068852_100679190 | Ga0068852_1006791902 | 178 |
| 207 | 3300005616 | Ga0068852_100988400 | Ga0068852_1009884002 | 178 |
| 208 | 3300005616 | Ga0068852_101014038 | Ga0068852_1010140382 | 178 |
| 209 | 3300005616 | Ga0068852_101165336 | Ga0068852_1011653362 | 178 |
| 210 | 3300005617 | Ga0068859_100080429 | Ga0068859_1000804295 | 178 |
| 211 | 3300005617 | Ga0068859_100091900 | Ga0068859_1000919005 | 178 |
| 212 | 3300005617 | Ga0068859_100246090 | Ga0068859_1002460904 | 178 |
| 213 | 3300005618 | Ga0068864_100007806 | Ga0068864_1000078068 | 178 |
| 214 | 3300005618 | Ga0068864_101899621 | Ga0068864_1018996211 | 178 |
| 215 | 3300005718 | Ga0068866_10175585 | Ga0068866_101755852 | 178 |
| 216 | 3300005834 | Ga0068851_10098093 | Ga0068851_100980932 | 178 |
| 217 | 3300005834 | Ga0068851_10110499 | Ga0068851_101104993 | 178 |
| 218 | 3300005841 | Ga0068863_100000055 | Ga0068863_10000005556 | 178 |
| 219 | 3300005841 | Ga0068863_100001458 | Ga0068863_10000145817 | 178 |
| 220 | 3300005842 | Ga0068858_100000980 | Ga0068858_10000098015 | 178 |
| 221 | 3300005842 | Ga0068858_100038150 | Ga0068858_1000381504 | 178 |
| 222 | 3300005842 | Ga0068858_100491907 | Ga0068858_1004919072 | 178 |
| 223 | 3300005843 | Ga0068860_100015091 | Ga0068860_1000150913 | 178 |
| 224 | 3300005844 | Ga0068862_100251333 | Ga0068862_1002513332 | 178 |
| 225 | 3300006028 | Ga0070717_10030870 | Ga0070717_100308703 | 178 |
| 226 | 3300006163 | Ga0070715_10224231 | Ga0070715_102242312 | 178 |
| 227 | 3300006175 | Ga0070712_100032304 | Ga0070712_1000323042 | 178 |
| 228 | 3300006237 | Ga0097621_100181608 | Ga0097621_1001816083 | 178 |
| 229 | 3300006358 | Ga0068871_100363612 | Ga0068871_1003636122 | 178 |
| 230 | 3300006881 | Ga0068865_100079405 | Ga0068865_1000794051 | 178 |
| 231 | 3300006931 | Ga0097620_100080427 | Ga0097620_1000804275 | 178 |
| 232 | 3300006931 | Ga0097620_100091903 | Ga0097620_1000919035 | 178 |
| 233 | 3300006931 | Ga0097620_100246085 | Ga0097620_1002460852 | 178 |
| 234 | 3300009093 | Ga0105240_10076863 | Ga0105240_100768634 | 178 |
| 235 | 3300009093 | Ga0105240_10137255 | Ga0105240_101372554 | 178 |
| 236 | 3300009093 | Ga0105240_10232742 | Ga0105240_102327424 | 178 |
| 237 | 3300009093 | Ga0105240_10664599 | Ga0105240_106645992 | 178 |
| 238 | 3300009098 | Ga0105245_10059460 | Ga0105245_100594606 | 178 |
| 239 | 3300009098 | Ga0105245_10085636 | Ga0105245_100856364 | 178 |
| 240 | 3300009098 | Ga0105245_10104779 | Ga0105245_101047794 | 178 |
| 241 | 3300009148 | Ga0105243_11271993 | Ga0105243_112719931 | 178 |
| 242 | 3300009174 | Ga0105241_10121991 | Ga0105241_101219912 | 178 |
| 243 | 3300009174 | Ga0105241_10921215 | Ga0105241_109212152 | 178 |
| 244 | 3300009176 | Ga0105242_10004126 | Ga0105242_1000412611 | 178 |
| 245 | 3300009177 | Ga0105248_10000390 | Ga0105248_1000039039 | 178 |
| 246 | 3300009177 | Ga0105248_10037274 | Ga0105248_100372743 | 178 |
| 247 | 3300009177 | Ga0105248_10248704 | Ga0105248_102487044 | 178 |
| 248 | 3300009177 | Ga0105248_10339606 | Ga0105248_103396063 | 178 |
| 249 | 3300009545 | Ga0105237_10171582 | Ga0105237_101715822 | 178 |
| 250 | 3300009545 | Ga0105237_10555137 | Ga0105237_105551372 | 178 |
| 251 | 3300009545 | Ga0105237_10599276 | Ga0105237_105992761 | 178 |
| 252 | 3300009551 | Ga0105238_10006826 | Ga0105238_100068263 | 178 |
| 253 | 3300009551 | Ga0105238_10065141 | Ga0105238_100651414 | 178 |
| 254 | 3300009551 | Ga0105238_10630096 | Ga0105238_106300962 | 178 |
| 255 | 3300010375 | Ga0105239_10076898 | Ga0105239_100768985 | 178 |
| 256 | 3300010375 | Ga0105239_10988155 | Ga0105239_109881552 | 178 |
| 257 | 3300010375 | Ga0105239_12026330 | Ga0105239_120263301 | 178 |
| 258 | 3300011119 | Ga0105246_10100291 | Ga0105246_101002914 | 178 |
| 259 | 3300011119 | Ga0105246_10329691 | Ga0105246_103296911 | 178 |
| 260 | 3300013100 | Ga0157373_10032949 | Ga0157373_100329495 | 178 |
| 261 | 3300013100 | Ga0157373_10059212 | Ga0157373_100592123 | 178 |
| 262 | 3300013100 | Ga0157373_10075267 | Ga0157373_100752672 | 178 |
| 263 | 3300013100 | Ga0157373_10079476 | Ga0157373_100794763 | 178 |
| 264 | 3300013100 | Ga0157373_10432155 | Ga0157373_104321552 | 178 |
| 265 | 3300013100 | Ga0157373_10469705 | Ga0157373_104697051 | 178 |
| 266 | 3300013102 | Ga0157371_10010609 | Ga0157371_100106095 | 178 |
| 267 | 3300013102 | Ga0157371_10057924 | Ga0157371_100579245 | 178 |
| 268 | 3300013102 | Ga0157371_10065528 | Ga0157371_100655281 | 178 |
