F473921

General Info

Members Datasets Scaffolds Average Seq Length
668 278 1336 380

Family's Representative Sequence

Representative Sequence 3300009177|Ga0105248_10413668|Ga0105248_104136682
Length 412
Sequence MRMNPPLSDPVRHAWNGRGGRSRINSVDLRDTPDEEQFRSELKAWLDANLPDELKGHRGGAARFSDSAIRNWSGTLYDAGYIGLTWPKEYGGGGKPYSYQAIFLEEMARAEAPPHLGVIGLGMAGPTIIACGTEAQKARYLQPLLSAHEIWCQGFSEPGAGSDLSAVRTSARLEDGHFVVDGQKVWSSYAHIADWCILLTRSDPDSERHAGLTYLIVDMRAPGVEVRPLRQITGEAEFNEIFFSGVEVPVENVVGDVGGGWQVAMTTLLHERGTLGFALVAALEVMVGKLIELARDRGATPLQRDAIAQEWMELQGLRYTAYRSLSALMKTGIPGPEGSILKQQWSEAAQRLTKLALELLGPDAQLLGENAPYGGYWQHMQLRSRGNTIEAGTSEILRNIIAERVLGLPRSR

Samples

Sample ID Description Type Environment
1 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
40 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
41 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
108 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
110 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
111 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
112 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
113 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
114 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
115 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
116 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
117 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
118 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
119 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
120 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
121 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
122 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
123 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
124 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
125 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
126 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
127 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
128 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
129 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
130 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
131 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
132 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
133 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
134 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
135 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
136 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
137 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
138 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
139 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
140 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
141 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
142 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
143 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
144 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
145 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
146 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
147 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
148 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
149 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
150 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
151 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
152 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
153 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
154 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
155 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
156 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
157 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
158 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
159 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
160 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
161 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
162 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
163 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
164 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
165 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
166 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
167 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
168 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
169 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
170 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
171 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
172 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
173 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
174 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
175 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
176 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
177 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
178 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
179 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
180 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
181 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
182 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
183 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
184 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
185 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
186 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
187 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
188 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
189 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
190 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
191 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
192 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
193 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
194 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
195 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
196 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
197 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
198 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
199 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
200 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
201 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
202 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
203 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
204 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
205 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
206 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
207 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
208 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
209 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
210 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
211 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
212 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
213 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
214 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
215 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
216 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
217 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
218 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
219 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
220 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
221 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
222 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
223 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
224 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
225 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
226 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
227 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
228 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
243 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
244 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
245 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
246 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
247 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
248 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
249 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
250 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
251 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
252 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
253 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
254 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
255 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
256 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
257 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
260 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
261 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
262 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
263 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
264 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
265 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
266 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
267 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
268 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
269 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
270 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
271 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
272 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
273 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
274 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
275 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
276 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
277 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
278 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.7
Metatranscriptomes 0.3
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.75
Nodule 0
Rhizoplane 11.08
Rhizosphere 87.72
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105248_10413668 3300009177 Bacteria 1518
2 JGI25407J50210_10013488 3300003373 Bacteria 2101
3 Ga0070658_10042261 3300005327 Bacteria 3681
4 Ga0070658_10154108 3300005327 Bacteria 1925
5 Ga0070670_100180665 3300005331 Bacteria 1832
6 Ga0070680_100021911 3300005336 Bacteria 5081
7 Ga0070680_100065961 3300005336 Bacteria 2967
8 Ga0070680_100079043 3300005336 Bacteria 2711
9 Ga0070682_100049452 3300005337 Bacteria 2621
10 Ga0068868_100039855 3300005338 Bacteria 3653
11 Ga0070660_100000819 3300005339 Bacteria 20620
12 Ga0070660_100010792 3300005339 Bacteria 6466
13 Ga0070660_100017814 3300005339 Bacteria 5181
14 Ga0070660_100056966 3300005339 Bacteria 3025
15 Ga0070660_100127123 3300005339 Bacteria 2037
16 Ga0070689_100014722 3300005340 Bacteria 5689
17 Ga0070661_100049212 3300005344 Bacteria 3085
18 Ga0070661_100075497 3300005344 Bacteria 2483
19 Ga0070661_100119015 3300005344 Bacteria 1977
20 Ga0070692_10029036 3300005345 Bacteria 2755
21 Ga0070668_100042803 3300005347 Bacteria 3471
22 Ga0070675_100072593 3300005354 Bacteria 2857
23 Ga0070675_100083731 3300005354 Bacteria 2663
24 Ga0070674_100095256 3300005356 Bacteria 2158
25 Ga0070673_100187048 3300005364 Bacteria 1776
26 Ga0070714_100134906 3300005435 Bacteria 2209
27 Ga0070714_100198495 3300005435 Bacteria 1834
28 Ga0070714_100235718 3300005435 Bacteria 1687
29 Ga0070701_10007113 3300005438 Bacteria 4754
30 Ga0070711_100141808 3300005439 Bacteria 1803
31 Ga0070694_100099885 3300005444 Bacteria 2051
32 Ga0070708_100057681 3300005445 Bacteria 3458
33 Ga0070708_100109458 3300005445 Bacteria 2538
34 Ga0070663_100020364 3300005455 Bacteria 4391
35 Ga0070662_100018182 3300005457 Bacteria 4750
36 Ga0070662_100061948 3300005457 Bacteria 2732
37 Ga0070681_10000818 3300005458 Bacteria 25982
38 Ga0070681_10002075 3300005458 Bacteria 18192
39 Ga0070681_10017507 3300005458 Bacteria 7163
40 Ga0070681_10040047 3300005458 Bacteria 4698
41 Ga0070685_10040143 3300005466 Bacteria 2662
42 Ga0070706_100001869 3300005467 Bacteria 21738
43 Ga0070706_100003808 3300005467 Bacteria 14735
44 Ga0070706_100004945 3300005467 Bacteria 12758
45 Ga0070706_100005263 3300005467 Bacteria 12345
46 Ga0070706_100093191 3300005467 Bacteria 2795
47 Ga0070706_100209487 3300005467 Bacteria 1820
48 Ga0070707_100029065 3300005468 Bacteria 5262
49 Ga0070707_100073242 3300005468 Bacteria 3302
50 Ga0070707_100129187 3300005468 Bacteria 2456
51 Ga0070698_100001821 3300005471 Bacteria 23719
52 Ga0070698_100003055 3300005471 Bacteria 18451
53 Ga0070698_100008490 3300005471 Bacteria 11095
54 Ga0070698_100011112 3300005471 Bacteria 9567
55 Ga0070698_100013592 3300005471 Bacteria 8618
56 Ga0070698_100195821 3300005471 Bacteria 1958
57 Ga0070699_100080550 3300005518 Bacteria 2838
58 Ga0070699_100236479 3300005518 Bacteria 1629
59 Ga0070699_100415309 3300005518 Bacteria 1218
60 Ga0070679_100028811 3300005530 Bacteria 5477
61 Ga0070679_100110003 3300005530 Bacteria 2742
62 Ga0070697_100059796 3300005536 Bacteria 3104
63 Ga0070697_100101473 3300005536 Bacteria 2391
64 Ga0070672_100009638 3300005543 Bacteria 6666
65 Ga0070672_100033028 3300005543 Bacteria 3914
66 Ga0070693_100030067 3300005547 Bacteria 2967
67 Ga0070665_100075015 3300005548 Bacteria 3388
68 Ga0070704_100022510 3300005549 Bacteria 4102
69 Ga0068855_100056886 3300005563 Bacteria 4586
70 Ga0068855_100088902 3300005563 Bacteria 3567
71 Ga0068855_100192746 3300005563 Bacteria 2298
72 Ga0068852_100059311 3300005616 Bacteria 3318
73 Ga0068860_100051084 3300005843 Bacteria 3934
74 Ga0081455_10003327 3300005937 Bacteria 18552
75 Ga0081455_10006995 3300005937 Bacteria 11986
76 Ga0081455_10021239 3300005937 Bacteria 6093
77 Ga0081455_10022832 3300005937 Bacteria 5834
78 Ga0081455_10059128 3300005937 Bacteria 3238
79 Ga0081455_10131773 3300005937 Bacteria 1954
80 Ga0081455_10146791 3300005937 Bacteria 1824
81 Ga0081455_10157153 3300005937 Bacteria 1746
82 Ga0081538_10000195 3300005981 Bacteria 66942
83 Ga0081538_10037799 3300005981 Bacteria 3124
84 Ga0081538_10070943 3300005981 Bacteria 1920
85 Ga0081539_10000973 3300005985 Bacteria 53526
86 Ga0081539_10008764 3300005985 Bacteria 8681
87 Ga0075365_10013300 3300006038 Bacteria 4915
88 Ga0075365_10190486 3300006038 Bacteria 1435
89 Ga0075364_10057798 3300006051 Bacteria 2541
90 Ga0075432_10002179 3300006058 Bacteria 6517
91 Ga0075432_10039091 3300006058 Bacteria 1654
92 Ga0075428_100002450 3300006844 Bacteria 20164
93 Ga0075428_100191844 3300006844 Bacteria 2210
94 Ga0075430_100129619 3300006846 Bacteria 2102
95 Ga0075431_100079083 3300006847 Bacteria 3395
96 Ga0075433_10048678 3300006852 Bacteria 3687
97 Ga0075433_10149481 3300006852 Bacteria 2077
98 Ga0075434_100128254 3300006871 Bacteria 2554
99 Ga0075429_100076447 3300006880 Bacteria 2916
100 Ga0068865_100045520 3300006881 Bacteria 3008
101 Ga0068865_100065593 3300006881 Bacteria 2559
102 Ga0068865_100125017 3300006881 Bacteria 1918
103 Ga0075436_100048061 3300006914 Bacteria 2944
104 Ga0075436_100049246 3300006914 Bacteria 2907
105 Ga0075435_100096578 3300007076 Bacteria 2444
106 Ga0105244_10065749 3300009036 Bacteria 1816
107 Ga0111539_10036099 3300009094 Bacteria 5979
108 Ga0111539_10062191 3300009094 Bacteria 4420
109 Ga0111539_10067444 3300009094 Bacteria 4225
110 Ga0111539_10229441 3300009094 Bacteria 2162
111 Ga0111539_10247175 3300009094 Bacteria 2077
112 Ga0105245_10024883 3300009098 Bacteria 5262
113 Ga0105245_10030680 3300009098 Bacteria 4754
114 Ga0105247_10040212 3300009101 Bacteria 2857
115 Ga0114129_10408864 3300009147 Bacteria 1787
116 Ga0114129_10501671 3300009147 Bacteria 1585
117 Ga0105243_10051860 3300009148 Bacteria 3246
118 Ga0105243_10092111 3300009148 Bacteria 2498
119 Ga0105242_10034320 3300009176 Bacteria 4066
120 Ga0105242_10060368 3300009176 Bacteria 3115
121 Ga0105248_10080633 3300009177 Bacteria 3658
122 Ga0105248_10120907 3300009177 Bacteria 2954
123 Ga0105248_10248154 3300009177 Bacteria 2004
124 Ga0105237_10064403 3300009545 Bacteria 3662
125 Ga0105238_10028168 3300009551 Bacteria 5723
126 Ga0105249_10145438 3300009553 Bacteria 2277
127 Ga0105239_10042005 3300010375 Bacteria 5009
128 Ga0105239_10140002 3300010375 Bacteria 2696
129 Ga0105239_10221047 3300010375 Bacteria 2124
130 Ga0157371_10128215 3300013102 Bacteria 1804
131 Ga0157371_10186517 3300013102 Bacteria 1484
132 Ga0157370_10006933 3300013104 Bacteria 12382
133 Ga0157369_10001003 3300013105 Bacteria 35669
134 Ga0157374_10047472 3300013296 Bacteria 3982