| 269 | 3300013102 | Ga0157371_10099661 | Ga0157371_100996614 | 178 |
| 270 | 3300013102 | Ga0157371_10167827 | Ga0157371_101678272 | 178 |
| 271 | 3300013104 | Ga0157370_10000707 | Ga0157370_1000070744 | 178 |
| 272 | 3300013104 | Ga0157370_10012615 | Ga0157370_100126158 | 178 |
| 273 | 3300013104 | Ga0157370_10015729 | Ga0157370_100157299 | 178 |
| 274 | 3300013104 | Ga0157370_10018879 | Ga0157370_100188797 | 178 |
| 275 | 3300013104 | Ga0157370_10023637 | Ga0157370_100236374 | 178 |
| 276 | 3300013104 | Ga0157370_10088985 | Ga0157370_100889852 | 178 |
| 277 | 3300013104 | Ga0157370_10318992 | Ga0157370_103189922 | 178 |
| 278 | 3300013104 | Ga0157370_10370878 | Ga0157370_103708783 | 178 |
| 279 | 3300013104 | Ga0157370_10752734 | Ga0157370_107527341 | 178 |
| 280 | 3300013104 | Ga0157370_11256871 | Ga0157370_112568711 | 178 |
| 281 | 3300013105 | Ga0157369_10000137 | Ga0157369_1000013733 | 178 |
| 282 | 3300013105 | Ga0157369_10002106 | Ga0157369_1000210627 | 178 |
| 283 | 3300013105 | Ga0157369_10036957 | Ga0157369_100369576 | 178 |
| 284 | 3300013105 | Ga0157369_10039374 | Ga0157369_100393743 | 178 |
| 285 | 3300013105 | Ga0157369_10065692 | Ga0157369_100656924 | 178 |
| 286 | 3300013105 | Ga0157369_10091987 | Ga0157369_100919872 | 178 |
| 287 | 3300013296 | Ga0157374_10001339 | Ga0157374_100013393 | 178 |
| 288 | 3300013297 | Ga0157378_10006347 | Ga0157378_100063478 | 178 |
| 289 | 3300013297 | Ga0157378_10129939 | Ga0157378_101299393 | 178 |
| 290 | 3300013306 | Ga0163162_10104187 | Ga0163162_101041874 | 178 |
| 291 | 3300013306 | Ga0163162_10239930 | Ga0163162_102399304 | 178 |
| 292 | 3300013306 | Ga0163162_11593364 | Ga0163162_115933642 | 178 |
| 293 | 3300013307 | Ga0157372_10165332 | Ga0157372_101653323 | 178 |
| 294 | 3300013307 | Ga0157372_10284898 | Ga0157372_102848982 | 178 |
| 295 | 3300013307 | Ga0157372_10285671 | Ga0157372_102856713 | 178 |
| 296 | 3300013307 | Ga0157372_10377676 | Ga0157372_103776762 | 178 |
| 297 | 3300013307 | Ga0157372_12075827 | Ga0157372_120758271 | 178 |
| 298 | 3300013307 | Ga0157372_12538658 | Ga0157372_125386581 | 178 |
| 299 | 3300013308 | Ga0157375_10155699 | Ga0157375_101556993 | 178 |
| 300 | 3300013308 | Ga0157375_10205780 | Ga0157375_102057803 | 178 |
| 301 | 3300013308 | Ga0157375_10250098 | Ga0157375_102500982 | 178 |
| 302 | 3300013308 | Ga0157375_11338914 | Ga0157375_113389142 | 178 |
| 303 | 3300014325 | Ga0163163_10015746 | Ga0163163_100157466 | 178 |
| 304 | 3300014325 | Ga0163163_10669989 | Ga0163163_106699892 | 178 |
| 305 | 3300014745 | Ga0157377_11245424 | Ga0157377_112454241 | 178 |
| 306 | 3300014968 | Ga0157379_10020058 | Ga0157379_100200582 | 178 |
| 307 | 3300014969 | Ga0157376_10089097 | Ga0157376_100890972 | 178 |
| 308 | 3300015684 | Ga0183365_10008 | Ga0183365_1000859 | 178 |
| 309 | 3300017792 | Ga0163161_10143576 | Ga0163161_101435764 | 178 |
| 310 | 3300017792 | Ga0163161_10347628 | Ga0163161_103476282 | 178 |
| 311 | 3300017792 | Ga0163161_10790265 | Ga0163161_107902652 | 178 |
| 312 | 3300020081 | Ga0206354_10753768 | Ga0206354_107537682 | 178 |
| 313 | 3300020081 | Ga0206354_11008188 | Ga0206354_110081882 | 178 |
| 314 | 3300020082 | Ga0206353_10094556 | Ga0206353_100945565 | 178 |
| 315 | 3300020082 | Ga0206353_10123983 | Ga0206353_101239833 | 178 |
| 316 | 3300020082 | Ga0206353_11094556 | Ga0206353_110945562 | 178 |
| 317 | 3300025315 | Ga0207697_10019218 | Ga0207697_100192183 | 178 |
| 318 | 3300025321 | Ga0207656_10224857 | Ga0207656_102248572 | 178 |
| 319 | 3300025903 | Ga0207680_10000414 | Ga0207680_1000041411 | 178 |
| 320 | 3300025903 | Ga0207680_10001382 | Ga0207680_100013826 | 178 |
| 321 | 3300025903 | Ga0207680_10003973 | Ga0207680_100039738 | 178 |
| 322 | 3300025903 | Ga0207680_10025601 | Ga0207680_100256014 | 178 |
| 323 | 3300025903 | Ga0207680_10225350 | Ga0207680_102253502 | 178 |
| 324 | 3300025903 | Ga0207680_10434638 | Ga0207680_104346382 | 178 |
| 325 | 3300025904 | Ga0207647_10026260 | Ga0207647_100262603 | 178 |
| 326 | 3300025904 | Ga0207647_10029155 | Ga0207647_100291556 | 178 |
| 327 | 3300025904 | Ga0207647_10030910 | Ga0207647_100309104 | 178 |
| 328 | 3300025904 | Ga0207647_10090103 | Ga0207647_100901033 | 178 |
| 329 | 3300025904 | Ga0207647_10149082 | Ga0207647_101490822 | 178 |
| 330 | 3300025904 | Ga0207647_10250402 | Ga0207647_102504022 | 178 |
| 331 | 3300025907 | Ga0207645_10030642 | Ga0207645_100306425 | 178 |