135 Ga0157374_10116535 3300013296 Bacteria 2574
136 Ga0157374_10162809 3300013296 Bacteria 2173
137 Ga0157372_10031033 3300013307 Bacteria 5849
138 Ga0157372_10091948 3300013307 Bacteria 3451
139 Ga0157372_10141611 3300013307 Bacteria 2771
140 Ga0157372_10258138 3300013307 Bacteria 2023
141 Ga0157375_10010053 3300013308 Bacteria 8319
142 Ga0157375_10033375 3300013308 Bacteria 4890
143 Ga0157375_10040593 3300013308 Bacteria 4487
144 Ga0157375_10045570 3300013308 Bacteria 4269
145 Ga0157375_10297199 3300013308 Bacteria 1778
146 Ga0157380_10019372 3300014326 Bacteria 5070
147 Ga0157377_10160446 3300014745 Bacteria 1398
148 Ga0157379_10169388 3300014968 Bacteria 1971
149 Ga0206356_11828667 3300020070 Bacteria 3635
150 Ga0206353_10130899 3300020082 Bacteria 8536
151 Ga0207653_10055321 3300025885 Bacteria 1328
152 Ga0207643_10012190 3300025908 Bacteria 4648
153 Ga0207705_10133034 3300025909 Bacteria 1852
154 Ga0207684_10000137 3300025910 Bacteria 132561
155 Ga0207684_10000289 3300025910 Bacteria 72104
156 Ga0207684_10004500 3300025910 Bacteria 13106
157 Ga0207684_10019297 3300025910 Bacteria 5832
158 Ga0207707_10010499 3300025912 Bacteria 8038
159 Ga0207707_10012886 3300025912 Bacteria 7277
160 Ga0207707_10032544 3300025912 Bacteria 4564
161 Ga0207707_10093932 3300025912 Bacteria 2620
162 Ga0207695_10216916 3300025913 Bacteria 1822
163 Ga0207693_10027392 3300025915 Bacteria 4506
164 Ga0207663_10069088 3300025916 Bacteria 2271
165 Ga0207660_10012383 3300025917 Bacteria 5580
166 Ga0207660_10023914 3300025917 Bacteria 4131
167 Ga0207660_10076279 3300025917 Bacteria 2451
168 Ga0207657_10001876 3300025919 Bacteria 22733
169 Ga0207657_10010396 3300025919 Bacteria 9289
170 Ga0207657_10030401 3300025919 Bacteria 4902
171 Ga0207657_10030447 3300025919 Bacteria 4898
172 Ga0207657_10056602 3300025919 Bacteria 3382
173 Ga0207657_10085245 3300025919 Bacteria 2646
174 Ga0207657_10192613 3300025919 Bacteria 1644
175 Ga0207652_10024169 3300025921 Bacteria 5040
176 Ga0207652_10031973 3300025921 Bacteria 4420
177 Ga0207652_10041086 3300025921 Bacteria 3930
178 Ga0207652_10100256 3300025921 Bacteria 2557
179 Ga0207652_10106120 3300025921 Bacteria 2486
180 Ga0207646_10000665 3300025922 Bacteria 44568
181 Ga0207646_10003063 3300025922 Bacteria 19239
182 Ga0207646_10048754 3300025922 Bacteria 3795
183 Ga0207694_10097942 3300025924 Bacteria 2321
184 Ga0207687_10034003 3300025927 Bacteria 3460
185 Ga0207664_10032707 3300025929 Bacteria 3989
186 Ga0207664_10120910 3300025929 Bacteria 2191
187 Ga0207690_10138132 3300025932 Bacteria 1792
188 Ga0207706_10004470 3300025933 Bacteria 13131
189 Ga0207706_10068537 3300025933 Bacteria 3121
190 Ga0207686_10079672 3300025934 Bacteria 2133
191 Ga0207686_10121562 3300025934 Bacteria 1778
192 Ga0207709_10155036 3300025935 Bacteria 1591
193 Ga0207704_10019928 3300025938 Bacteria 3536
194 Ga0207691_10010949 3300025940 Bacteria 8705
195 Ga0207691_10047893 3300025940 Bacteria 3920
196 Ga0207691_10149037 3300025940 Bacteria 2058
197 Ga0207661_10010994 3300025944 Bacteria 6539
198 Ga0207661_10029560 3300025944 Bacteria 4210
199 Ga0207661_10137335 3300025944 Bacteria 2101
200 Ga0207661_10187105 3300025944 Bacteria 1813
201 Ga0207661_10246593 3300025944 Bacteria 1586
202 Ga0207679_10024866 3300025945 Bacteria 4111
203 Ga0207679_10162487 3300025945 Bacteria 1830
204 Ga0207667_10271257 3300025949 Bacteria 1734
205 Ga0207712_10297077 3300025961 Bacteria 1324
206 Ga0207640_10086523 3300025981 Bacteria 2158
207 Ga0207678_10137567 3300026067 Bacteria 2084
208 Ga0207708_10132650 3300026075 Bacteria 1948
209 Ga0207674_10024285 3300026116 Bacteria 6480
210 Ga0207674_10072447 3300026116 Bacteria 3461
211 Ga0207675_100010838 3300026118 Bacteria 8541
212 Ga0207675_100057667 3300026118 Bacteria 3623
213 Ga0207683_10009335 3300026121 Bacteria 8356
214 Ga0207698_10122976 3300026142 Bacteria 2200
215 Ga0207698_10165291 3300026142 Bacteria 1941
216 Ga0207428_10000431 3300027907 Bacteria 51701
217 Ga0207428_10025292 3300027907 Bacteria 4969
218 Ga0207428_10106494 3300027907 Bacteria 2161
219 Ga0268264_10032711 3300028381 Bacteria 4268
220 Ga0265319_1005442 3300028563 Bacteria 6088
221 Ga0265319_1008616 3300028563 Bacteria 4446
222 Ga0265319_1011220 3300028563 Bacteria 3683
223 Ga0265334_10000884 3300028573 Bacteria 14971
224 Ga0265334_10027204 3300028573 Bacteria 2305
225 Ga0265318_10000561 3300028577 Bacteria 26198
226 Ga0265318_10011745 3300028577 Bacteria 3753
227 Ga0265318_10059030 3300028577 Bacteria 1431
228 Ga0265322_10006466 3300028654 Bacteria 3450
229 Ga0265338_10009928 3300028800 Bacteria 11254
230 Ga0265338_10016638 3300028800 Bacteria 7978
231 Ga0265338_10045778 3300028800 Bacteria 4018
232 Ga0265338_10200415 3300028800 Bacteria 1505
233 Ga0265332_10044208 3300031238 Bacteria 1921
234 Ga0265328_10000876 3300031239 Bacteria 13921
235 Ga0265320_10038679 3300031240 Bacteria 2391
236 Ga0265325_10002855 3300031241 Bacteria 11521
237 Ga0265329_10027508 3300031242 Bacteria 1868
238 Ga0265329_10030733 3300031242 Bacteria 1748
239 Ga0265340_10046703 3300031247 Bacteria 2111
240 Ga0265340_10088295 3300031247 Bacteria 1452
241 Ga0265339_10055967 3300031249 Bacteria 2137
242 Ga0265327_10000014 3300031251 Bacteria 506288
243 Ga0265327_10012029 3300031251 Bacteria 5884
244 Ga0265316_10009520 3300031344 Bacteria 8943
245 Ga0265316_10027194 3300031344 Bacteria 4741
246 Ga0265313_10002358 3300031595 Bacteria 16470
247 Ga0265314_10003852 3300031711 Bacteria 14305
248 Ga0265314_10008195 3300031711 Bacteria 8985
249 Ga0265342_10018395 3300031712 Bacteria 4528
250 Ga0307406_10131836 3300031901 Bacteria 1756
251 Ga0307406_10134487 3300031901 Bacteria 1740
252 Ga0307416_100161270 3300032002 Bacteria 2073
253 Ga0307415_100180915 3300032126 Bacteria 1654
254 Ga0373944_0037754 3300035089 Bacteria 1481
255 Ga0373949_0012154 3300035090 Bacteria 1901
256 Ga0373956_0060057 3300035119 Bacteria 1721
257 Ga0373943_0001869 3300035170 Bacteria 9519
258 Ga0373943_0002003 3300035170 Bacteria 9228
259 Ga0373946_0006469 3300035171 Bacteria 4247
260 Ga0373955_0116672 3300035172 Bacteria 1548
261 Ga0373961_0010445 3300035241 Bacteria 2288
262 Ga0373935_0093176 3300035692 Bacteria 1975
263 Ga0373927_0041300 3300035695 Bacteria 2992
264 Ga0373933_0016032 3300035724 Bacteria 4186
265 Ga0373947_0000658 3300035725 Bacteria 20469
266 Ga0373947_0010442 3300035725 Bacteria 5329
267 Ga0373925_0006545 3300037068 Bacteria 8566
268 Ga0373925_0013616 3300037068 Bacteria 5890
269 Ga0395899_0005121 3300037312 Bacteria 10201
270 Ga0395899_0005857 3300037312 Bacteria 9540
271 Ga0395899_0008984 3300037312 Bacteria 7685
272 Ga0395899_0030078 3300037312 Bacteria 4086
273 Ga0395899_0048992 3300037312 Bacteria 3141
274 Ga0395900_0001698 3300037418 Bacteria 25566
275 Ga0395900_0001815 3300037418 Bacteria 24440
276 Ga0395900_0038976 3300037418 Bacteria 4898
277 Ga0395900_0045966 3300037418 Bacteria 4497
278 Ga0395900_0055873 3300037418 Bacteria 4064
279 Ga0395900_0075457 3300037418 Bacteria 3466
280 Ga0395900_0206324 3300037418 Bacteria 1986
281 Ga0395900_0229053 3300037418 Bacteria 1870
282 Ga0395900_0544117 3300037418 Bacteria 1106
283 Ga0395898_0006446 3300037466 Bacteria 12539
284 Ga0395898_0009510 3300037466 Bacteria 10203
285 Ga0395898_0015449 3300037466 Bacteria 7829
286 Ga0395898_0016345 3300037466 Bacteria 7594
287 Ga0395898_0034799 3300037466 Bacteria 5014
288 Ga0395898_0042119 3300037466 Bacteria 4507
289 Ga0395898_0211632 3300037466 Bacteria 1849
290 Ga0395898_0212570 3300037466 Bacteria 1845
291 Ga0395898_0217643 3300037466 Bacteria 1822
292 Ga0395898_0414777 3300037466 Bacteria 1283
293 Ga0395905_0006116 3300037471 Bacteria 12159
294 Ga0395905_0017788 3300037471 Bacteria 6752
295 Ga0395905_0022493 3300037471 Bacteria 5962
296 Ga0395905_0033088 3300037471 Bacteria 4860
297 Ga0395905_0042113 3300037471 Bacteria 4284
298 Ga0395905_0100334 3300037471 Bacteria 2718
299 Ga0395905_0142045 3300037471 Bacteria 2258
300 Ga0395905_0151268 3300037471 Bacteria 2183
301 Ga0395905_0153526 3300037471 Bacteria 2166
302 Ga0395905_0234491 3300037471 Bacteria 1715
303 Ga0395901_0005917 3300038443 Bacteria 12387
304 Ga0395901_0009486 3300038443 Bacteria 9872
305 Ga0395901_0016276 3300038443 Bacteria 7574
306 Ga0395901_0018544 3300038443 Bacteria 7104
307 Ga0395901_0028173 3300038443 Bacteria 5778
308 Ga0395901_0056796 3300038443 Bacteria 4072
309 Ga0395901_0152151 3300038443 Bacteria 2431
310 Ga0395901_0200729 3300038443 Bacteria 2090
311 Ga0395901_0274153 3300038443 Bacteria 1754
312 Ga0395901_0472476 3300038443 Bacteria 1280
313 Ga0436365_0212877 3300039437 Bacteria 2943
314 Ga0439436_0022153 3300041404 Bacteria 1883
315 Ga0439439_0006996 3300041406 Bacteria 2626
316 Ga0439453_0005787 3300041408 Bacteria 1899
317 Ga0451789_0293741 3300041443 Bacteria 2258
318 Ga0451793_1848829 3300041452 Bacteria 2121
319 Ga0451795_0352695 3300041456 Bacteria 1680
320 Ga0451807_0428708 3300041486 Bacteria 1650
321 Ga0451833_0581219 3300041491 Bacteria 1833
322 Ga0451839_1645058 3300041496 Bacteria 1429
323 Ga0439433_0003631 3300041999 Bacteria 3319
324 Ga0439454_000700 3300042011 Bacteria 2845
325 Ga0450920_016532 3300042122 Bacteria 1407
326 Ga0450888_006539 3300042126 Bacteria 1270
327 Ga0450906_012724 3300042145 Bacteria 1557
328 Ga0439446_0002889 3300042156 Bacteria 4190
329 Ga0439434_0017512 3300042435 Bacteria 2144
330 Ga0439460_0039901 3300042461 Bacteria 1374
331 Ga0439460_0073464 3300042461 Bacteria 1063
332 Ga0466969_0018025 3300044656 Bacteria 3683
333 Ga0466961_0017989 3300044693 Bacteria 4544
334 Ga0466963_0002900 3300044694 Bacteria 9681
335 Ga0466963_0003298 3300044694 Bacteria 9204
336 Ga0466963_0010394 3300044694 Bacteria 5634
337 Ga0466964_0003519 3300044706 Bacteria 5721
338 Ga0466964_0039992 3300044706 Bacteria 1892
339 Ga0466971_0008682 3300044719 Bacteria 4432
340 Ga0466968_0095951 3300044735 Bacteria 1320
341 Ga0466957_0048811 3300044842 Bacteria 2572
342 Ga0466959_0050185 3300045049 Bacteria 3063
343 Ga0466958_0007000 3300045836 Bacteria 6168
344 Ga0466958_0054203 3300045836 Bacteria 2432
345 Ga0466967_0010673 3300045976 Bacteria 6906
346 Ga0466967_0042111 3300045976 Bacteria 3944
347 Ga0466967_0150238 3300045976 Bacteria 2176
348 Ga0466967_0158001 3300045976 Bacteria 2126
349 Ga0466967_0195674 3300045976 Bacteria 1912
350 Ga0466967_0286551 3300045976 Bacteria 1581
351 Ga0495592_0054410 3300046454 Bacteria 2965
352 Ga0495603_0002169 3300046455 Bacteria 11549
353 Ga0495603_0067572 3300046455 Bacteria 2104
354 Ga0495629_0000159 3300046459 Bacteria 59616
355 Ga0495629_0067188 3300046459 Bacteria 2502
356 Ga0495629_0167429 3300046459 Bacteria 1526
357 Ga0495641_0003425 3300046461 Bacteria 11883
358 Ga0495651_0014719 3300046462 Bacteria 6049
359 Ga0495653_0047507 3300046463 Bacteria 3319
360 Ga0495653_0086235 3300046463 Bacteria 2308
361 Ga0495580_0104775 3300046472 Bacteria 1966
362 Ga0495582_0000183 3300046473 Bacteria 34098
363 Ga0495582_0024372 3300046473 Bacteria 3310
364 Ga0495639_0004941 3300046475 Bacteria 5715
365 Ga0495662_0000220 3300046476 Bacteria 23891
366 Ga0495596_0019243 3300046500 Bacteria 2807
367 Ga0495596_0049810 3300046500 Bacteria 1642
368 Ga0495618_0045419 3300046514 Bacteria 2771
369 Ga0495618_0112058 3300046514 Bacteria 1747
370 Ga0495630_0004113 3300046517 Bacteria 10186
371 Ga0495630_0005932 3300046517 Bacteria 8638
372 Ga0495630_0017737 3300046517 Bacteria 5220
373 Ga0495630_0133971 3300046517 Bacteria 1882
374 Ga0495644_0072649 3300046523 Bacteria 1294
375 Ga0495666_0030129 3300046526 Bacteria 2665
376 Ga0495665_0003082 3300046531 Bacteria 9020
377 Ga0495640_0057771 3300046533 Bacteria 2647
378 Ga0495640_0072749 3300046533 Bacteria 2302
379 Ga0495640_0073356 3300046533 Bacteria 2291
380 Ga0495587_0022855 3300046536 Bacteria 3847
381 Ga0495587_0079257 3300046536 Bacteria 1905
382 Ga0495645_0041657 3300046543 Bacteria 3349
383 Ga0495667_0128070 3300046559 Bacteria 1637
384 Ga0495634_0006252 3300046642 Bacteria 9068
385 Ga0495634_0164727 3300046642 Bacteria 1396
386 Ga0495635_0049850 3300046663 Bacteria 2886
387 Ga0495635_0070804 3300046663 Bacteria 2390
388 Ga0495635_0075561 3300046663 Bacteria 2308
389 Ga0495588_0011111 3300046674 Bacteria 4215
390 Ga0495657_0031896 3300046675 Bacteria 3680
391 Ga0495657_0095155 3300046675 Bacteria 1904
392 Ga0495599_0113359 3300046678 Bacteria 1688
393 Ga0495623_0017587 3300046679 Bacteria 4616
394 Ga0495646_0034846 3300046680 Bacteria 3124
395 Ga0495646_0102532 3300046680 Bacteria 1639
396 Ga0495658_0003714 3300046683 Bacteria 7549
397 Ga0495658_0068665 3300046683 Bacteria 2053
398 Ga0495613_0001702 3300046689 Bacteria 16745
399 Ga0495613_0016817 3300046689 Bacteria 5447
400 Ga0495671_0074955 3300046692 Bacteria 1660
401 Ga0495600_0022984 3300046809 Bacteria 4009
402 Ga0495600_0062832 3300046809 Bacteria 2426
403 Ga0495581_0002281 3300047315 Bacteria 10800
404 Ga0495604_0021242 3300047317 Bacteria 5182
405 Ga0495674_0003066 3300047319 Bacteria 16232
406 Ga0495674_0059473 3300047319 Bacteria 3337
407 Ga0495676_0008530 3300047321 Bacteria 9392
408 Ga0495676_0151278 3300047321 Bacteria 1651
409 Ga0495676_0152149 3300047321 Bacteria 1645
410 Ga0495680_0004997 3300047322 Bacteria 12543
411 Ga0495680_0015775 3300047322 Bacteria 6505
412 Ga0495680_0020576 3300047322 Bacteria 5546
413 Ga0495680_0104439 3300047322 Bacteria 2108
414 Ga0495593_0004600 3300047673 Bacteria 8205
415 Ga0495602_0016803 3300048088 Bacteria 7345
416 Ga0496100_0003593 3300048903 Bacteria 8103
417 Ga0496100_0018347 3300048903 Bacteria 4149
418 Ga0496100_0031095 3300048903 Bacteria 3316
419 Ga0496100_0043960 3300048903 Bacteria 2859
420 Ga0496100_0065446 3300048903 Bacteria 2408
421 Ga0496100_0320661 3300048903 Bacteria 1164
422 Ga0496101_0003566 3300048904 Bacteria 9708
423 Ga0496101_0007288 3300048904 Bacteria 7156
424 Ga0496101_0045230 3300048904 Bacteria 3152
425 Ga0496101_0058408 3300048904 Bacteria 2793
426 Ga0496101_0106715 3300048904 Bacteria 2103
427 Ga0496102_0000999 3300048905 Bacteria 26578
428 Ga0496102_0003890 3300048905 Bacteria 12652
429 Ga0496102_0022014 3300048905 Bacteria 5646
430 Ga0496102_0227249 3300048905 Bacteria 1760
431 Ga0496103_0031458 3300048906 Bacteria 3233
432 Ga0496103_0047973 3300048906 Bacteria 2639
433 Ga0496103_0081648 3300048906 Bacteria 2034
434 Ga0496104_0000992 3300048907 Bacteria 24270
435 Ga0496104_0078934 3300048907 Bacteria 3137
436 Ga0496104_0172381 3300048907 Bacteria 2074
437 Ga0496105_0000598 3300048908 Bacteria 24057
438 Ga0496105_0003424 3300048908 Bacteria 11740
439 Ga0496105_0074721 3300048908 Bacteria 2800
440 Ga0496105_0141421 3300048908 Bacteria 1981
441 Ga0496105_0143600 3300048908 Bacteria 1964
442 Ga0496105_0145638 3300048908 Bacteria 1948
443 Ga0496105_0170825 3300048908 Bacteria 1782
444 Ga0496106_0020345 3300048909 Bacteria 4924
445 Ga0496106_0163743 3300048909 Bacteria 1760
446 Ga0496107_0025867 3300048910 Bacteria 4158
447 Ga0496108_0014734 3300048911 Bacteria 6380
448 Ga0496108_0052878 3300048911 Bacteria 3405
449 Ga0496108_0059631 3300048911 Bacteria 3209
450 Ga0496108_0121633 3300048911 Bacteria 2239
451 Ga0496108_0150569 3300048911 Bacteria 2007
452 Ga0496109_0002918 3300048912 Bacteria 14290
453 Ga0496109_0004618 3300048912 Bacteria 11496
454 Ga0496109_0019138 3300048912 Bacteria 6031
455 Ga0496109_0020723 3300048912 Bacteria 5806
456 Ga0496109_0056953 3300048912 Bacteria 3566
457 Ga0496109_0209478 3300048912 Bacteria 1833
458 Ga0496110_0001490 3300048913 Bacteria 16957
459 Ga0496110_0003337 3300048913 Bacteria 12268
460 Ga0496110_0008544 3300048913 Bacteria 8245
461 Ga0496110_0014931 3300048913 Bacteria 6456
462 Ga0496110_0052501 3300048913 Bacteria 3582
463 Ga0496110_0096612 3300048913 Bacteria 2648
464 Ga0496110_0134966 3300048913 Bacteria 2229
465 Ga0496111_0000850 3300048914 Bacteria 16511
466 Ga0496111_0001012 3300048914 Bacteria 15424
467 Ga0496111_0002022 3300048914 Bacteria 12073
468 Ga0496111_0009525 3300048914 Bacteria 6490
469 Ga0496111_0037237 3300048914 Bacteria 3482
470 Ga0496111_0069832 3300048914 Bacteria 2554
471 Ga0496111_0134981 3300048914 Bacteria 1827
472 Ga0496112_0002299 3300048915 Bacteria 15308
473 Ga0496112_0025005 3300048915 Bacteria 5730
474 Ga0496112_0108665 3300048915 Bacteria 2744
475 Ga0496112_0395153 3300048915 Bacteria 1323
476 Ga0496113_0015794 3300048916 Bacteria 5202
477 Ga0496113_0028376 3300048916 Bacteria 4025
478 Ga0496113_0069242 3300048916 Bacteria 2680