| 332 | 3300025909 | Ga0207705_10000569 | Ga0207705_1000056930 | 178 |
| 333 | 3300025909 | Ga0207705_10001953 | Ga0207705_100019538 | 178 |
| 334 | 3300025909 | Ga0207705_10004281 | Ga0207705_1000428110 | 178 |
| 335 | 3300025909 | Ga0207705_10009606 | Ga0207705_100096063 | 178 |
| 336 | 3300025909 | Ga0207705_10034262 | Ga0207705_100342623 | 178 |
| 337 | 3300025909 | Ga0207705_10129447 | Ga0207705_101294473 | 178 |
| 338 | 3300025909 | Ga0207705_10190726 | Ga0207705_101907262 | 178 |
| 339 | 3300025909 | Ga0207705_10231948 | Ga0207705_102319482 | 178 |
| 340 | 3300025909 | Ga0207705_10252505 | Ga0207705_102525053 | 178 |
| 341 | 3300025909 | Ga0207705_10352704 | Ga0207705_103527042 | 178 |
| 342 | 3300025909 | Ga0207705_10404833 | Ga0207705_104048332 | 178 |
| 343 | 3300025913 | Ga0207695_10057126 | Ga0207695_100571264 | 178 |
| 344 | 3300025913 | Ga0207695_10332570 | Ga0207695_103325702 | 178 |
| 345 | 3300025913 | Ga0207695_10407687 | Ga0207695_104076872 | 178 |
| 346 | 3300025913 | Ga0207695_10663617 | Ga0207695_106636172 | 178 |
| 347 | 3300025914 | Ga0207671_10222140 | Ga0207671_102221403 | 178 |
| 348 | 3300025917 | Ga0207660_10012190 | Ga0207660_100121906 | 178 |
| 349 | 3300025919 | Ga0207657_10000284 | Ga0207657_1000028448 | 178 |
| 350 | 3300025919 | Ga0207657_10000675 | Ga0207657_1000067525 | 178 |
| 351 | 3300025919 | Ga0207657_10008334 | Ga0207657_100083347 | 178 |
| 352 | 3300025919 | Ga0207657_10009137 | Ga0207657_100091375 | 178 |
| 353 | 3300025919 | Ga0207657_10021076 | Ga0207657_100210764 | 178 |
| 354 | 3300025919 | Ga0207657_10036695 | Ga0207657_100366955 | 178 |
| 355 | 3300025919 | Ga0207657_10052475 | Ga0207657_100524753 | 178 |
| 356 | 3300025919 | Ga0207657_10089674 | Ga0207657_100896743 | 178 |
| 357 | 3300025919 | Ga0207657_10170312 | Ga0207657_101703123 | 178 |
| 358 | 3300025919 | Ga0207657_10691925 | Ga0207657_106919252 | 178 |
| 359 | 3300025920 | Ga0207649_10000557 | Ga0207649_100005575 | 178 |
| 360 | 3300025920 | Ga0207649_10032676 | Ga0207649_100326764 | 178 |
| 361 | 3300025920 | Ga0207649_10045078 | Ga0207649_100450784 | 178 |
| 362 | 3300025920 | Ga0207649_10185967 | Ga0207649_101859672 | 178 |
| 363 | 3300025920 | Ga0207649_10667738 | Ga0207649_106677381 | 178 |
| 364 | 3300025920 | Ga0207649_11055863 | Ga0207649_110558631 | 178 |
| 365 | 3300025921 | Ga0207652_10001035 | Ga0207652_100010357 | 178 |
| 366 | 3300025923 | Ga0207681_10004130 | Ga0207681_100041305 | 178 |
| 367 | 3300025924 | Ga0207694_10018805 | Ga0207694_100188057 | 178 |
| 368 | 3300025924 | Ga0207694_10020530 | Ga0207694_100205305 | 178 |
| 369 | 3300025925 | Ga0207650_10078405 | Ga0207650_100784053 | 178 |
| 370 | 3300025925 | Ga0207650_10287878 | Ga0207650_102878783 | 178 |
| 371 | 3300025926 | Ga0207659_10436108 | Ga0207659_104361082 | 178 |
| 372 | 3300025926 | Ga0207659_11067294 | Ga0207659_110672942 | 178 |
| 373 | 3300025927 | Ga0207687_10066102 | Ga0207687_100661023 | 178 |
| 374 | 3300025929 | Ga0207664_10020477 | Ga0207664_100204774 | 178 |
| 375 | 3300025929 | Ga0207664_10079710 | Ga0207664_100797103 | 178 |
| 376 | 3300025929 | Ga0207664_10082899 | Ga0207664_100828993 | 178 |
| 377 | 3300025929 | Ga0207664_10112666 | Ga0207664_101126663 | 178 |
| 378 | 3300025931 | Ga0207644_10000256 | Ga0207644_100002563 | 178 |
| 379 | 3300025931 | Ga0207644_10014676 | Ga0207644_100146766 | 178 |
| 380 | 3300025932 | Ga0207690_10022165 | Ga0207690_100221653 | 178 |
| 381 | 3300025932 | Ga0207690_10023874 | Ga0207690_100238744 | 178 |
| 382 | 3300025932 | Ga0207690_10091252 | Ga0207690_100912521 | 178 |
| 383 | 3300025932 | Ga0207690_10247788 | Ga0207690_102477882 | 178 |
| 384 | 3300025932 | Ga0207690_10251849 | Ga0207690_102518492 | 178 |
| 385 | 3300025932 | Ga0207690_10324942 | Ga0207690_103249422 | 178 |
| 386 | 3300025933 | Ga0207706_10003671 | Ga0207706_1000367116 | 178 |
| 387 | 3300025933 | Ga0207706_10006585 | Ga0207706_100065859 | 178 |
| 388 | 3300025933 | Ga0207706_10010427 | Ga0207706_100104276 | 178 |
| 389 | 3300025933 | Ga0207706_10052626 | Ga0207706_100526263 | 178 |
| 390 | 3300025933 | Ga0207706_10059300 | Ga0207706_100593005 | 178 |
| 391 | 3300025933 | Ga0207706_10095362 | Ga0207706_100953624 | 178 |
| 392 | 3300025933 | Ga0207706_10135484 | Ga0207706_101354843 | 178 |
| 393 | 3300025937 | Ga0207669_10012758 | Ga0207669_100127582 | 178 |
| 394 | 3300025937 | Ga0207669_10014624 | Ga0207669_100146247 | 178 |
| 395 | 3300025937 | Ga0207669_10020519 | Ga0207669_100205192 | 178 |
| 396 | 3300025937 | Ga0207669_10106458 | Ga0207669_101064581 | 178 |
| 397 | 3300025937 | Ga0207669_11215986 | Ga0207669_112159861 | 178 |
| 398 | 3300025938 | Ga0207704_10010644 | Ga0207704_100106442 | 178 |
| 399 | 3300025938 | Ga0207704_10105059 | Ga0207704_101050592 | 178 |
| 400 | 3300025940 | Ga0207691_10008045 | Ga0207691_1000804512 | 178 |
| 401 | 3300025940 | Ga0207691_10083093 | Ga0207691_100830934 | 178 |
| 402 | 3300025940 | Ga0207691_10090488 | Ga0207691_100904883 | 178 |
| 403 | 3300025940 | Ga0207691_10099955 | Ga0207691_100999555 | 178 |
| 404 | 3300025940 | Ga0207691_10453936 | Ga0207691_104539362 | 178 |
| 405 | 3300025941 | Ga0207711_10000190 | Ga0207711_1000019072 | 178 |
| 406 | 3300025941 | Ga0207711_10105909 | Ga0207711_101059094 | 178 |
| 407 | 3300025944 | Ga0207661_10045438 | Ga0207661_100454386 | 178 |
| 408 | 3300025945 | Ga0207679_10064198 | Ga0207679_100641984 | 178 |
| 409 | 3300025945 | Ga0207679_10183901 | Ga0207679_101839013 | 178 |
| 410 | 3300025945 | Ga0207679_10190858 | Ga0207679_101908583 | 178 |
| 411 | 3300025945 | Ga0207679_10260649 | Ga0207679_102606492 | 178 |
| 412 | 3300025945 | Ga0207679_10517562 | Ga0207679_105175622 | 178 |
| 413 | 3300025949 | Ga0207667_10007154 | Ga0207667_100071546 | 178 |
| 414 | 3300025949 | Ga0207667_10010782 | Ga0207667_100107824 | 178 |
| 415 | 3300025949 | Ga0207667_10074317 | Ga0207667_100743173 | 178 |
| 416 | 3300025949 | Ga0207667_10427171 | Ga0207667_104271711 | 178 |
| 417 | 3300025949 | Ga0207667_10541057 | Ga0207667_105410572 | 178 |
| 418 | 3300025960 | Ga0207651_10001768 | Ga0207651_100017688 | 178 |
| 419 | 3300025960 | Ga0207651_10036455 | Ga0207651_100364554 | 178 |
| 420 | 3300025960 | Ga0207651_10132358 | Ga0207651_101323583 | 178 |
| 421 | 3300025960 | Ga0207651_10133968 | Ga0207651_101339684 | 178 |
| 422 | 3300025960 | Ga0207651_10650291 | Ga0207651_106502912 | 178 |
| 423 | 3300025972 | Ga0207668_10000373 | Ga0207668_100003735 | 178 |
| 424 | 3300025981 | Ga0207640_10019668 | Ga0207640_100196684 | 178 |
| 425 | 3300025981 | Ga0207640_10184268 | Ga0207640_101842683 | 178 |
| 426 | 3300025981 | Ga0207640_10254002 | Ga0207640_102540023 | 178 |
| 427 | 3300025981 | Ga0207640_10257768 | Ga0207640_102577681 | 178 |
| 428 | 3300025981 | Ga0207640_10295782 | Ga0207640_102957822 | 178 |
| 429 | 3300025981 | Ga0207640_10424317 | Ga0207640_104243172 | 178 |
| 430 | 3300025986 | Ga0207658_10000087 | Ga0207658_1000008722 | 178 |
| 431 | 3300025986 | Ga0207658_10002604 | Ga0207658_100026044 | 178 |
| 432 | 3300025986 | Ga0207658_10237211 | Ga0207658_102372112 | 178 |
| 433 | 3300025986 | Ga0207658_10315052 | Ga0207658_103150522 | 178 |
| 434 | 3300026023 | Ga0207677_10005685 | Ga0207677_100056854 | 178 |
| 435 | 3300026023 | Ga0207677_10006502 | Ga0207677_100065028 | 178 |
| 436 | 3300026023 | Ga0207677_10054390 | Ga0207677_100543902 | 178 |
| 437 | 3300026035 | Ga0207703_10000461 | Ga0207703_1000046141 | 178 |
| 438 | 3300026035 | Ga0207703_10026919 | Ga0207703_100269194 | 178 |
| 439 | 3300026041 | Ga0207639_10000089 | Ga0207639_1000008953 | 178 |
| 440 | 3300026041 | Ga0207639_10072226 | Ga0207639_100722263 | 178 |
| 441 | 3300026041 | Ga0207639_10161790 | Ga0207639_101617904 | 178 |
| 442 | 3300026041 | Ga0207639_10225255 | Ga0207639_102252552 | 178 |
| 443 | 3300026067 | Ga0207678_10000325 | Ga0207678_1000032533 | 178 |
| 444 | 3300026067 | Ga0207678_10004910 | Ga0207678_100049106 | 178 |
| 445 | 3300026067 | Ga0207678_10018428 | Ga0207678_100184283 | 178 |
| 446 | 3300026067 | Ga0207678_10042735 | Ga0207678_100427355 | 178 |
| 447 | 3300026067 | Ga0207678_10523236 | Ga0207678_105232362 | 178 |
| 448 | 3300026078 | Ga0207702_10015224 | Ga0207702_100152247 | 178 |
| 449 | 3300026078 | Ga0207702_10022337 | Ga0207702_100223377 | 178 |
| 450 | 3300026078 | Ga0207702_10032441 | Ga0207702_100324412 | 178 |
| 451 | 3300026078 | Ga0207702_10068689 | Ga0207702_100686894 | 178 |
| 452 | 3300026078 | Ga0207702_10070541 | Ga0207702_100705416 | 178 |
| 453 | 3300026078 | Ga0207702_10312565 | Ga0207702_103125652 | 178 |
| 454 | 3300026078 | Ga0207702_10383385 | Ga0207702_103833851 | 178 |
| 455 | 3300026078 | Ga0207702_10456706 | Ga0207702_104567062 | 178 |
| 456 | 3300026078 | Ga0207702_10553182 | Ga0207702_105531822 | 178 |
| 457 | 3300026078 | Ga0207702_10823353 | Ga0207702_108233532 | 178 |