479 Ga0496114_0001233 3300048917 Bacteria 19345
480 Ga0496114_0009854 3300048917 Bacteria 7594
481 Ga0496114_0015901 3300048917 Bacteria 6056
482 Ga0496114_0048330 3300048917 Bacteria 3539
483 Ga0496115_0022707 3300048918 Bacteria 4865
484 Ga0496115_0041573 3300048918 Bacteria 3659
485 Ga0496115_0064139 3300048918 Bacteria 2965
486 Ga0501031_0009448 3300049568 Bacteria 6340
487 Ga0501031_0011946 3300049568 Bacteria 5661
488 Ga0501031_0012444 3300049568 Bacteria 5551
489 Ga0501031_0032230 3300049568 Bacteria 3417
490 Ga0501031_0165559 3300049568 Bacteria 1445
491 Ga0501032_0005924 3300049569 Bacteria 9030
492 Ga0501033_0019739 3300049570 Bacteria 5093
493 Ga0501033_0020147 3300049570 Bacteria 5042
494 Ga0501036_0004126 3300049572 Bacteria 11685
495 Ga0501036_0017431 3300049572 Bacteria 6004
496 Ga0501036_0024235 3300049572 Bacteria 5114
497 Ga0501036_0036266 3300049572 Bacteria 4172
498 Ga0501036_0065916 3300049572 Bacteria 3064
499 Ga0501037_0000556 3300049573 Bacteria 29683
500 Ga0501038_0016342 3300049574 Bacteria 6727
501 Ga0501038_0017489 3300049574 Bacteria 6481
502 Ga0501038_0042883 3300049574 Bacteria 3938
503 Ga0501038_0114529 3300049574 Bacteria 2230
504 Ga0501038_0190256 3300049574 Bacteria 1652
505 Ga0501039_0001806 3300049575 Bacteria 15825
506 Ga0501039_0010915 3300049575 Bacteria 6923
507 Ga0501039_0028212 3300049575 Bacteria 4319
508 Ga0501039_0054017 3300049575 Bacteria 3110
509 Ga0501039_0093729 3300049575 Bacteria 2340
510 Ga0501040_0014802 3300049576 Bacteria 5147
511 Ga0501040_0030015 3300049576 Bacteria 3670
512 Ga0501040_0039618 3300049576 Bacteria 3204
513 Ga0501040_0057822 3300049576 Bacteria 2663
514 Ga0501040_0139381 3300049576 Bacteria 1708
515 Ga0501040_0247227 3300049576 Bacteria 1272
516 Ga0501041_0001746 3300049577 Bacteria 12186
517 Ga0501041_0006721 3300049577 Bacteria 6741
518 Ga0501041_0006801 3300049577 Bacteria 6701
519 Ga0501041_0011042 3300049577 Bacteria 5333
520 Ga0501041_0067661 3300049577 Bacteria 2189
521 Ga0501041_0159264 3300049577 Bacteria 1411
522 Ga0501042_0015496 3300049578 Bacteria 5220
523 Ga0501042_0018996 3300049578 Bacteria 4768
524 Ga0501042_0110850 3300049578 Bacteria 1976
525 Ga0501042_0150024 3300049578 Bacteria 1681
526 Ga0501042_0155859 3300049578 Bacteria 1647
527 Ga0501043_0010792 3300049579 Bacteria 7153
528 Ga0501043_0057894 3300049579 Bacteria 3042
529 Ga0501046_0002105 3300049580 Bacteria 18869
530 Ga0501046_0010021 3300049580 Bacteria 8161
531 Ga0501047_0060414 3300049581 Bacteria 3658
532 Ga0501048_0001503 3300049582 Bacteria 17647
533 Ga0501048_0005851 3300049582 Bacteria 9353
534 Ga0501048_0011997 3300049582 Bacteria 6457
535 Ga0501048_0027113 3300049582 Bacteria 4166
536 Ga0501048_0047885 3300049582 Bacteria 3049
537 Ga0501048_0069351 3300049582 Bacteria 2490
538 Ga0501067_0002721 3300049583 Bacteria 9723
539 Ga0501067_0130055 3300049583 Bacteria 1401
540 Ga0501068_0002565 3300049584 Bacteria 9636
541 Ga0501068_0056140 3300049584 Bacteria 2387
542 Ga0501068_0056992 3300049584 Bacteria 2368
543 Ga0501068_0172573 3300049584 Bacteria 1365
544 Ga0501069_0005303 3300049585 Bacteria 6698
545 Ga0501070_0013449 3300049586 Bacteria 6898
546 Ga0501070_0016592 3300049586 Bacteria 6186
547 Ga0501071_0001415 3300049587 Bacteria 13806
548 Ga0501071_0011424 3300049587 Bacteria 5982
549 Ga0501071_0033159 3300049587 Bacteria 3670
550 Ga0501071_0046579 3300049587 Bacteria 3114
551 Ga0501071_0158680 3300049587 Bacteria 1690
552 Ga0501072_0003345 3300049588 Bacteria 12059
553 Ga0501072_0009597 3300049588 Bacteria 7358
554 Ga0501072_0018392 3300049588 Bacteria 5380
555 Ga0501072_0033003 3300049588 Bacteria 4055
556 Ga0501072_0035081 3300049588 Bacteria 3931
557 Ga0501072_0148199 3300049588 Bacteria 1871
558 Ga0501072_0187953 3300049588 Bacteria 1647
559 Ga0501072_0264555 3300049588 Bacteria 1369
560 Ga0501073_0041153 3300049589 Bacteria 3265
561 Ga0501073_0131446 3300049589 Bacteria 1735
562 Ga0501074_0020916 3300049590 Bacteria 4752
563 Ga0501074_0072156 3300049590 Bacteria 2480
564 Ga0501074_0092101 3300049590 Bacteria 2171
565 Ga0501074_0112223 3300049590 Bacteria 1950
566 Ga0501075_0002024 3300049591 Bacteria 13403
567 Ga0501075_0003197 3300049591 Bacteria 10961
568 Ga0501075_0004015 3300049591 Bacteria 9919
569 Ga0501075_0021247 3300049591 Bacteria 4730
570 Ga0501075_0051402 3300049591 Bacteria 3099
571 Ga0501075_0114910 3300049591 Bacteria 2047
572 Ga0501075_0205988 3300049591 Bacteria 1500
573 Ga0501076_0004491 3300049592 Bacteria 9938
574 Ga0501076_0006461 3300049592 Bacteria 8508
575 Ga0501076_0010329 3300049592 Bacteria 6923
576 Ga0501076_0037340 3300049592 Bacteria 3809
577 Ga0501076_0081432 3300049592 Bacteria 2599
578 Ga0501077_0000985 3300049593 Bacteria 17153
579 Ga0501077_0001964 3300049593 Bacteria 12433
580 Ga0501077_0008778 3300049593 Bacteria 6272
581 Ga0501077_0012300 3300049593 Bacteria 5360
582 Ga0501077_0012690 3300049593 Bacteria 5277
583 Ga0501077_0019080 3300049593 Bacteria 4335
584 Ga0501079_0010798 3300049741 Bacteria 6955
585 Ga0501079_0014046 3300049741 Bacteria 6106
586 Ga0501079_0017017 3300049741 Bacteria 5552
587 Ga0501079_0029098 3300049741 Bacteria 4240
588 Ga0501079_0072930 3300049741 Bacteria 2654
589 Ga0501079_0073338 3300049741 Bacteria 2645
590 Ga0501080_0005070 3300049742 Bacteria 11732
591 Ga0501080_0007528 3300049742 Bacteria 9838
592 Ga0501080_0026209 3300049742 Bacteria 5416
593 Ga0501080_0032290 3300049742 Bacteria 4882
594 Ga0501080_0043477 3300049742 Bacteria 4183
595 Ga0501081_0002309 3300049743 Bacteria 12012
596 Ga0501081_0009349 3300049743 Bacteria 6386
597 Ga0501081_0009510 3300049743 Bacteria 6337
598 Ga0501081_0013363 3300049743 Bacteria 5400
599 Ga0501081_0044222 3300049743 Bacteria 3056
600 Ga0501083_0007917 3300049744 Bacteria 7526
601 Ga0501083_0012620 3300049744 Bacteria 5910
602 Ga0501083_0031777 3300049744 Bacteria 3623
603 Ga0501035_0030724 3300049822 Bacteria 4897
604 Ga0501035_0031407 3300049822 Bacteria 4837
605 Ga0501035_0051633 3300049822 Bacteria 3680
606 Ga0501044_0072812 3300049823 Bacteria 3493
607 Ga0501044_0076298 3300049823 Bacteria 3402
608 Ga0501044_0081779 3300049823 Bacteria 3269
609 Ga0501045_0001518 3300049824 Bacteria 15440
610 Ga0501045_0002277 3300049824 Bacteria 13003
611 Ga0501045_0005780 3300049824 Bacteria 8559
612 Ga0501045_0011883 3300049824 Bacteria 6119
613 Ga0501045_0147134 3300049824 Bacteria 1752
614 nmdc:mga00v17_4654_c1 3300050491 Bacteria 7162
615 nmdc:mga06z11_39796_c1 3300050494 Bacteria 2341
616 nmdc:mga05p37_123043_c1 3300050507 Bacteria 3187
617 nmdc:mga05p37_208930_c1 3300050507 Bacteria 2361
618 nmdc:mga05p37_22821_c1 3300050507 Bacteria 7589
619 nmdc:mga05p37_230375_c1 3300050507 Bacteria 2232
620 nmdc:mga05p37_24026_c1 3300050507 Bacteria 7404
621 nmdc:mga05p37_376095_c1 3300050507 Bacteria 1666
622 nmdc:mga09592_39819_c1 3300050508 Bacteria 3948
623 nmdc:mga09592_52029_c1 3300050508 Bacteria 3456
624 nmdc:mga06r32_244409_c1 3300050510 Bacteria 1782
625 nmdc:mga06r32_334394_c1 3300050510 Bacteria 1499
626 nmdc:mga08y16_194002_c1 3300050511 Bacteria 2106
627 nmdc:mga08y16_92491_c1 3300050511 Bacteria 3152
628 nmdc:mga0n895_136186_c1 3300050512 Bacteria 2482
629 nmdc:mga0n895_321510_c1 3300050512 Bacteria 1568
630 nmdc:mga0n895_4658_c1 3300050512 Bacteria 11312
631 nmdc:mga0rr50_40202_c1 3300050513 Bacteria 3399
632 nmdc:mga0rr50_60587_c1 3300050513 Bacteria 2848
633 nmdc:mga08x19_49336_c1 3300050514 Bacteria 2699
634 nmdc:mga08x19_9240_c1 3300050514 Bacteria 5891
635 nmdc:mga0a205_60267_c1 3300050515 Bacteria 3666
636 nmdc:mga0a205_94501_c1 3300050515 Bacteria 2888
637 nmdc:mga0a205_9890_c1 3300050515 Bacteria 8748
638 Ga0495601_0000757 3300053077 Bacteria 17435
639 Ga0495601_0047996 3300053077 Bacteria 2689
640 Ga0495601_0072318 3300053077 Bacteria 2203
641 Ga0495655_0005452 3300053083 Bacteria 2247
642 Ga0495595_0011232 3300053084 Bacteria 3740
643 Ga0495619_0005539 3300053085 Bacteria 8009
644 Ga0495619_0023390 3300053085 Bacteria 3961
645 Ga0495619_0031768 3300053085 Bacteria 3422
646 Ga0495619_0074055 3300053085 Bacteria 2283
647 Ga0495619_0085656 3300053085 Bacteria 2129
648 Ga0501084_0003938 3300054114 Bacteria 12095
649 Ga0501084_0004712 3300054114 Bacteria 11143
650 Ga0501084_0009527 3300054114 Bacteria 8037
651 Ga0501084_0011433 3300054114 Bacteria 7349
652 Ga0501084_0049487 3300054114 Bacteria 3518
653 Ga0501084_0105188 3300054114 Bacteria 2371
654 Ga0501084_0118192 3300054114 Bacteria 2229
655 Ga0501084_0183350 3300054114 Bacteria 1767
656 Ga0590071_015562 3300059421 Bacteria 1783
657 Ga0501082_0004646 3300060353 Bacteria 11979
658 Ga0501082_0010213 3300060353 Bacteria 8082
659 Ga0501082_0028347 3300060353 Bacteria 4824
660 Ga0501082_0034830 3300060353 Bacteria 4339
661 Ga0501082_0062532 3300060353 Bacteria 3205
662 Ga0501082_0080366 3300060353 Bacteria 2813
663 Ga0501082_0134218 3300060353 Bacteria 2147
664 Ga0501082_0195660 3300060353 Bacteria 1759
665 Ga0466962_0000627 3300061719 Bacteria 15671
666 Ga0530510_0005684 3300061734 Bacteria 8638
667 Ga0530510_0024608 3300061734 Bacteria 4299
668 Ga0530510_0026776 3300061734 Bacteria 4129
669 Ga0105248_10413668
670 JGI25407J50210_10013488
671 Ga0070658_10042261
672 Ga0070658_10154108
673 Ga0070670_100180665
674 Ga0070680_100021911
675 Ga0070680_100065961
676 Ga0070680_100079043
677 Ga0070682_100049452
678 Ga0068868_100039855
679 Ga0070660_100000819
680 Ga0070660_100010792
681 Ga0070660_100017814
682 Ga0070660_100056966
683 Ga0070660_100127123
684 Ga0070689_100014722
685 Ga0070661_100049212
686 Ga0070661_100075497
687 Ga0070661_100119015
688 Ga0070692_10029036
689 Ga0070668_100042803
690 Ga0070675_100072593
691 Ga0070675_100083731
692 Ga0070674_100095256
693 Ga0070673_100187048
694 Ga0070714_100134906
695 Ga0070714_100198495
696 Ga0070714_100235718
697 Ga0070701_10007113
698 Ga0070711_100141808
699 Ga0070694_100099885
700 Ga0070708_100057681
701 Ga0070708_100109458
702 Ga0070663_100020364
703 Ga0070662_100018182
704 Ga0070662_100061948
705 Ga0070681_10000818
706 Ga0070681_10002075
707 Ga0070681_10017507
708 Ga0070681_10040047
709 Ga0070685_10040143
710 Ga0070706_100001869
711 Ga0070706_100003808
712 Ga0070706_100004945
713 Ga0070706_100005263
714 Ga0070706_100093191
715 Ga0070706_100209487
716 Ga0070707_100029065
717 Ga0070707_100073242
718 Ga0070707_100129187
719 Ga0070698_100001821
720 Ga0070698_100003055
721 Ga0070698_100008490
722 Ga0070698_100011112
723 Ga0070698_100013592
724 Ga0070698_100195821
725 Ga0070699_100080550
726 Ga0070699_100236479
727 Ga0070699_100415309
728 Ga0070679_100028811
729 Ga0070679_100110003
730 Ga0070697_100059796
731 Ga0070697_100101473
732 Ga0070672_100009638
733 Ga0070672_100033028
734 Ga0070693_100030067
735 Ga0070665_100075015
736 Ga0070704_100022510
737 Ga0068855_100056886
738 Ga0068855_100088902
739 Ga0068855_100192746
740 Ga0068852_100059311
741 Ga0068860_100051084
742 Ga0081455_10003327
743 Ga0081455_10006995
744 Ga0081455_10021239
745 Ga0081455_10022832
746 Ga0081455_10059128
747 Ga0081455_10131773
748 Ga0081455_10146791
749 Ga0081455_10157153
750 Ga0081538_10000195
751 Ga0081538_10037799
752 Ga0081538_10070943
753 Ga0081539_10000973
754 Ga0081539_10008764
755 Ga0075365_10013300
756 Ga0075365_10190486
757 Ga0075364_10057798
758 Ga0075432_10002179
759 Ga0075432_10039091
760 Ga0075428_100002450
761 Ga0075428_100191844
762 Ga0075430_100129619
763 Ga0075431_100079083
764 Ga0075433_10048678
765 Ga0075433_10149481
766 Ga0075434_100128254
767 Ga0075429_100076447
768 Ga0068865_100045520
769 Ga0068865_100065593
770 Ga0068865_100125017
771 Ga0075436_100048061
772 Ga0075436_100049246
773 Ga0075435_100096578
774 Ga0105244_10065749
775 Ga0111539_10036099
776 Ga0111539_10062191
777 Ga0111539_10067444
778 Ga0111539_10229441
779 Ga0111539_10247175
780 Ga0105245_10024883
781 Ga0105245_10030680
782 Ga0105247_10040212
783 Ga0114129_10408864
784 Ga0114129_10501671
785 Ga0105243_10051860
786 Ga0105243_10092111
787 Ga0105242_10034320
788 Ga0105242_10060368
789 Ga0105248_10080633
790 Ga0105248_10120907
791 Ga0105248_10248154
792 Ga0105237_10064403
793 Ga0105238_10028168
794 Ga0105249_10145438
795 Ga0105239_10042005
796 Ga0105239_10140002
797 Ga0105239_10221047
798 Ga0157371_10128215
799 Ga0157371_10186517
800 Ga0157370_10006933
801 Ga0157369_10001003
802 Ga0157374_10047472
803 Ga0157374_10116535
804 Ga0157374_10162809
805 Ga0157372_10031033
806 Ga0157372_10091948
807 Ga0157372_10141611
808 Ga0157372_10258138
809 Ga0157375_10010053
810 Ga0157375_10033375
811 Ga0157375_10040593
812 Ga0157375_10045570
813 Ga0157375_10297199
814 Ga0157380_10019372
815 Ga0157377_10160446
816 Ga0157379_10169388
817 Ga0206356_11828667
818 Ga0206353_10130899
819 Ga0207653_10055321
820 Ga0207643_10012190
821 Ga0207705_10133034
822 Ga0207684_10000137
823 Ga0207684_10000289
824 Ga0207684_10004500
825 Ga0207684_10019297
826 Ga0207707_10010499
827 Ga0207707_10012886
828 Ga0207707_10032544
829 Ga0207707_10093932
830 Ga0207695_10216916
831 Ga0207693_10027392
832 Ga0207663_10069088
833 Ga0207660_10012383
834 Ga0207660_10023914
835 Ga0207660_10076279
836 Ga0207657_10001876
837 Ga0207657_10010396
838 Ga0207657_10030401
839 Ga0207657_10030447
840 Ga0207657_10056602
841 Ga0207657_10085245
842 Ga0207657_10192613
843 Ga0207652_10024169
844 Ga0207652_10031973
845 Ga0207652_10041086
846 Ga0207652_10100256
847 Ga0207652_10106120
848 Ga0207646_10000665
849 Ga0207646_10003063
850 Ga0207646_10048754
851 Ga0207694_10097942
852 Ga0207687_10034003
853 Ga0207664_10032707
854 Ga0207664_10120910
855 Ga0207690_10138132
856 Ga0207706_10004470
857 Ga0207706_10068537
858 Ga0207686_10079672
859 Ga0207686_10121562
860 Ga0207709_10155036
861 Ga0207704_10019928
862 Ga0207691_10010949
863 Ga0207691_10047893
864 Ga0207691_10149037
865 Ga0207661_10010994
866 Ga0207661_10029560
867 Ga0207661_10137335
868 Ga0207661_10187105
869 Ga0207661_10246593
870 Ga0207679_10024866
871 Ga0207679_10162487
872 Ga0207667_10271257
873 Ga0207712_10297077
874 Ga0207640_10086523
875 Ga0207678_10137567
876 Ga0207708_10132650
877 Ga0207674_10024285
878 Ga0207674_10072447
879 Ga0207675_100010838
880 Ga0207675_100057667
881 Ga0207683_10009335
882 Ga0207698_10122976
883 Ga0207698_10165291
884 Ga0207428_10000431
885 Ga0207428_10025292
886 Ga0207428_10106494
887 Ga0268264_10032711
888 Ga0265319_1005442
889 Ga0265319_1008616
890 Ga0265319_1011220
891 Ga0265334_10000884
892 Ga0265334_10027204
893 Ga0265318_10000561
894 Ga0265318_10011745
895 Ga0265318_10059030
896 Ga0265322_10006466
897 Ga0265338_10009928
898 Ga0265338_10016638
899 Ga0265338_10045778
900 Ga0265338_10200415
901 Ga0265332_10044208
902 Ga0265328_10000876
903 Ga0265320_10038679
904 Ga0265325_10002855
905 Ga0265329_10027508
906 Ga0265329_10030733
907 Ga0265340_10046703
908 Ga0265340_10088295
909 Ga0265339_10055967
910 Ga0265327_10000014
911 Ga0265327_10012029
912 Ga0265316_10009520
913 Ga0265316_10027194
914 Ga0265313_10002358
915 Ga0265314_10003852
916 Ga0265314_10008195
917 Ga0265342_10018395
918 Ga0307406_10131836
919 Ga0307406_10134487
920 Ga0307416_100161270
921 Ga0307415_100180915
922 Ga0373944_0037754
923 Ga0373949_0012154
924 Ga0373956_0060057
925 Ga0373943_0001869
926 Ga0373943_0002003
927 Ga0373946_0006469
928 Ga0373955_0116672
929 Ga0373961_0010445
930 Ga0373935_0093176
931 Ga0373927_0041300
932 Ga0373933_0016032
933 Ga0373947_0000658
934 Ga0373947_0010442
935 Ga0373925_0006545
936 Ga0373925_0013616
937 Ga0395899_0005121
938 Ga0395899_0005857
939 Ga0395899_0008984
940 Ga0395899_0030078
941 Ga0395899_0048992
942 Ga0395900_0001698
943 Ga0395900_0001815
944 Ga0395900_0038976
945 Ga0395900_0045966
946 Ga0395900_0055873
947 Ga0395900_0075457
948 Ga0395900_0206324
949 Ga0395900_0229053
950 Ga0395900_0544117
951 Ga0395898_0006446
952 Ga0395898_0009510
953 Ga0395898_0015449
954 Ga0395898_0016345
955 Ga0395898_0034799
956 Ga0395898_0042119
957 Ga0395898_0211632
958 Ga0395898_0212570
959 Ga0395898_0217643
960 Ga0395898_0414777
961 Ga0395905_0006116
962 Ga0395905_0017788
963 Ga0395905_0022493
964 Ga0395905_0033088
965 Ga0395905_0042113
966 Ga0395905_0100334
967 Ga0395905_0142045
968 Ga0395905_0151268
969 Ga0395905_0153526
970 Ga0395905_0234491
971 Ga0395901_0005917
972 Ga0395901_0009486
973 Ga0395901_0016276
974 Ga0395901_0018544
975 Ga0395901_0028173
976 Ga0395901_0056796
977 Ga0395901_0152151
978 Ga0395901_0200729
979 Ga0395901_0274153
980 Ga0395901_0472476
981 Ga0436365_0212877
982 Ga0439436_0022153
983 Ga0439439_0006996
984 Ga0439453_0005787
985 Ga0451789_0293741