| 458 | 3300026088 | Ga0207641_10000110 | Ga0207641_1000011022 | 178 |
| 459 | 3300026088 | Ga0207641_10050188 | Ga0207641_100501882 | 178 |
| 460 | 3300026089 | Ga0207648_10008490 | Ga0207648_1000849011 | 178 |
| 461 | 3300026095 | Ga0207676_10250357 | Ga0207676_102503571 | 178 |
| 462 | 3300026116 | Ga0207674_10000271 | Ga0207674_100002715 | 178 |
| 463 | 3300026116 | Ga0207674_10004818 | Ga0207674_1000481813 | 178 |
| 464 | 3300026116 | Ga0207674_10025787 | Ga0207674_100257873 | 178 |
| 465 | 3300026116 | Ga0207674_10034276 | Ga0207674_100342766 | 178 |
| 466 | 3300026116 | Ga0207674_10101061 | Ga0207674_101010614 | 178 |
| 467 | 3300026118 | Ga0207675_100487239 | Ga0207675_1004872391 | 178 |
| 468 | 3300026121 | Ga0207683_10000721 | Ga0207683_1000072115 | 178 |
| 469 | 3300026121 | Ga0207683_10001875 | Ga0207683_100018755 | 178 |
| 470 | 3300026121 | Ga0207683_11307136 | Ga0207683_113071362 | 178 |
| 471 | 3300026142 | Ga0207698_10007075 | Ga0207698_100070754 | 178 |
| 472 | 3300026142 | Ga0207698_10080557 | Ga0207698_100805574 | 178 |
| 473 | 3300026142 | Ga0207698_10109516 | Ga0207698_101095163 | 178 |
| 474 | 3300026142 | Ga0207698_10431231 | Ga0207698_104312313 | 178 |
| 475 | 3300028379 | Ga0268266_10044210 | Ga0268266_100442104 | 178 |
| 476 | 3300028379 | Ga0268266_10172656 | Ga0268266_101726564 | 178 |
| 477 | 3300028380 | Ga0268265_10040794 | Ga0268265_100407942 | 178 |
| 478 | 3300028381 | Ga0268264_10017033 | Ga0268264_100170333 | 178 |
| 479 | 3300031548 | Ga0307408_100213436 | Ga0307408_1002134363 | 178 |
| 480 | 3300031548 | Ga0307408_100566687 | Ga0307408_1005666872 | 178 |
| 481 | 3300031548 | Ga0307408_100729657 | Ga0307408_1007296572 | 178 |
| 482 | 3300031731 | Ga0307405_10243942 | Ga0307405_102439421 | 178 |
| 483 | 3300031731 | Ga0307405_11161715 | Ga0307405_111617151 | 178 |
| 484 | 3300031824 | Ga0307413_10035806 | Ga0307413_100358064 | 178 |
| 485 | 3300031824 | Ga0307413_10189860 | Ga0307413_101898602 | 178 |
| 486 | 3300031824 | Ga0307413_10228074 | Ga0307413_102280742 | 178 |
| 487 | 3300031852 | Ga0307410_10024280 | Ga0307410_100242804 | 178 |
| 488 | 3300031852 | Ga0307410_10026955 | Ga0307410_100269552 | 178 |
| 489 | 3300031852 | Ga0307410_10164561 | Ga0307410_101645611 | 178 |
| 490 | 3300031852 | Ga0307410_10615464 | Ga0307410_106154642 | 178 |
| 491 | 3300031903 | Ga0307407_10008712 | Ga0307407_100087125 | 178 |
| 492 | 3300031903 | Ga0307407_10743834 | Ga0307407_107438342 | 178 |
| 493 | 3300031911 | Ga0307412_10160530 | Ga0307412_101605303 | 178 |
| 494 | 3300031911 | Ga0307412_10228457 | Ga0307412_102284572 | 178 |
| 495 | 3300031995 | Ga0307409_100038091 | Ga0307409_1000380914 | 178 |
| 496 | 3300031995 | Ga0307409_100216086 | Ga0307409_1002160862 | 178 |
| 497 | 3300031995 | Ga0307409_100339536 | Ga0307409_1003395361 | 178 |
| 498 | 3300031995 | Ga0307409_100806281 | Ga0307409_1008062811 | 178 |
| 499 | 3300032002 | Ga0307416_100008755 | Ga0307416_1000087559 | 178 |
| 500 | 3300032002 | Ga0307416_100124409 | Ga0307416_1001244094 | 178 |
| 501 | 3300032002 | Ga0307416_101319254 | Ga0307416_1013192542 | 178 |
| 502 | 3300032002 | Ga0307416_102717469 | Ga0307416_1027174691 | 178 |
| 503 | 3300032004 | Ga0307414_10061944 | Ga0307414_100619446 | 178 |
| 504 | 3300032004 | Ga0307414_10066601 | Ga0307414_100666012 | 178 |
| 505 | 3300032005 | Ga0307411_10085846 | Ga0307411_100858464 | 178 |
| 506 | 3300032005 | Ga0307411_10124749 | Ga0307411_101247493 | 178 |
| 507 | 3300032005 | Ga0307411_10749717 | Ga0307411_107497172 | 178 |
| 508 | 3300032126 | Ga0307415_100001996 | Ga0307415_1000019968 | 178 |
| 509 | 3300032126 | Ga0307415_100286122 | Ga0307415_1002861222 | 178 |
| 510 | 3300035088 | Ga0373940_0105209 | Ga0373940_0105209_296_835 | 178 |
| 511 | 3300035121 | Ga0373960_0105963 | Ga0373960_0105963_197_736 | 178 |
| 512 | 3300035170 | Ga0373943_0027220 | Ga0373943_0027220_1779_2315 | 178 |
| 513 | 3300035170 | Ga0373943_0088509 | Ga0373943_0088509_536_1075 | 178 |
| 514 | 3300035171 | Ga0373946_0072105 | Ga0373946_0072105_258_794 | 178 |
| 515 | 3300035691 | Ga0373931_0024649 | Ga0373931_0024649_64_603 | 178 |
| 516 | 3300035692 | Ga0373935_0025894 | Ga0373935_0025894_1687_2226 | 178 |
| 517 | 3300035692 | Ga0373935_0864009 | Ga0373935_0864009_55_594 | 178 |
| 518 | 3300035695 | Ga0373927_0073121 | Ga0373927_0073121_974_1510 | 178 |
| 519 | 3300036401 | Ga0373937_0706573 | Ga0373937_0706573_208_747 | 178 |
| 520 | 3300037068 | Ga0373925_0156912 | Ga0373925_0156912_1165_1701 | 178 |
| 521 | 3300037312 | Ga0395899_0000162 | Ga0395899_0000162_57252_57788 | 178 |
| 522 | 3300037312 | Ga0395899_0003851 | Ga0395899_0003851_9734_10270 | 178 |
| 523 | 3300037312 | Ga0395899_0028386 | Ga0395899_0028386_847_1383 | 178 |
| 524 | 3300037312 | Ga0395899_0045105 | Ga0395899_0045105_1182_1718 | 178 |
| 525 | 3300037312 | Ga0395899_0045872 | Ga0395899_0045872_1105_1641 | 178 |
| 526 | 3300037312 | Ga0395899_0054694 | Ga0395899_0054694_2050_2586 | 178 |
| 527 | 3300037312 | Ga0395899_0088836 | Ga0395899_0088836_584_1120 | 178 |
| 528 | 3300037312 | Ga0395899_0110059 | Ga0395899_0110059_1009_1575 | 178 |
| 529 | 3300037312 | Ga0395899_0162586 | Ga0395899_0162586_978_1526 | 178 |
| 530 | 3300037312 | Ga0395899_0174444 | Ga0395899_0174444_375_911 | 178 |
| 531 | 3300037312 | Ga0395899_0365590 | Ga0395899_0365590_168_704 | 178 |
| 532 | 3300037312 | Ga0395899_0384809 | Ga0395899_0384809_347_883 | 178 |
| 533 | 3300037312 | Ga0395899_0413942 | Ga0395899_0413942_270_806 | 178 |
| 534 | 3300037312 | Ga0395899_0504765 | Ga0395899_0504765_26_565 | 178 |
| 535 | 3300037418 | Ga0395900_0000129 | Ga0395900_0000129_68518_69054 | 178 |
| 536 | 3300037418 | Ga0395900_0000666 | Ga0395900_0000666_40622_41158 | 178 |
| 537 | 3300037418 | Ga0395900_0001095 | Ga0395900_0001095_1181_1717 | 178 |
| 538 | 3300037418 | Ga0395900_0007391 | Ga0395900_0007391_4550_5086 | 178 |
| 539 | 3300037418 | Ga0395900_0020412 | Ga0395900_0020412_4025_4561 | 178 |
| 540 | 3300037418 | Ga0395900_0022227 | Ga0395900_0022227_2060_2596 | 178 |
| 541 | 3300037418 | Ga0395900_0036019 | Ga0395900_0036019_2581_3117 | 178 |
| 542 | 3300037418 | Ga0395900_0041106 | Ga0395900_0041106_2802_3368 | 178 |
| 543 | 3300037418 | Ga0395900_0070992 | Ga0395900_0070992_2409_2975 | 178 |
| 544 | 3300037418 | Ga0395900_0078633 | Ga0395900_0078633_2182_2718 | 178 |
| 545 | 3300037418 | Ga0395900_0095368 | Ga0395900_0095368_318_854 | 178 |
| 546 | 3300037418 | Ga0395900_0109098 | Ga0395900_0109098_1502_2041 | 178 |
| 547 | 3300037418 | Ga0395900_0367236 | Ga0395900_0367236_198_734 | 178 |
| 548 | 3300037418 | Ga0395900_0452206 | Ga0395900_0452206_368_904 | 178 |
| 549 | 3300037418 | Ga0395900_0543798 | Ga0395900_0543798_410_946 | 178 |
| 550 | 3300037418 | Ga0395900_1003935 | Ga0395900_1003935_148_684 | 178 |
| 551 | 3300037418 | Ga0395900_1005244 | Ga0395900_1005244_194_730 | 178 |
| 552 | 3300037418 | Ga0395900_1140250 | Ga0395900_1140250_74_610 | 178 |
| 553 | 3300037418 | Ga0395900_1147418 | Ga0395900_1147418_132_671 | 178 |
| 554 | 3300037466 | Ga0395898_0001704 | Ga0395898_0001704_3778_4314 | 178 |
| 555 | 3300037466 | Ga0395898_0009787 | Ga0395898_0009787_7977_8513 | 178 |
| 556 | 3300037466 | Ga0395898_0041651 | Ga0395898_0041651_590_1138 | 178 |
| 557 | 3300037466 | Ga0395898_0045291 | Ga0395898_0045291_535_1071 | 178 |
| 558 | 3300037466 | Ga0395898_0055623 | Ga0395898_0055623_1983_2519 | 178 |
| 559 | 3300037466 | Ga0395898_0059310 | Ga0395898_0059310_2314_2880 | 178 |
| 560 | 3300037466 | Ga0395898_0062586 | Ga0395898_0062586_1897_2433 | 178 |
| 561 | 3300037466 | Ga0395898_0073614 | Ga0395898_0073614_36_602 | 178 |
| 562 | 3300037466 | Ga0395898_0083099 | Ga0395898_0083099_2295_2831 | 178 |
| 563 | 3300037466 | Ga0395898_0085965 | Ga0395898_0085965_2060_2596 | 178 |
| 564 | 3300037466 | Ga0395898_0088891 | Ga0395898_0088891_2362_2898 | 178 |
| 565 | 3300037466 | Ga0395898_0176370 | Ga0395898_0176370_113_652 | 178 |
| 566 | 3300037466 | Ga0395898_0712458 | Ga0395898_0712458_47_586 | 178 |
| 567 | 3300037466 | Ga0395898_1311499 | Ga0395898_1311499_94_633 | 178 |
| 568 | 3300037471 | Ga0395905_0001395 | Ga0395905_0001395_5678_6214 | 178 |
| 569 | 3300037471 | Ga0395905_0003061 | Ga0395905_0003061_1181_1717 | 178 |
| 570 | 3300037471 | Ga0395905_0014155 | Ga0395905_0014155_6704_7240 | 178 |
| 571 | 3300037471 | Ga0395905_0019204 | Ga0395905_0019204_395_931 | 178 |
| 572 | 3300037471 | Ga0395905_0055854 | Ga0395905_0055854_2283_2849 | 178 |
| 573 | 3300037471 | Ga0395905_0099581 | Ga0395905_0099581_298_846 | 178 |
| 574 | 3300037471 | Ga0395905_0166526 | Ga0395905_0166526_695_1231 | 178 |
| 575 | 3300037471 | Ga0395905_0170237 | Ga0395905_0170237_1491_2030 | 178 |
| 576 | 3300037471 | Ga0395905_0173511 | Ga0395905_0173511_740_1276 | 178 |
| 577 | 3300037471 | Ga0395905_0176567 | Ga0395905_0176567_801_1337 | 178 |