986 Ga0451793_1848829
987 Ga0451795_0352695
988 Ga0451807_0428708
989 Ga0451833_0581219
990 Ga0451839_1645058
991 Ga0439433_0003631
992 Ga0439454_000700
993 Ga0450920_016532
994 Ga0450888_006539
995 Ga0450906_012724
996 Ga0439446_0002889
997 Ga0439434_0017512
998 Ga0439460_0039901
999 Ga0439460_0073464
1000 Ga0466969_0018025
1001 Ga0466961_0017989
1002 Ga0466963_0002900
1003 Ga0466963_0003298
1004 Ga0466963_0010394
1005 Ga0466964_0003519
1006 Ga0466964_0039992
1007 Ga0466971_0008682
1008 Ga0466968_0095951
1009 Ga0466957_0048811
1010 Ga0466959_0050185
1011 Ga0466958_0007000
1012 Ga0466958_0054203
1013 Ga0466967_0010673
1014 Ga0466967_0042111
1015 Ga0466967_0150238
1016 Ga0466967_0158001
1017 Ga0466967_0195674
1018 Ga0466967_0286551
1019 Ga0495592_0054410
1020 Ga0495603_0002169
1021 Ga0495603_0067572
1022 Ga0495629_0000159
1023 Ga0495629_0067188
1024 Ga0495629_0167429
1025 Ga0495641_0003425
1026 Ga0495651_0014719
1027 Ga0495653_0047507
1028 Ga0495653_0086235
1029 Ga0495580_0104775
1030 Ga0495582_0000183
1031 Ga0495582_0024372
1032 Ga0495639_0004941
1033 Ga0495662_0000220
1034 Ga0495596_0019243
1035 Ga0495596_0049810
1036 Ga0495618_0045419
1037 Ga0495618_0112058
1038 Ga0495630_0004113
1039 Ga0495630_0005932
1040 Ga0495630_0017737
1041 Ga0495630_0133971
1042 Ga0495644_0072649
1043 Ga0495666_0030129
1044 Ga0495665_0003082
1045 Ga0495640_0057771
1046 Ga0495640_0072749
1047 Ga0495640_0073356
1048 Ga0495587_0022855
1049 Ga0495587_0079257
1050 Ga0495645_0041657
1051 Ga0495667_0128070
1052 Ga0495634_0006252
1053 Ga0495634_0164727
1054 Ga0495635_0049850
1055 Ga0495635_0070804
1056 Ga0495635_0075561
1057 Ga0495588_0011111
1058 Ga0495657_0031896
1059 Ga0495657_0095155
1060 Ga0495599_0113359
1061 Ga0495623_0017587
1062 Ga0495646_0034846
1063 Ga0495646_0102532
1064 Ga0495658_0003714
1065 Ga0495658_0068665
1066 Ga0495613_0001702
1067 Ga0495613_0016817
1068 Ga0495671_0074955
1069 Ga0495600_0022984
1070 Ga0495600_0062832
1071 Ga0495581_0002281
1072 Ga0495604_0021242
1073 Ga0495674_0003066
1074 Ga0495674_0059473
1075 Ga0495676_0008530
1076 Ga0495676_0151278
1077 Ga0495676_0152149
1078 Ga0495680_0004997
1079 Ga0495680_0015775
1080 Ga0495680_0020576
1081 Ga0495680_0104439
1082 Ga0495593_0004600
1083 Ga0495602_0016803
1084 Ga0496100_0003593
1085 Ga0496100_0018347
1086 Ga0496100_0031095
1087 Ga0496100_0043960
1088 Ga0496100_0065446
1089 Ga0496100_0320661
1090 Ga0496101_0003566
1091 Ga0496101_0007288
1092 Ga0496101_0045230
1093 Ga0496101_0058408
1094 Ga0496101_0106715
1095 Ga0496102_0000999
1096 Ga0496102_0003890
1097 Ga0496102_0022014
1098 Ga0496102_0227249
1099 Ga0496103_0031458
1100 Ga0496103_0047973
1101 Ga0496103_0081648
1102 Ga0496104_0000992
1103 Ga0496104_0078934
1104 Ga0496104_0172381
1105 Ga0496105_0000598
1106 Ga0496105_0003424
1107 Ga0496105_0074721
1108 Ga0496105_0141421
1109 Ga0496105_0143600
1110 Ga0496105_0145638
1111 Ga0496105_0170825
1112 Ga0496106_0020345
1113 Ga0496106_0163743
1114 Ga0496107_0025867
1115 Ga0496108_0014734
1116 Ga0496108_0052878
1117 Ga0496108_0059631
1118 Ga0496108_0121633
1119 Ga0496108_0150569
1120 Ga0496109_0002918
1121 Ga0496109_0004618
1122 Ga0496109_0019138
1123 Ga0496109_0020723
1124 Ga0496109_0056953
1125 Ga0496109_0209478
1126 Ga0496110_0001490
1127 Ga0496110_0003337
1128 Ga0496110_0008544
1129 Ga0496110_0014931
1130 Ga0496110_0052501
1131 Ga0496110_0096612
1132 Ga0496110_0134966
1133 Ga0496111_0000850
1134 Ga0496111_0001012
1135 Ga0496111_0002022
1136 Ga0496111_0009525
1137 Ga0496111_0037237
1138 Ga0496111_0069832
1139 Ga0496111_0134981
1140 Ga0496112_0002299
1141 Ga0496112_0025005
1142 Ga0496112_0108665
1143 Ga0496112_0395153
1144 Ga0496113_0015794
1145 Ga0496113_0028376
1146 Ga0496113_0069242
1147 Ga0496114_0001233
1148 Ga0496114_0009854
1149 Ga0496114_0015901
1150 Ga0496114_0048330
1151 Ga0496115_0022707
1152 Ga0496115_0041573
1153 Ga0496115_0064139
1154 Ga0501031_0009448
1155 Ga0501031_0011946
1156 Ga0501031_0012444
1157 Ga0501031_0032230
1158 Ga0501031_0165559
1159 Ga0501032_0005924
1160 Ga0501033_0019739
1161 Ga0501033_0020147
1162 Ga0501036_0004126
1163 Ga0501036_0017431
1164 Ga0501036_0024235
1165 Ga0501036_0036266
1166 Ga0501036_0065916
1167 Ga0501037_0000556
1168 Ga0501038_0016342
1169 Ga0501038_0017489
1170 Ga0501038_0042883
1171 Ga0501038_0114529
1172 Ga0501038_0190256
1173 Ga0501039_0001806
1174 Ga0501039_0010915
1175 Ga0501039_0028212
1176 Ga0501039_0054017
1177 Ga0501039_0093729
1178 Ga0501040_0014802
1179 Ga0501040_0030015
1180 Ga0501040_0039618
1181 Ga0501040_0057822
1182 Ga0501040_0139381
1183 Ga0501040_0247227
1184 Ga0501041_0001746
1185 Ga0501041_0006721
1186 Ga0501041_0006801
1187 Ga0501041_0011042
1188 Ga0501041_0067661
1189 Ga0501041_0159264
1190 Ga0501042_0015496
1191 Ga0501042_0018996
1192 Ga0501042_0110850
1193 Ga0501042_0150024
1194 Ga0501042_0155859
1195 Ga0501043_0010792
1196 Ga0501043_0057894
1197 Ga0501046_0002105
1198 Ga0501046_0010021
1199 Ga0501047_0060414
1200 Ga0501048_0001503
1201 Ga0501048_0005851
1202 Ga0501048_0011997
1203 Ga0501048_0027113
1204 Ga0501048_0047885
1205 Ga0501048_0069351
1206 Ga0501067_0002721
1207 Ga0501067_0130055
1208 Ga0501068_0002565
1209 Ga0501068_0056140
1210 Ga0501068_0056992
1211 Ga0501068_0172573
1212 Ga0501069_0005303
1213 Ga0501070_0013449
1214 Ga0501070_0016592
1215 Ga0501071_0001415
1216 Ga0501071_0011424
1217 Ga0501071_0033159
1218 Ga0501071_0046579
1219 Ga0501071_0158680
1220 Ga0501072_0003345
1221 Ga0501072_0009597
1222 Ga0501072_0018392
1223 Ga0501072_0033003
1224 Ga0501072_0035081
1225 Ga0501072_0148199
1226 Ga0501072_0187953
1227 Ga0501072_0264555
1228 Ga0501073_0041153
1229 Ga0501073_0131446
1230 Ga0501074_0020916
1231 Ga0501074_0072156
1232 Ga0501074_0092101
1233 Ga0501074_0112223
1234 Ga0501075_0002024
1235 Ga0501075_0003197
1236 Ga0501075_0004015
1237 Ga0501075_0021247
1238 Ga0501075_0051402
1239 Ga0501075_0114910
1240 Ga0501075_0205988
1241 Ga0501076_0004491
1242 Ga0501076_0006461
1243 Ga0501076_0010329
1244 Ga0501076_0037340
1245 Ga0501076_0081432
1246 Ga0501077_0000985
1247 Ga0501077_0001964
1248 Ga0501077_0008778
1249 Ga0501077_0012300
1250 Ga0501077_0012690
1251 Ga0501077_0019080
1252 Ga0501079_0010798
1253 Ga0501079_0014046
1254 Ga0501079_0017017
1255 Ga0501079_0029098
1256 Ga0501079_0072930
1257 Ga0501079_0073338
1258 Ga0501080_0005070
1259 Ga0501080_0007528
1260 Ga0501080_0026209
1261 Ga0501080_0032290
1262 Ga0501080_0043477
1263 Ga0501081_0002309
1264 Ga0501081_0009349
1265 Ga0501081_0009510
1266 Ga0501081_0013363
1267 Ga0501081_0044222
1268 Ga0501083_0007917
1269 Ga0501083_0012620
1270 Ga0501083_0031777
1271 Ga0501035_0030724
1272 Ga0501035_0031407
1273 Ga0501035_0051633
1274 Ga0501044_0072812
1275 Ga0501044_0076298
1276 Ga0501044_0081779
1277 Ga0501045_0001518
1278 Ga0501045_0002277
1279 Ga0501045_0005780
1280 Ga0501045_0011883
1281 Ga0501045_0147134
1282 nmdc:mga00v17_4654_c1
1283 nmdc:mga06z11_39796_c1
1284 nmdc:mga05p37_123043_c1
1285 nmdc:mga05p37_208930_c1
1286 nmdc:mga05p37_22821_c1
1287 nmdc:mga05p37_230375_c1
1288 nmdc:mga05p37_24026_c1
1289 nmdc:mga05p37_376095_c1
1290 nmdc:mga09592_39819_c1
1291 nmdc:mga09592_52029_c1
1292 nmdc:mga06r32_244409_c1
1293 nmdc:mga06r32_334394_c1
1294 nmdc:mga08y16_194002_c1
1295 nmdc:mga08y16_92491_c1
1296 nmdc:mga0n895_136186_c1
1297 nmdc:mga0n895_321510_c1
1298 nmdc:mga0n895_4658_c1
1299 nmdc:mga0rr50_40202_c1
1300 nmdc:mga0rr50_60587_c1
1301 nmdc:mga08x19_49336_c1
1302 nmdc:mga08x19_9240_c1
1303 nmdc:mga0a205_60267_c1
1304 nmdc:mga0a205_94501_c1
1305 nmdc:mga0a205_9890_c1
1306 Ga0495601_0000757
1307 Ga0495601_0047996
1308 Ga0495601_0072318
1309 Ga0495655_0005452
1310 Ga0495595_0011232
1311 Ga0495619_0005539
1312 Ga0495619_0023390
1313 Ga0495619_0031768
1314 Ga0495619_0074055
1315 Ga0495619_0085656
1316 Ga0501084_0003938
1317 Ga0501084_0004712
1318 Ga0501084_0009527
1319 Ga0501084_0011433
1320 Ga0501084_0049487
1321 Ga0501084_0105188
1322 Ga0501084_0118192
1323 Ga0501084_0183350
1324 Ga0590071_015562
1325 Ga0501082_0004646
1326 Ga0501082_0010213
1327 Ga0501082_0028347
1328 Ga0501082_0034830
1329 Ga0501082_0062532
1330 Ga0501082_0080366
1331 Ga0501082_0134218
1332 Ga0501082_0195660
1333 Ga0466962_0000627
1334 Ga0530510_0005684
1335 Ga0530510_0024608
1336 Ga0530510_0026776

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00441

Acyl-CoA_dh_1

Acyl-CoA dehydrogenase, C-terminal domain

258

406

0.95

PF02770

Acyl-CoA_dh_M

Acyl-CoA dehydrogenase, middle domain

152

246

0.87

PF02771

Acyl-CoA_dh_N

Acyl-CoA dehydrogenase, N-terminal domain

32

148

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hk0-assembly1.cif.gz_A crystal structure of fic32-33 complex from streptomyces ficellus nrrl 8067 0.8845 1 354
6wy8-assembly1.cif.gz_D tcur3481-tcur3483 steroid acad 0.8796 1 363
4irn-assembly2.cif.gz_E crystal structure of the prolyl acyl carrier protein oxidase anab 0.8768 4 360
6wy8-assembly1.cif.gz_D tcur3481-tcur3483 steroid acad 0.8754 1 363
6af6-assembly1.cif.gz_A piga with fad and proline 0.8743 1 360
ID Description Score Start End Superfamily
af_P96855_462_572_2.40.110.10 Mainly Beta;Beta Barrel;Butyryl-CoA Dehydrogenase, subunit A; domain 2;Butyryl-CoA Dehydrogenase, subunit A, domain 2 0.9776 112 221 2.40.110.10
af_P96855_462_572_2.40.110.10 Mainly Beta;Beta Barrel;Butyryl-CoA Dehydrogenase, subunit A; domain 2;Butyryl-CoA Dehydrogenase, subunit A, domain 2 0.9605 112 221 2.40.110.10
2pg0A02 Mainly Beta;Beta Barrel;Butyryl-CoA Dehydrogenase, subunit A; domain 2;Butyryl-CoA Dehydrogenase, subunit A, domain 2 0.9383 112 216 2.40.110.10
5iduB02 Mainly Beta;Beta Barrel;Butyryl-CoA Dehydrogenase, subunit A; domain 2;Butyryl-CoA Dehydrogenase, subunit A, domain 2 0.9322 112 227 2.40.110.10
af_Q6NWF0_171_282_2.40.110.10 Mainly Beta;Beta Barrel;Butyryl-CoA Dehydrogenase, subunit A; domain 2;Butyryl-CoA Dehydrogenase, subunit A, domain 2 0.9306 112 218 2.40.110.10
ID Description Score Start End GO Terms
AF-A0A353HX35-F1-model_v4 Acyl-CoA dehydrogenase 0.9844 127 224 GO:0005886
GO:0016627
AF-A0A351EJS1-F1-model_v4 Acyl-CoA dehydrogenase 0.9686 115 205 GO:0005886
GO:0016627
AF-X8C5I8-F1-model_v4 deleted 0.9604 84 216
AF-A0A351EJS1-F1-model_v4 Acyl-CoA dehydrogenase 0.9584 115 205 GO:0005886
GO:0016627
AF-A0A371PXN5-F1-model_v4 Acyl-CoA oxidase/dehydrogenase middle domain-containing protein 0.9516 128 208 GO:0005886
GO:0016627

Map