| 578 | 3300037471 | Ga0395905_0183648 | Ga0395905_0183648_551_1117 | 178 |
| 579 | 3300037471 | Ga0395905_0358615 | Ga0395905_0358615_114_680 | 178 |
| 580 | 3300038443 | Ga0395901_0000111 | Ga0395901_0000111_54743_55279 | 178 |
| 581 | 3300038443 | Ga0395901_0012693 | Ga0395901_0012693_5628_6164 | 178 |
| 582 | 3300038443 | Ga0395901_0015987 | Ga0395901_0015987_2249_2785 | 178 |
| 583 | 3300038443 | Ga0395901_0024546 | Ga0395901_0024546_899_1438 | 178 |
| 584 | 3300038443 | Ga0395901_0035383 | Ga0395901_0035383_3442_3978 | 178 |
| 585 | 3300038443 | Ga0395901_0056099 | Ga0395901_0056099_2150_2686 | 178 |
| 586 | 3300038443 | Ga0395901_0078608 | Ga0395901_0078608_512_1048 | 178 |
| 587 | 3300038443 | Ga0395901_0088862 | Ga0395901_0088862_847_1383 | 178 |
| 588 | 3300038443 | Ga0395901_0127521 | Ga0395901_0127521_188_724 | 178 |
| 589 | 3300038443 | Ga0395901_0155006 | Ga0395901_0155006_1645_2181 | 178 |
| 590 | 3300038443 | Ga0395901_0203939 | Ga0395901_0203939_267_806 | 178 |
| 591 | 3300038443 | Ga0395901_0286757 | Ga0395901_0286757_290_826 | 178 |
| 592 | 3300038443 | Ga0395901_0400112 | Ga0395901_0400112_184_720 | 178 |
| 593 | 3300039450 | Ga0436363_0451272 | Ga0436363_0451272_347_883 | 178 |
| 594 | 3300041413 | Ga0439465_0023521 | Ga0439465_0023521_277_813 | 178 |
| 595 | 3300041458 | Ga0451798_0398690 | Ga0451798_0398690_191_727 | 178 |
| 596 | 3300041512 | Ga0451853_2987684 | Ga0451853_2987684_124_663 | 178 |
| 597 | 3300042004 | Ga0439445_0003001 | Ga0439445_0003001_2687_3223 | 178 |
| 598 | 3300042157 | Ga0439458_0000647 | Ga0439458_0000647_1862_2398 | 178 |
| 599 | 3300044656 | Ga0466969_0008689 | Ga0466969_0008689_3595_4131 | 178 |
| 600 | 3300044658 | Ga0466972_0023375 | Ga0466972_0023375_503_1039 | 178 |
| 601 | 3300044658 | Ga0466972_0027190 | Ga0466972_0027190_1460_1999 | 178 |
| 602 | 3300044683 | Ga0466965_0125612 | Ga0466965_0125612_483_1019 | 178 |
| 603 | 3300044684 | Ga0466966_0000026 | Ga0466966_0000026_68273_68821 | 178 |
| 604 | 3300044684 | Ga0466966_0018412 | Ga0466966_0018412_2109_2651 | 178 |
| 605 | 3300044684 | Ga0466966_0020740 | Ga0466966_0020740_2710_3246 | 178 |
| 606 | 3300044684 | Ga0466966_0073956 | Ga0466966_0073956_1482_2018 | 178 |
| 607 | 3300044684 | Ga0466966_0077307 | Ga0466966_0077307_676_1212 | 178 |
| 608 | 3300044684 | Ga0466966_0092257 | Ga0466966_0092257_1332_1868 | 178 |
| 609 | 3300044693 | Ga0466961_0111094 | Ga0466961_0111094_140_676 | 178 |
| 610 | 3300044693 | Ga0466961_0140180 | Ga0466961_0140180_421_963 | 178 |
| 611 | 3300044693 | Ga0466961_0153201 | Ga0466961_0153201_612_1148 | 178 |
| 612 | 3300044693 | Ga0466961_0173969 | Ga0466961_0173969_582_1118 | 178 |
| 613 | 3300044694 | Ga0466963_0023556 | Ga0466963_0023556_2880_3428 | 178 |
| 614 | 3300044694 | Ga0466963_0101549 | Ga0466963_0101549_983_1519 | 178 |
| 615 | 3300044719 | Ga0466971_0057327 | Ga0466971_0057327_132_668 | 178 |
| 616 | 3300044735 | Ga0466968_0013379 | Ga0466968_0013379_1546_2082 | 178 |
| 617 | 3300044765 | Ga0466970_0036825 | Ga0466970_0036825_912_1448 | 178 |
| 618 | 3300044765 | Ga0466970_0089168 | Ga0466970_0089168_577_1113 | 178 |
| 619 | 3300044765 | Ga0466970_0142602 | Ga0466970_0142602_688_1230 | 178 |
| 620 | 3300044765 | Ga0466970_0390442 | Ga0466970_0390442_233_772 | 178 |
| 621 | 3300044765 | Ga0466970_0443736 | Ga0466970_0443736_134_670 | 178 |
| 622 | 3300044842 | Ga0466957_0048990 | Ga0466957_0048990_559_1095 | 178 |
| 623 | 3300044842 | Ga0466957_0132580 | Ga0466957_0132580_918_1454 | 178 |
| 624 | 3300044901 | Ga0466960_0176726 | Ga0466960_0176726_338_877 | 178 |
| 625 | 3300045049 | Ga0466959_0056375 | Ga0466959_0056375_1933_2469 | 178 |
| 626 | 3300045049 | Ga0466959_0060828 | Ga0466959_0060828_1018_1554 | 178 |
| 627 | 3300045049 | Ga0466959_0112786 | Ga0466959_0112786_604_1140 | 178 |
| 628 | 3300045049 | Ga0466959_0185950 | Ga0466959_0185950_789_1325 | 178 |
| 629 | 3300045836 | Ga0466958_0029167 | Ga0466958_0029167_1349_1885 | 178 |
| 630 | 3300045836 | Ga0466958_0037711 | Ga0466958_0037711_1168_1704 | 178 |
| 631 | 3300045836 | Ga0466958_0088413 | Ga0466958_0088413_580_1116 | 178 |
| 632 | 3300045976 | Ga0466967_0040164 | Ga0466967_0040164_647_1189 | 178 |
| 633 | 3300045976 | Ga0466967_0071169 | Ga0466967_0071169_1636_2172 | 178 |
| 634 | 3300045976 | Ga0466967_0129433 | Ga0466967_0129433_170_712 | 178 |
| 635 | 3300045976 | Ga0466967_0145350 | Ga0466967_0145350_1223_1759 | 178 |
| 636 | 3300045976 | Ga0466967_0240234 | Ga0466967_0240234_106_654 | 178 |
| 637 | 3300046525 | Ga0495663_0007104 | Ga0495663_0007104_1907_2446 | 178 |
| 638 | 3300046525 | Ga0495663_0037337 | Ga0495663_0037337_646_1185 | 178 |
| 639 | 3300046528 | Ga0495642_0010946 | Ga0495642_0010946_2601_3140 | 178 |
| 640 | 3300046528 | Ga0495642_0156517 | Ga0495642_0156517_224_763 | 178 |
| 641 | 3300046537 | Ga0495598_0000126 | Ga0495598_0000126_4668_5207 | 178 |
| 642 | 3300046539 | Ga0495621_0000046 | Ga0495621_0000046_884_1423 | 178 |
| 643 | 3300046684 | Ga0495669_0000394 | Ga0495669_0000394_16140_16679 | 178 |
| 644 | 3300046684 | Ga0495669_0093934 | Ga0495669_0093934_577_1116 | 178 |
| 645 | 3300046691 | Ga0495670_0043527 | Ga0495670_0043527_989_1528 | 178 |
| 646 | 3300047445 | Ga0495677_0007021 | Ga0495677_0007021_557_1096 | 178 |
| 647 | 3300048903 | Ga0496100_0001483 | Ga0496100_0001483_1680_2219 | 178 |
| 648 | 3300048905 | Ga0496102_0414065 | Ga0496102_0414065_227_766 | 178 |
| 649 | 3300048907 | Ga0496104_0126715 | Ga0496104_0126715_200_739 | 178 |
| 650 | 3300048908 | Ga0496105_0457882 | Ga0496105_0457882_216_755 | 178 |
| 651 | 3300048910 | Ga0496107_0035183 | Ga0496107_0035183_2583_3122 | 178 |
| 652 | 3300048911 | Ga0496108_0006078 | Ga0496108_0006078_495_1034 | 178 |
| 653 | 3300048912 | Ga0496109_0951873 | Ga0496109_0951873_86_625 | 178 |
| 654 | 3300048913 | Ga0496110_0002522 | Ga0496110_0002522_11790_12329 | 178 |
| 655 | 3300048914 | Ga0496111_0025728 | Ga0496111_0025728_972_1511 | 178 |
| 656 | 3300048914 | Ga0496111_0356084 | Ga0496111_0356084_135_701 | 178 |
| 657 | 3300048915 | Ga0496112_0027081 | Ga0496112_0027081_108_647 | 178 |
| 658 | 3300048915 | Ga0496112_0179822 | Ga0496112_0179822_317_856 | 178 |
| 659 | 3300048917 | Ga0496114_0000016 | Ga0496114_0000016_112723_113262 | 178 |
| 660 | 3300049568 | Ga0501031_0686881 | Ga0501031_0686881_56_592 | 178 |
| 661 | 3300049570 | Ga0501033_0063644 | Ga0501033_0063644_1228_1764 | 178 |
| 662 | 3300049581 | Ga0501047_0995895 | Ga0501047_0995895_18_554 | 178 |
| 663 | 3300049742 | Ga0501080_0253872 | Ga0501080_0253872_977_1513 | 178 |
| 664 | 3300049822 | Ga0501035_0002613 | Ga0501035_0002613_10316_10852 | 178 |
| 665 | 3300053122 | Ga0500608_000251 | Ga0500608_000251_15790_16326 | 178 |
| 666 | 3300053123 | Ga0500614_069827 | Ga0500614_069827_403_939 | 178 |
| 667 | 3300061719 | Ga0466962_0043867 | Ga0466962_0043867_937_1473 | 178 |
| 668 | 3300061719 | Ga0466962_0328353 | Ga0466962_0328353_36_572 | 178 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1mkz-assembly1.cif.gz_A | crystal structure of moab protein at 1.6 a resolution. | 0.9712 | 3 | 170 |
| 1r2k-assembly1.cif.gz_B | crystal structure of moab from escherichia coli | 0.9681 | 3 | 165 |
| 1y5e-assembly1.cif.gz_C | crystal structure of molybdenum cofactor biosynthesis protein b | 0.9622 | 11 | 157 |
| 3iwt-assembly1.cif.gz_A | structure of hypothetical molybdenum cofactor biosynthesis protein b from sulfolobus tokodaii | 0.9556 | 11 | 157 |
| 1mkz-assembly1.cif.gz_A | crystal structure of moab protein at 1.6 a resolution. | 0.9431 | 3 | 170 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1r2kA00 | Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain | 0.9696 | 3 | 170 | 3.40.980.10 |
| 2pjkA00 | Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain | 0.9553 | 11 | 157 | 3.40.980.10 |
| 1r2kA00 | Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain | 0.9524 | 3 | 170 | 3.40.980.10 |
| 1y5eB00 | Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain | 0.9494 | 11 | 154 | 3.40.980.10 |
| af_P39205_1_179_3.40.980.10 | Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain | 0.9345 | 12 | 155 | 3.40.980.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A059G262-F1-model_v4 | Molybdenum cofactor biosynthesis protein B | 0.9963 | 1 | 178 |
GO:0005829
GO:0006777 |
| AF-A0A0F2QJ17-F1-model_v4 | Molybdenum cofactor biosynthesis protein B | 0.9961 | 1 | 178 |
GO:0005829
GO:0006777 |
| AF-A0A1D2TUU4-F1-model_v4 | Molybdenum cofactor biosynthesis protein B | 0.996 | 1 | 178 |
GO:0005829
GO:0006777 |
| AF-A0A521PIW7-F1-model_v4 | Molybdenum cofactor biosynthesis protein B | 0.9945 | 1 | 178 |
GO:0005829
GO:0006777 |
| AF-A0A3S9VBC5-F1-model_v4 | Molybdenum cofactor biosynthesis protein B | 0.9927 | 1 | 178 |
GO:0005829
GO:0006777 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar