F473921
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 668 | 278 | 1336 | 380 |
Family's Representative Sequence
| Representative Sequence | 3300009177|Ga0105248_10413668|Ga0105248_104136682 |
| Length | 412 |
| Sequence | MRMNPPLSDPVRHAWNGRGGRSRINSVDLRDTPDEEQFRSELKAWLDANLPDELKGHRGGAARFSDSAIRNWSGTLYDAGYIGLTWPKEYGGGGKPYSYQAIFLEEMARAEAPPHLGVIGLGMAGPTIIACGTEAQKARYLQPLLSAHEIWCQGFSEPGAGSDLSAVRTSARLEDGHFVVDGQKVWSSYAHIADWCILLTRSDPDSERHAGLTYLIVDMRAPGVEVRPLRQITGEAEFNEIFFSGVEVPVENVVGDVGGGWQVAMTTLLHERGTLGFALVAALEVMVGKLIELARDRGATPLQRDAIAQEWMELQGLRYTAYRSLSALMKTGIPGPEGSILKQQWSEAAQRLTKLALELLGPDAQLLGENAPYGGYWQHMQLRSRGNTIEAGTSEILRNIIAERVLGLPRSR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 2 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 6 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 36 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 37 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 38 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 39 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 40 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 41 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 42 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 43 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 44 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 45 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 46 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 47 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 48 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 49 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 50 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 51 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 52 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 53 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 74 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 75 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 108 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 110 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 111 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 112 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 113 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 114 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 115 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 116 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 117 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 118 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 119 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 120 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 121 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 122 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 123 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 124 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 125 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 126 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 127 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 128 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 129 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 130 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 131 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 132 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 133 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 134 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 135 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 136 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 137 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 138 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 139 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 140 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 141 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 142 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 143 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 144 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 145 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 146 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 147 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 148 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 149 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 150 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 151 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 152 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 153 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 154 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 155 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 156 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 157 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 158 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 159 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 160 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 161 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 162 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 163 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 164 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 165 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 166 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 167 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 168 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 169 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 170 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 171 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 172 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 173 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 174 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 213 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 214 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 215 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 216 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 217 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 218 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 219 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 220 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 221 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 222 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 223 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 224 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 225 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 226 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 227 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 228 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 230 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 231 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 232 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 233 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 234 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 235 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 236 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 237 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 238 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 240 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 241 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 242 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 243 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 244 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 245 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 248 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 251 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 252 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 254 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 255 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 256 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 261 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 262 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 263 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 264 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 265 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 266 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 267 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 268 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 269 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 270 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 276 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 278 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.7 |
| Metatranscriptomes | 0.3 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.75 |
| Nodule | 0 |
| Rhizoplane | 11.08 |
| Rhizosphere | 87.72 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0105248_10413668 | 3300009177 | Bacteria | 1518 |
| 2 | JGI25407J50210_10013488 | 3300003373 | Bacteria | 2101 |
| 3 | Ga0070658_10042261 | 3300005327 | Bacteria | 3681 |
| 4 | Ga0070658_10154108 | 3300005327 | Bacteria | 1925 |
| 5 | Ga0070670_100180665 | 3300005331 | Bacteria | 1832 |
| 6 | Ga0070680_100021911 | 3300005336 | Bacteria | 5081 |
| 7 | Ga0070680_100065961 | 3300005336 | Bacteria | 2967 |
| 8 | Ga0070680_100079043 | 3300005336 | Bacteria | 2711 |
| 9 | Ga0070682_100049452 | 3300005337 | Bacteria | 2621 |
| 10 | Ga0068868_100039855 | 3300005338 | Bacteria | 3653 |
| 11 | Ga0070660_100000819 | 3300005339 | Bacteria | 20620 |
| 12 | Ga0070660_100010792 | 3300005339 | Bacteria | 6466 |
| 13 | Ga0070660_100017814 | 3300005339 | Bacteria | 5181 |
| 14 | Ga0070660_100056966 | 3300005339 | Bacteria | 3025 |
| 15 | Ga0070660_100127123 | 3300005339 | Bacteria | 2037 |
| 16 | Ga0070689_100014722 | 3300005340 | Bacteria | 5689 |
| 17 | Ga0070661_100049212 | 3300005344 | Bacteria | 3085 |
| 18 | Ga0070661_100075497 | 3300005344 | Bacteria | 2483 |
| 19 | Ga0070661_100119015 | 3300005344 | Bacteria | 1977 |
| 20 | Ga0070692_10029036 | 3300005345 | Bacteria | 2755 |
| 21 | Ga0070668_100042803 | 3300005347 | Bacteria | 3471 |
| 22 | Ga0070675_100072593 | 3300005354 | Bacteria | 2857 |
| 23 | Ga0070675_100083731 | 3300005354 | Bacteria | 2663 |
| 24 | Ga0070674_100095256 | 3300005356 | Bacteria | 2158 |
| 25 | Ga0070673_100187048 | 3300005364 | Bacteria | 1776 |
| 26 | Ga0070714_100134906 | 3300005435 | Bacteria | 2209 |
| 27 | Ga0070714_100198495 | 3300005435 | Bacteria | 1834 |
| 28 | Ga0070714_100235718 | 3300005435 | Bacteria | 1687 |
| 29 | Ga0070701_10007113 | 3300005438 | Bacteria | 4754 |
| 30 | Ga0070711_100141808 | 3300005439 | Bacteria | 1803 |
| 31 | Ga0070694_100099885 | 3300005444 | Bacteria | 2051 |
| 32 | Ga0070708_100057681 | 3300005445 | Bacteria | 3458 |
| 33 | Ga0070708_100109458 | 3300005445 | Bacteria | 2538 |
| 34 | Ga0070663_100020364 | 3300005455 | Bacteria | 4391 |
| 35 | Ga0070662_100018182 | 3300005457 | Bacteria | 4750 |
| 36 | Ga0070662_100061948 | 3300005457 | Bacteria | 2732 |
| 37 | Ga0070681_10000818 | 3300005458 | Bacteria | 25982 |
| 38 | Ga0070681_10002075 | 3300005458 | Bacteria | 18192 |
| 39 | Ga0070681_10017507 | 3300005458 | Bacteria | 7163 |
| 40 | Ga0070681_10040047 | 3300005458 | Bacteria | 4698 |
| 41 | Ga0070685_10040143 | 3300005466 | Bacteria | 2662 |
| 42 | Ga0070706_100001869 | 3300005467 | Bacteria | 21738 |
| 43 | Ga0070706_100003808 | 3300005467 | Bacteria | 14735 |
| 44 | Ga0070706_100004945 | 3300005467 | Bacteria | 12758 |
| 45 | Ga0070706_100005263 | 3300005467 | Bacteria | 12345 |
| 46 | Ga0070706_100093191 | 3300005467 | Bacteria | 2795 |
| 47 | Ga0070706_100209487 | 3300005467 | Bacteria | 1820 |
| 48 | Ga0070707_100029065 | 3300005468 | Bacteria | 5262 |
| 49 | Ga0070707_100073242 | 3300005468 | Bacteria | 3302 |
| 50 | Ga0070707_100129187 | 3300005468 | Bacteria | 2456 |
| 51 | Ga0070698_100001821 | 3300005471 | Bacteria | 23719 |
| 52 | Ga0070698_100003055 | 3300005471 | Bacteria | 18451 |
| 53 | Ga0070698_100008490 | 3300005471 | Bacteria | 11095 |
| 54 | Ga0070698_100011112 | 3300005471 | Bacteria | 9567 |
| 55 | Ga0070698_100013592 | 3300005471 | Bacteria | 8618 |
| 56 | Ga0070698_100195821 | 3300005471 | Bacteria | 1958 |
| 57 | Ga0070699_100080550 | 3300005518 | Bacteria | 2838 |
| 58 | Ga0070699_100236479 | 3300005518 | Bacteria | 1629 |
| 59 | Ga0070699_100415309 | 3300005518 | Bacteria | 1218 |
| 60 | Ga0070679_100028811 | 3300005530 | Bacteria | 5477 |
| 61 | Ga0070679_100110003 | 3300005530 | Bacteria | 2742 |
| 62 | Ga0070697_100059796 | 3300005536 | Bacteria | 3104 |
| 63 | Ga0070697_100101473 | 3300005536 | Bacteria | 2391 |
| 64 | Ga0070672_100009638 | 3300005543 | Bacteria | 6666 |
| 65 | Ga0070672_100033028 | 3300005543 | Bacteria | 3914 |
| 66 | Ga0070693_100030067 | 3300005547 | Bacteria | 2967 |
| 67 | Ga0070665_100075015 | 3300005548 | Bacteria | 3388 |
| 68 | Ga0070704_100022510 | 3300005549 | Bacteria | 4102 |
| 69 | Ga0068855_100056886 | 3300005563 | Bacteria | 4586 |
| 70 | Ga0068855_100088902 | 3300005563 | Bacteria | 3567 |
| 71 | Ga0068855_100192746 | 3300005563 | Bacteria | 2298 |
| 72 | Ga0068852_100059311 | 3300005616 | Bacteria | 3318 |
| 73 | Ga0068860_100051084 | 3300005843 | Bacteria | 3934 |
| 74 | Ga0081455_10003327 | 3300005937 | Bacteria | 18552 |
| 75 | Ga0081455_10006995 | 3300005937 | Bacteria | 11986 |
| 76 | Ga0081455_10021239 | 3300005937 | Bacteria | 6093 |
| 77 | Ga0081455_10022832 | 3300005937 | Bacteria | 5834 |
| 78 | Ga0081455_10059128 | 3300005937 | Bacteria | 3238 |
| 79 | Ga0081455_10131773 | 3300005937 | Bacteria | 1954 |
| 80 | Ga0081455_10146791 | 3300005937 | Bacteria | 1824 |
| 81 | Ga0081455_10157153 | 3300005937 | Bacteria | 1746 |
| 82 | Ga0081538_10000195 | 3300005981 | Bacteria | 66942 |
| 83 | Ga0081538_10037799 | 3300005981 | Bacteria | 3124 |
| 84 | Ga0081538_10070943 | 3300005981 | Bacteria | 1920 |
| 85 | Ga0081539_10000973 | 3300005985 | Bacteria | 53526 |
| 86 | Ga0081539_10008764 | 3300005985 | Bacteria | 8681 |
| 87 | Ga0075365_10013300 | 3300006038 | Bacteria | 4915 |
| 88 | Ga0075365_10190486 | 3300006038 | Bacteria | 1435 |
| 89 | Ga0075364_10057798 | 3300006051 | Bacteria | 2541 |
| 90 | Ga0075432_10002179 | 3300006058 | Bacteria | 6517 |
| 91 | Ga0075432_10039091 | 3300006058 | Bacteria | 1654 |
| 92 | Ga0075428_100002450 | 3300006844 | Bacteria | 20164 |
| 93 | Ga0075428_100191844 | 3300006844 | Bacteria | 2210 |
| 94 | Ga0075430_100129619 | 3300006846 | Bacteria | 2102 |
| 95 | Ga0075431_100079083 | 3300006847 | Bacteria | 3395 |
| 96 | Ga0075433_10048678 | 3300006852 | Bacteria | 3687 |
| 97 | Ga0075433_10149481 | 3300006852 | Bacteria | 2077 |
| 98 | Ga0075434_100128254 | 3300006871 | Bacteria | 2554 |
| 99 | Ga0075429_100076447 | 3300006880 | Bacteria | 2916 |
| 100 | Ga0068865_100045520 | 3300006881 | Bacteria | 3008 |
| 101 | Ga0068865_100065593 | 3300006881 | Bacteria | 2559 |
| 102 | Ga0068865_100125017 | 3300006881 | Bacteria | 1918 |
| 103 | Ga0075436_100048061 | 3300006914 | Bacteria | 2944 |
| 104 | Ga0075436_100049246 | 3300006914 | Bacteria | 2907 |
| 105 | Ga0075435_100096578 | 3300007076 | Bacteria | 2444 |
| 106 | Ga0105244_10065749 | 3300009036 | Bacteria | 1816 |
| 107 | Ga0111539_10036099 | 3300009094 | Bacteria | 5979 |
| 108 | Ga0111539_10062191 | 3300009094 | Bacteria | 4420 |
| 109 | Ga0111539_10067444 | 3300009094 | Bacteria | 4225 |
| 110 | Ga0111539_10229441 | 3300009094 | Bacteria | 2162 |
| 111 | Ga0111539_10247175 | 3300009094 | Bacteria | 2077 |
| 112 | Ga0105245_10024883 | 3300009098 | Bacteria | 5262 |
| 113 | Ga0105245_10030680 | 3300009098 | Bacteria | 4754 |
| 114 | Ga0105247_10040212 | 3300009101 | Bacteria | 2857 |
| 115 | Ga0114129_10408864 | 3300009147 | Bacteria | 1787 |
| 116 | Ga0114129_10501671 | 3300009147 | Bacteria | 1585 |
| 117 | Ga0105243_10051860 | 3300009148 | Bacteria | 3246 |
| 118 | Ga0105243_10092111 | 3300009148 | Bacteria | 2498 |
| 119 | Ga0105242_10034320 | 3300009176 | Bacteria | 4066 |
| 120 | Ga0105242_10060368 | 3300009176 | Bacteria | 3115 |
| 121 | Ga0105248_10080633 | 3300009177 | Bacteria | 3658 |
| 122 | Ga0105248_10120907 | 3300009177 | Bacteria | 2954 |
| 123 | Ga0105248_10248154 | 3300009177 | Bacteria | 2004 |
| 124 | Ga0105237_10064403 | 3300009545 | Bacteria | 3662 |
| 125 | Ga0105238_10028168 | 3300009551 | Bacteria | 5723 |
| 126 | Ga0105249_10145438 | 3300009553 | Bacteria | 2277 |
| 127 | Ga0105239_10042005 | 3300010375 | Bacteria | 5009 |
| 128 | Ga0105239_10140002 | 3300010375 | Bacteria | 2696 |
| 129 | Ga0105239_10221047 | 3300010375 | Bacteria | 2124 |
| 130 | Ga0157371_10128215 | 3300013102 | Bacteria | 1804 |
| 131 | Ga0157371_10186517 | 3300013102 | Bacteria | 1484 |
| 132 | Ga0157370_10006933 | 3300013104 | Bacteria | 12382 |
| 133 | Ga0157369_10001003 | 3300013105 | Bacteria | 35669 |
| 134 | Ga0157374_10047472 | 3300013296 | Bacteria | 3982 |
| 135 | Ga0157374_10116535 | 3300013296 | Bacteria | 2574 |
| 136 | Ga0157374_10162809 | 3300013296 | Bacteria | 2173 |
| 137 | Ga0157372_10031033 | 3300013307 | Bacteria | 5849 |
| 138 | Ga0157372_10091948 | 3300013307 | Bacteria | 3451 |
| 139 | Ga0157372_10141611 | 3300013307 | Bacteria | 2771 |
| 140 | Ga0157372_10258138 | 3300013307 | Bacteria | 2023 |
| 141 | Ga0157375_10010053 | 3300013308 | Bacteria | 8319 |
| 142 | Ga0157375_10033375 | 3300013308 | Bacteria | 4890 |
| 143 | Ga0157375_10040593 | 3300013308 | Bacteria | 4487 |
| 144 | Ga0157375_10045570 | 3300013308 | Bacteria | 4269 |
| 145 | Ga0157375_10297199 | 3300013308 | Bacteria | 1778 |
| 146 | Ga0157380_10019372 | 3300014326 | Bacteria | 5070 |
| 147 | Ga0157377_10160446 | 3300014745 | Bacteria | 1398 |
| 148 | Ga0157379_10169388 | 3300014968 | Bacteria | 1971 |
| 149 | Ga0206356_11828667 | 3300020070 | Bacteria | 3635 |
| 150 | Ga0206353_10130899 | 3300020082 | Bacteria | 8536 |
| 151 | Ga0207653_10055321 | 3300025885 | Bacteria | 1328 |
| 152 | Ga0207643_10012190 | 3300025908 | Bacteria | 4648 |
| 153 | Ga0207705_10133034 | 3300025909 | Bacteria | 1852 |
| 154 | Ga0207684_10000137 | 3300025910 | Bacteria | 132561 |
| 155 | Ga0207684_10000289 | 3300025910 | Bacteria | 72104 |
| 156 | Ga0207684_10004500 | 3300025910 | Bacteria | 13106 |
| 157 | Ga0207684_10019297 | 3300025910 | Bacteria | 5832 |
| 158 | Ga0207707_10010499 | 3300025912 | Bacteria | 8038 |
| 159 | Ga0207707_10012886 | 3300025912 | Bacteria | 7277 |
| 160 | Ga0207707_10032544 | 3300025912 | Bacteria | 4564 |
| 161 | Ga0207707_10093932 | 3300025912 | Bacteria | 2620 |
| 162 | Ga0207695_10216916 | 3300025913 | Bacteria | 1822 |
| 163 | Ga0207693_10027392 | 3300025915 | Bacteria | 4506 |
| 164 | Ga0207663_10069088 | 3300025916 | Bacteria | 2271 |
| 165 | Ga0207660_10012383 | 3300025917 | Bacteria | 5580 |
| 166 | Ga0207660_10023914 | 3300025917 | Bacteria | 4131 |
| 167 | Ga0207660_10076279 | 3300025917 | Bacteria | 2451 |
| 168 | Ga0207657_10001876 | 3300025919 | Bacteria | 22733 |
| 169 | Ga0207657_10010396 | 3300025919 | Bacteria | 9289 |
| 170 | Ga0207657_10030401 | 3300025919 | Bacteria | 4902 |
| 171 | Ga0207657_10030447 | 3300025919 | Bacteria | 4898 |
| 172 | Ga0207657_10056602 | 3300025919 | Bacteria | 3382 |
| 173 | Ga0207657_10085245 | 3300025919 | Bacteria | 2646 |
| 174 | Ga0207657_10192613 | 3300025919 | Bacteria | 1644 |
| 175 | Ga0207652_10024169 | 3300025921 | Bacteria | 5040 |
| 176 | Ga0207652_10031973 | 3300025921 | Bacteria | 4420 |
| 177 | Ga0207652_10041086 | 3300025921 | Bacteria | 3930 |
| 178 | Ga0207652_10100256 | 3300025921 | Bacteria | 2557 |
| 179 | Ga0207652_10106120 | 3300025921 | Bacteria | 2486 |
| 180 | Ga0207646_10000665 | 3300025922 | Bacteria | 44568 |
| 181 | Ga0207646_10003063 | 3300025922 | Bacteria | 19239 |
| 182 | Ga0207646_10048754 | 3300025922 | Bacteria | 3795 |
| 183 | Ga0207694_10097942 | 3300025924 | Bacteria | 2321 |
| 184 | Ga0207687_10034003 | 3300025927 | Bacteria | 3460 |
| 185 | Ga0207664_10032707 | 3300025929 | Bacteria | 3989 |
| 186 | Ga0207664_10120910 | 3300025929 | Bacteria | 2191 |
| 187 | Ga0207690_10138132 | 3300025932 | Bacteria | 1792 |
| 188 | Ga0207706_10004470 | 3300025933 | Bacteria | 13131 |
| 189 | Ga0207706_10068537 | 3300025933 | Bacteria | 3121 |
| 190 | Ga0207686_10079672 | 3300025934 | Bacteria | 2133 |
| 191 | Ga0207686_10121562 | 3300025934 | Bacteria | 1778 |
| 192 | Ga0207709_10155036 | 3300025935 | Bacteria | 1591 |
| 193 | Ga0207704_10019928 | 3300025938 | Bacteria | 3536 |
| 194 | Ga0207691_10010949 | 3300025940 | Bacteria | 8705 |
| 195 | Ga0207691_10047893 | 3300025940 | Bacteria | 3920 |
| 196 | Ga0207691_10149037 | 3300025940 | Bacteria | 2058 |
| 197 | Ga0207661_10010994 | 3300025944 | Bacteria | 6539 |
| 198 | Ga0207661_10029560 | 3300025944 | Bacteria | 4210 |
| 199 | Ga0207661_10137335 | 3300025944 | Bacteria | 2101 |
| 200 | Ga0207661_10187105 | 3300025944 | Bacteria | 1813 |
| 201 | Ga0207661_10246593 | 3300025944 | Bacteria | 1586 |
| 202 | Ga0207679_10024866 | 3300025945 | Bacteria | 4111 |
| 203 | Ga0207679_10162487 | 3300025945 | Bacteria | 1830 |
| 204 | Ga0207667_10271257 | 3300025949 | Bacteria | 1734 |
| 205 | Ga0207712_10297077 | 3300025961 | Bacteria | 1324 |
| 206 | Ga0207640_10086523 | 3300025981 | Bacteria | 2158 |
| 207 | Ga0207678_10137567 | 3300026067 | Bacteria | 2084 |
| 208 | Ga0207708_10132650 | 3300026075 | Bacteria | 1948 |
| 209 | Ga0207674_10024285 | 3300026116 | Bacteria | 6480 |
| 210 | Ga0207674_10072447 | 3300026116 | Bacteria | 3461 |
| 211 | Ga0207675_100010838 | 3300026118 | Bacteria | 8541 |
| 212 | Ga0207675_100057667 | 3300026118 | Bacteria | 3623 |
| 213 | Ga0207683_10009335 | 3300026121 | Bacteria | 8356 |
| 214 | Ga0207698_10122976 | 3300026142 | Bacteria | 2200 |
| 215 | Ga0207698_10165291 | 3300026142 | Bacteria | 1941 |
| 216 | Ga0207428_10000431 | 3300027907 | Bacteria | 51701 |
| 217 | Ga0207428_10025292 | 3300027907 | Bacteria | 4969 |
| 218 | Ga0207428_10106494 | 3300027907 | Bacteria | 2161 |
| 219 | Ga0268264_10032711 | 3300028381 | Bacteria | 4268 |
| 220 | Ga0265319_1005442 | 3300028563 | Bacteria | 6088 |
| 221 | Ga0265319_1008616 | 3300028563 | Bacteria | 4446 |
| 222 | Ga0265319_1011220 | 3300028563 | Bacteria | 3683 |
| 223 | Ga0265334_10000884 | 3300028573 | Bacteria | 14971 |
| 224 | Ga0265334_10027204 | 3300028573 | Bacteria | 2305 |
| 225 | Ga0265318_10000561 | 3300028577 | Bacteria | 26198 |
| 226 | Ga0265318_10011745 | 3300028577 | Bacteria | 3753 |
| 227 | Ga0265318_10059030 | 3300028577 | Bacteria | 1431 |
| 228 | Ga0265322_10006466 | 3300028654 | Bacteria | 3450 |
| 229 | Ga0265338_10009928 | 3300028800 | Bacteria | 11254 |
| 230 | Ga0265338_10016638 | 3300028800 | Bacteria | 7978 |
| 231 | Ga0265338_10045778 | 3300028800 | Bacteria | 4018 |
| 232 | Ga0265338_10200415 | 3300028800 | Bacteria | 1505 |
| 233 | Ga0265332_10044208 | 3300031238 | Bacteria | 1921 |
| 234 | Ga0265328_10000876 | 3300031239 | Bacteria | 13921 |
| 235 | Ga0265320_10038679 | 3300031240 | Bacteria | 2391 |
| 236 | Ga0265325_10002855 | 3300031241 | Bacteria | 11521 |
| 237 | Ga0265329_10027508 | 3300031242 | Bacteria | 1868 |
| 238 | Ga0265329_10030733 | 3300031242 | Bacteria | 1748 |
| 239 | Ga0265340_10046703 | 3300031247 | Bacteria | 2111 |
| 240 | Ga0265340_10088295 | 3300031247 | Bacteria | 1452 |
| 241 | Ga0265339_10055967 | 3300031249 | Bacteria | 2137 |
| 242 | Ga0265327_10000014 | 3300031251 | Bacteria | 506288 |
| 243 | Ga0265327_10012029 | 3300031251 | Bacteria | 5884 |
| 244 | Ga0265316_10009520 | 3300031344 | Bacteria | 8943 |
| 245 | Ga0265316_10027194 | 3300031344 | Bacteria | 4741 |
| 246 | Ga0265313_10002358 | 3300031595 | Bacteria | 16470 |
| 247 | Ga0265314_10003852 | 3300031711 | Bacteria | 14305 |
| 248 | Ga0265314_10008195 | 3300031711 | Bacteria | 8985 |
| 249 | Ga0265342_10018395 | 3300031712 | Bacteria | 4528 |
| 250 | Ga0307406_10131836 | 3300031901 | Bacteria | 1756 |
| 251 | Ga0307406_10134487 | 3300031901 | Bacteria | 1740 |
| 252 | Ga0307416_100161270 | 3300032002 | Bacteria | 2073 |
| 253 | Ga0307415_100180915 | 3300032126 | Bacteria | 1654 |
| 254 | Ga0373944_0037754 | 3300035089 | Bacteria | 1481 |
| 255 | Ga0373949_0012154 | 3300035090 | Bacteria | 1901 |
| 256 | Ga0373956_0060057 | 3300035119 | Bacteria | 1721 |
| 257 | Ga0373943_0001869 | 3300035170 | Bacteria | 9519 |
| 258 | Ga0373943_0002003 | 3300035170 | Bacteria | 9228 |
| 259 | Ga0373946_0006469 | 3300035171 | Bacteria | 4247 |
| 260 | Ga0373955_0116672 | 3300035172 | Bacteria | 1548 |
| 261 | Ga0373961_0010445 | 3300035241 | Bacteria | 2288 |
| 262 | Ga0373935_0093176 | 3300035692 | Bacteria | 1975 |
| 263 | Ga0373927_0041300 | 3300035695 | Bacteria | 2992 |
| 264 | Ga0373933_0016032 | 3300035724 | Bacteria | 4186 |
| 265 | Ga0373947_0000658 | 3300035725 | Bacteria | 20469 |
| 266 | Ga0373947_0010442 | 3300035725 | Bacteria | 5329 |
| 267 | Ga0373925_0006545 | 3300037068 | Bacteria | 8566 |
| 268 | Ga0373925_0013616 | 3300037068 | Bacteria | 5890 |
| 269 | Ga0395899_0005121 | 3300037312 | Bacteria | 10201 |
| 270 | Ga0395899_0005857 | 3300037312 | Bacteria | 9540 |
| 271 | Ga0395899_0008984 | 3300037312 | Bacteria | 7685 |
| 272 | Ga0395899_0030078 | 3300037312 | Bacteria | 4086 |
| 273 | Ga0395899_0048992 | 3300037312 | Bacteria | 3141 |
| 274 | Ga0395900_0001698 | 3300037418 | Bacteria | 25566 |
| 275 | Ga0395900_0001815 | 3300037418 | Bacteria | 24440 |
| 276 | Ga0395900_0038976 | 3300037418 | Bacteria | 4898 |
| 277 | Ga0395900_0045966 | 3300037418 | Bacteria | 4497 |
| 278 | Ga0395900_0055873 | 3300037418 | Bacteria | 4064 |
| 279 | Ga0395900_0075457 | 3300037418 | Bacteria | 3466 |
| 280 | Ga0395900_0206324 | 3300037418 | Bacteria | 1986 |
| 281 | Ga0395900_0229053 | 3300037418 | Bacteria | 1870 |
| 282 | Ga0395900_0544117 | 3300037418 | Bacteria | 1106 |
| 283 | Ga0395898_0006446 | 3300037466 | Bacteria | 12539 |
| 284 | Ga0395898_0009510 | 3300037466 | Bacteria | 10203 |
| 285 | Ga0395898_0015449 | 3300037466 | Bacteria | 7829 |
| 286 | Ga0395898_0016345 | 3300037466 | Bacteria | 7594 |
| 287 | Ga0395898_0034799 | 3300037466 | Bacteria | 5014 |
| 288 | Ga0395898_0042119 | 3300037466 | Bacteria | 4507 |
| 289 | Ga0395898_0211632 | 3300037466 | Bacteria | 1849 |
| 290 | Ga0395898_0212570 | 3300037466 | Bacteria | 1845 |
| 291 | Ga0395898_0217643 | 3300037466 | Bacteria | 1822 |
| 292 | Ga0395898_0414777 | 3300037466 | Bacteria | 1283 |
| 293 | Ga0395905_0006116 | 3300037471 | Bacteria | 12159 |
| 294 | Ga0395905_0017788 | 3300037471 | Bacteria | 6752 |
| 295 | Ga0395905_0022493 | 3300037471 | Bacteria | 5962 |
| 296 | Ga0395905_0033088 | 3300037471 | Bacteria | 4860 |
| 297 | Ga0395905_0042113 | 3300037471 | Bacteria | 4284 |
| 298 | Ga0395905_0100334 | 3300037471 | Bacteria | 2718 |
| 299 | Ga0395905_0142045 | 3300037471 | Bacteria | 2258 |
| 300 | Ga0395905_0151268 | 3300037471 | Bacteria | 2183 |
| 301 | Ga0395905_0153526 | 3300037471 | Bacteria | 2166 |
| 302 | Ga0395905_0234491 | 3300037471 | Bacteria | 1715 |
| 303 | Ga0395901_0005917 | 3300038443 | Bacteria | 12387 |
| 304 | Ga0395901_0009486 | 3300038443 | Bacteria | 9872 |
| 305 | Ga0395901_0016276 | 3300038443 | Bacteria | 7574 |
| 306 | Ga0395901_0018544 | 3300038443 | Bacteria | 7104 |
| 307 | Ga0395901_0028173 | 3300038443 | Bacteria | 5778 |
| 308 | Ga0395901_0056796 | 3300038443 | Bacteria | 4072 |
| 309 | Ga0395901_0152151 | 3300038443 | Bacteria | 2431 |
| 310 | Ga0395901_0200729 | 3300038443 | Bacteria | 2090 |
| 311 | Ga0395901_0274153 | 3300038443 | Bacteria | 1754 |
| 312 | Ga0395901_0472476 | 3300038443 | Bacteria | 1280 |
| 313 | Ga0436365_0212877 | 3300039437 | Bacteria | 2943 |
| 314 | Ga0439436_0022153 | 3300041404 | Bacteria | 1883 |
| 315 | Ga0439439_0006996 | 3300041406 | Bacteria | 2626 |
| 316 | Ga0439453_0005787 | 3300041408 | Bacteria | 1899 |
| 317 | Ga0451789_0293741 | 3300041443 | Bacteria | 2258 |
| 318 | Ga0451793_1848829 | 3300041452 | Bacteria | 2121 |
| 319 | Ga0451795_0352695 | 3300041456 | Bacteria | 1680 |
| 320 | Ga0451807_0428708 | 3300041486 | Bacteria | 1650 |
| 321 | Ga0451833_0581219 | 3300041491 | Bacteria | 1833 |
| 322 | Ga0451839_1645058 | 3300041496 | Bacteria | 1429 |
| 323 | Ga0439433_0003631 | 3300041999 | Bacteria | 3319 |
| 324 | Ga0439454_000700 | 3300042011 | Bacteria | 2845 |
| 325 | Ga0450920_016532 | 3300042122 | Bacteria | 1407 |
| 326 | Ga0450888_006539 | 3300042126 | Bacteria | 1270 |
| 327 | Ga0450906_012724 | 3300042145 | Bacteria | 1557 |
| 328 | Ga0439446_0002889 | 3300042156 | Bacteria | 4190 |
| 329 | Ga0439434_0017512 | 3300042435 | Bacteria | 2144 |
| 330 | Ga0439460_0039901 | 3300042461 | Bacteria | 1374 |
| 331 | Ga0439460_0073464 | 3300042461 | Bacteria | 1063 |
| 332 | Ga0466969_0018025 | 3300044656 | Bacteria | 3683 |
| 333 | Ga0466961_0017989 | 3300044693 | Bacteria | 4544 |
| 334 | Ga0466963_0002900 | 3300044694 | Bacteria | 9681 |
| 335 | Ga0466963_0003298 | 3300044694 | Bacteria | 9204 |
| 336 | Ga0466963_0010394 | 3300044694 | Bacteria | 5634 |
| 337 | Ga0466964_0003519 | 3300044706 | Bacteria | 5721 |
| 338 | Ga0466964_0039992 | 3300044706 | Bacteria | 1892 |
| 339 | Ga0466971_0008682 | 3300044719 | Bacteria | 4432 |
| 340 | Ga0466968_0095951 | 3300044735 | Bacteria | 1320 |
| 341 | Ga0466957_0048811 | 3300044842 | Bacteria | 2572 |
| 342 | Ga0466959_0050185 | 3300045049 | Bacteria | 3063 |
| 343 | Ga0466958_0007000 | 3300045836 | Bacteria | 6168 |
| 344 | Ga0466958_0054203 | 3300045836 | Bacteria | 2432 |
| 345 | Ga0466967_0010673 | 3300045976 | Bacteria | 6906 |
| 346 | Ga0466967_0042111 | 3300045976 | Bacteria | 3944 |
| 347 | Ga0466967_0150238 | 3300045976 | Bacteria | 2176 |
| 348 | Ga0466967_0158001 | 3300045976 | Bacteria | 2126 |
| 349 | Ga0466967_0195674 | 3300045976 | Bacteria | 1912 |
| 350 | Ga0466967_0286551 | 3300045976 | Bacteria | 1581 |
| 351 | Ga0495592_0054410 | 3300046454 | Bacteria | 2965 |
| 352 | Ga0495603_0002169 | 3300046455 | Bacteria | 11549 |
| 353 | Ga0495603_0067572 | 3300046455 | Bacteria | 2104 |
| 354 | Ga0495629_0000159 | 3300046459 | Bacteria | 59616 |
| 355 | Ga0495629_0067188 | 3300046459 | Bacteria | 2502 |
| 356 | Ga0495629_0167429 | 3300046459 | Bacteria | 1526 |
| 357 | Ga0495641_0003425 | 3300046461 | Bacteria | 11883 |
| 358 | Ga0495651_0014719 | 3300046462 | Bacteria | 6049 |
| 359 | Ga0495653_0047507 | 3300046463 | Bacteria | 3319 |
| 360 | Ga0495653_0086235 | 3300046463 | Bacteria | 2308 |
| 361 | Ga0495580_0104775 | 3300046472 | Bacteria | 1966 |
| 362 | Ga0495582_0000183 | 3300046473 | Bacteria | 34098 |
| 363 | Ga0495582_0024372 | 3300046473 | Bacteria | 3310 |
| 364 | Ga0495639_0004941 | 3300046475 | Bacteria | 5715 |
| 365 | Ga0495662_0000220 | 3300046476 | Bacteria | 23891 |
| 366 | Ga0495596_0019243 | 3300046500 | Bacteria | 2807 |
| 367 | Ga0495596_0049810 | 3300046500 | Bacteria | 1642 |
| 368 | Ga0495618_0045419 | 3300046514 | Bacteria | 2771 |
| 369 | Ga0495618_0112058 | 3300046514 | Bacteria | 1747 |
| 370 | Ga0495630_0004113 | 3300046517 | Bacteria | 10186 |
| 371 | Ga0495630_0005932 | 3300046517 | Bacteria | 8638 |
| 372 | Ga0495630_0017737 | 3300046517 | Bacteria | 5220 |
| 373 | Ga0495630_0133971 | 3300046517 | Bacteria | 1882 |
| 374 | Ga0495644_0072649 | 3300046523 | Bacteria | 1294 |
| 375 | Ga0495666_0030129 | 3300046526 | Bacteria | 2665 |
| 376 | Ga0495665_0003082 | 3300046531 | Bacteria | 9020 |
| 377 | Ga0495640_0057771 | 3300046533 | Bacteria | 2647 |
| 378 | Ga0495640_0072749 | 3300046533 | Bacteria | 2302 |
| 379 | Ga0495640_0073356 | 3300046533 | Bacteria | 2291 |
| 380 | Ga0495587_0022855 | 3300046536 | Bacteria | 3847 |
| 381 | Ga0495587_0079257 | 3300046536 | Bacteria | 1905 |
| 382 | Ga0495645_0041657 | 3300046543 | Bacteria | 3349 |
| 383 | Ga0495667_0128070 | 3300046559 | Bacteria | 1637 |
| 384 | Ga0495634_0006252 | 3300046642 | Bacteria | 9068 |
| 385 | Ga0495634_0164727 | 3300046642 | Bacteria | 1396 |
| 386 | Ga0495635_0049850 | 3300046663 | Bacteria | 2886 |
| 387 | Ga0495635_0070804 | 3300046663 | Bacteria | 2390 |
| 388 | Ga0495635_0075561 | 3300046663 | Bacteria | 2308 |
| 389 | Ga0495588_0011111 | 3300046674 | Bacteria | 4215 |
| 390 | Ga0495657_0031896 | 3300046675 | Bacteria | 3680 |
| 391 | Ga0495657_0095155 | 3300046675 | Bacteria | 1904 |
| 392 | Ga0495599_0113359 | 3300046678 | Bacteria | 1688 |
| 393 | Ga0495623_0017587 | 3300046679 | Bacteria | 4616 |
| 394 | Ga0495646_0034846 | 3300046680 | Bacteria | 3124 |
| 395 | Ga0495646_0102532 | 3300046680 | Bacteria | 1639 |
| 396 | Ga0495658_0003714 | 3300046683 | Bacteria | 7549 |
| 397 | Ga0495658_0068665 | 3300046683 | Bacteria | 2053 |
| 398 | Ga0495613_0001702 | 3300046689 | Bacteria | 16745 |
| 399 | Ga0495613_0016817 | 3300046689 | Bacteria | 5447 |
| 400 | Ga0495671_0074955 | 3300046692 | Bacteria | 1660 |
| 401 | Ga0495600_0022984 | 3300046809 | Bacteria | 4009 |
| 402 | Ga0495600_0062832 | 3300046809 | Bacteria | 2426 |
| 403 | Ga0495581_0002281 | 3300047315 | Bacteria | 10800 |
| 404 | Ga0495604_0021242 | 3300047317 | Bacteria | 5182 |
| 405 | Ga0495674_0003066 | 3300047319 | Bacteria | 16232 |
| 406 | Ga0495674_0059473 | 3300047319 | Bacteria | 3337 |
| 407 | Ga0495676_0008530 | 3300047321 | Bacteria | 9392 |
| 408 | Ga0495676_0151278 | 3300047321 | Bacteria | 1651 |
| 409 | Ga0495676_0152149 | 3300047321 | Bacteria | 1645 |
| 410 | Ga0495680_0004997 | 3300047322 | Bacteria | 12543 |
| 411 | Ga0495680_0015775 | 3300047322 | Bacteria | 6505 |
| 412 | Ga0495680_0020576 | 3300047322 | Bacteria | 5546 |
| 413 | Ga0495680_0104439 | 3300047322 | Bacteria | 2108 |
| 414 | Ga0495593_0004600 | 3300047673 | Bacteria | 8205 |
| 415 | Ga0495602_0016803 | 3300048088 | Bacteria | 7345 |
| 416 | Ga0496100_0003593 | 3300048903 | Bacteria | 8103 |
| 417 | Ga0496100_0018347 | 3300048903 | Bacteria | 4149 |
| 418 | Ga0496100_0031095 | 3300048903 | Bacteria | 3316 |
| 419 | Ga0496100_0043960 | 3300048903 | Bacteria | 2859 |
| 420 | Ga0496100_0065446 | 3300048903 | Bacteria | 2408 |
| 421 | Ga0496100_0320661 | 3300048903 | Bacteria | 1164 |
| 422 | Ga0496101_0003566 | 3300048904 | Bacteria | 9708 |
| 423 | Ga0496101_0007288 | 3300048904 | Bacteria | 7156 |
| 424 | Ga0496101_0045230 | 3300048904 | Bacteria | 3152 |
| 425 | Ga0496101_0058408 | 3300048904 | Bacteria | 2793 |
| 426 | Ga0496101_0106715 | 3300048904 | Bacteria | 2103 |
| 427 | Ga0496102_0000999 | 3300048905 | Bacteria | 26578 |
| 428 | Ga0496102_0003890 | 3300048905 | Bacteria | 12652 |
| 429 | Ga0496102_0022014 | 3300048905 | Bacteria | 5646 |
| 430 | Ga0496102_0227249 | 3300048905 | Bacteria | 1760 |
| 431 | Ga0496103_0031458 | 3300048906 | Bacteria | 3233 |
| 432 | Ga0496103_0047973 | 3300048906 | Bacteria | 2639 |
| 433 | Ga0496103_0081648 | 3300048906 | Bacteria | 2034 |
| 434 | Ga0496104_0000992 | 3300048907 | Bacteria | 24270 |
| 435 | Ga0496104_0078934 | 3300048907 | Bacteria | 3137 |
| 436 | Ga0496104_0172381 | 3300048907 | Bacteria | 2074 |
| 437 | Ga0496105_0000598 | 3300048908 | Bacteria | 24057 |
| 438 | Ga0496105_0003424 | 3300048908 | Bacteria | 11740 |
| 439 | Ga0496105_0074721 | 3300048908 | Bacteria | 2800 |
| 440 | Ga0496105_0141421 | 3300048908 | Bacteria | 1981 |
| 441 | Ga0496105_0143600 | 3300048908 | Bacteria | 1964 |
| 442 | Ga0496105_0145638 | 3300048908 | Bacteria | 1948 |
| 443 | Ga0496105_0170825 | 3300048908 | Bacteria | 1782 |
| 444 | Ga0496106_0020345 | 3300048909 | Bacteria | 4924 |
| 445 | Ga0496106_0163743 | 3300048909 | Bacteria | 1760 |
| 446 | Ga0496107_0025867 | 3300048910 | Bacteria | 4158 |
| 447 | Ga0496108_0014734 | 3300048911 | Bacteria | 6380 |
| 448 | Ga0496108_0052878 | 3300048911 | Bacteria | 3405 |
| 449 | Ga0496108_0059631 | 3300048911 | Bacteria | 3209 |
| 450 | Ga0496108_0121633 | 3300048911 | Bacteria | 2239 |
| 451 | Ga0496108_0150569 | 3300048911 | Bacteria | 2007 |
| 452 | Ga0496109_0002918 | 3300048912 | Bacteria | 14290 |
| 453 | Ga0496109_0004618 | 3300048912 | Bacteria | 11496 |
| 454 | Ga0496109_0019138 | 3300048912 | Bacteria | 6031 |
| 455 | Ga0496109_0020723 | 3300048912 | Bacteria | 5806 |
| 456 | Ga0496109_0056953 | 3300048912 | Bacteria | 3566 |
| 457 | Ga0496109_0209478 | 3300048912 | Bacteria | 1833 |
| 458 | Ga0496110_0001490 | 3300048913 | Bacteria | 16957 |
| 459 | Ga0496110_0003337 | 3300048913 | Bacteria | 12268 |
| 460 | Ga0496110_0008544 | 3300048913 | Bacteria | 8245 |
| 461 | Ga0496110_0014931 | 3300048913 | Bacteria | 6456 |
| 462 | Ga0496110_0052501 | 3300048913 | Bacteria | 3582 |
| 463 | Ga0496110_0096612 | 3300048913 | Bacteria | 2648 |
| 464 | Ga0496110_0134966 | 3300048913 | Bacteria | 2229 |
| 465 | Ga0496111_0000850 | 3300048914 | Bacteria | 16511 |
| 466 | Ga0496111_0001012 | 3300048914 | Bacteria | 15424 |
| 467 | Ga0496111_0002022 | 3300048914 | Bacteria | 12073 |
| 468 | Ga0496111_0009525 | 3300048914 | Bacteria | 6490 |
| 469 | Ga0496111_0037237 | 3300048914 | Bacteria | 3482 |
| 470 | Ga0496111_0069832 | 3300048914 | Bacteria | 2554 |
| 471 | Ga0496111_0134981 | 3300048914 | Bacteria | 1827 |
| 472 | Ga0496112_0002299 | 3300048915 | Bacteria | 15308 |
| 473 | Ga0496112_0025005 | 3300048915 | Bacteria | 5730 |
| 474 | Ga0496112_0108665 | 3300048915 | Bacteria | 2744 |
| 475 | Ga0496112_0395153 | 3300048915 | Bacteria | 1323 |
| 476 | Ga0496113_0015794 | 3300048916 | Bacteria | 5202 |
| 477 | Ga0496113_0028376 | 3300048916 | Bacteria | 4025 |
| 478 | Ga0496113_0069242 | 3300048916 | Bacteria | 2680 |
| 479 | Ga0496114_0001233 | 3300048917 | Bacteria | 19345 |
| 480 | Ga0496114_0009854 | 3300048917 | Bacteria | 7594 |
| 481 | Ga0496114_0015901 | 3300048917 | Bacteria | 6056 |
| 482 | Ga0496114_0048330 | 3300048917 | Bacteria | 3539 |
| 483 | Ga0496115_0022707 | 3300048918 | Bacteria | 4865 |
| 484 | Ga0496115_0041573 | 3300048918 | Bacteria | 3659 |
| 485 | Ga0496115_0064139 | 3300048918 | Bacteria | 2965 |
| 486 | Ga0501031_0009448 | 3300049568 | Bacteria | 6340 |
| 487 | Ga0501031_0011946 | 3300049568 | Bacteria | 5661 |
| 488 | Ga0501031_0012444 | 3300049568 | Bacteria | 5551 |
| 489 | Ga0501031_0032230 | 3300049568 | Bacteria | 3417 |
| 490 | Ga0501031_0165559 | 3300049568 | Bacteria | 1445 |
| 491 | Ga0501032_0005924 | 3300049569 | Bacteria | 9030 |
| 492 | Ga0501033_0019739 | 3300049570 | Bacteria | 5093 |
| 493 | Ga0501033_0020147 | 3300049570 | Bacteria | 5042 |
| 494 | Ga0501036_0004126 | 3300049572 | Bacteria | 11685 |
| 495 | Ga0501036_0017431 | 3300049572 | Bacteria | 6004 |
| 496 | Ga0501036_0024235 | 3300049572 | Bacteria | 5114 |
| 497 | Ga0501036_0036266 | 3300049572 | Bacteria | 4172 |
| 498 | Ga0501036_0065916 | 3300049572 | Bacteria | 3064 |
| 499 | Ga0501037_0000556 | 3300049573 | Bacteria | 29683 |
| 500 | Ga0501038_0016342 | 3300049574 | Bacteria | 6727 |
| 501 | Ga0501038_0017489 | 3300049574 | Bacteria | 6481 |
| 502 | Ga0501038_0042883 | 3300049574 | Bacteria | 3938 |
| 503 | Ga0501038_0114529 | 3300049574 | Bacteria | 2230 |
| 504 | Ga0501038_0190256 | 3300049574 | Bacteria | 1652 |
| 505 | Ga0501039_0001806 | 3300049575 | Bacteria | 15825 |
| 506 | Ga0501039_0010915 | 3300049575 | Bacteria | 6923 |
| 507 | Ga0501039_0028212 | 3300049575 | Bacteria | 4319 |
| 508 | Ga0501039_0054017 | 3300049575 | Bacteria | 3110 |
| 509 | Ga0501039_0093729 | 3300049575 | Bacteria | 2340 |
| 510 | Ga0501040_0014802 | 3300049576 | Bacteria | 5147 |
| 511 | Ga0501040_0030015 | 3300049576 | Bacteria | 3670 |
| 512 | Ga0501040_0039618 | 3300049576 | Bacteria | 3204 |
| 513 | Ga0501040_0057822 | 3300049576 | Bacteria | 2663 |
| 514 | Ga0501040_0139381 | 3300049576 | Bacteria | 1708 |
| 515 | Ga0501040_0247227 | 3300049576 | Bacteria | 1272 |
| 516 | Ga0501041_0001746 | 3300049577 | Bacteria | 12186 |
| 517 | Ga0501041_0006721 | 3300049577 | Bacteria | 6741 |
| 518 | Ga0501041_0006801 | 3300049577 | Bacteria | 6701 |
| 519 | Ga0501041_0011042 | 3300049577 | Bacteria | 5333 |
| 520 | Ga0501041_0067661 | 3300049577 | Bacteria | 2189 |
| 521 | Ga0501041_0159264 | 3300049577 | Bacteria | 1411 |
| 522 | Ga0501042_0015496 | 3300049578 | Bacteria | 5220 |
| 523 | Ga0501042_0018996 | 3300049578 | Bacteria | 4768 |
| 524 | Ga0501042_0110850 | 3300049578 | Bacteria | 1976 |
| 525 | Ga0501042_0150024 | 3300049578 | Bacteria | 1681 |
| 526 | Ga0501042_0155859 | 3300049578 | Bacteria | 1647 |
| 527 | Ga0501043_0010792 | 3300049579 | Bacteria | 7153 |
| 528 | Ga0501043_0057894 | 3300049579 | Bacteria | 3042 |
| 529 | Ga0501046_0002105 | 3300049580 | Bacteria | 18869 |
| 530 | Ga0501046_0010021 | 3300049580 | Bacteria | 8161 |
| 531 | Ga0501047_0060414 | 3300049581 | Bacteria | 3658 |
| 532 | Ga0501048_0001503 | 3300049582 | Bacteria | 17647 |
| 533 | Ga0501048_0005851 | 3300049582 | Bacteria | 9353 |
| 534 | Ga0501048_0011997 | 3300049582 | Bacteria | 6457 |
| 535 | Ga0501048_0027113 | 3300049582 | Bacteria | 4166 |
| 536 | Ga0501048_0047885 | 3300049582 | Bacteria | 3049 |
| 537 | Ga0501048_0069351 | 3300049582 | Bacteria | 2490 |
| 538 | Ga0501067_0002721 | 3300049583 | Bacteria | 9723 |
| 539 | Ga0501067_0130055 | 3300049583 | Bacteria | 1401 |
| 540 | Ga0501068_0002565 | 3300049584 | Bacteria | 9636 |
| 541 | Ga0501068_0056140 | 3300049584 | Bacteria | 2387 |
| 542 | Ga0501068_0056992 | 3300049584 | Bacteria | 2368 |
| 543 | Ga0501068_0172573 | 3300049584 | Bacteria | 1365 |
| 544 | Ga0501069_0005303 | 3300049585 | Bacteria | 6698 |
| 545 | Ga0501070_0013449 | 3300049586 | Bacteria | 6898 |
| 546 | Ga0501070_0016592 | 3300049586 | Bacteria | 6186 |
| 547 | Ga0501071_0001415 | 3300049587 | Bacteria | 13806 |
| 548 | Ga0501071_0011424 | 3300049587 | Bacteria | 5982 |
| 549 | Ga0501071_0033159 | 3300049587 | Bacteria | 3670 |
| 550 | Ga0501071_0046579 | 3300049587 | Bacteria | 3114 |
| 551 | Ga0501071_0158680 | 3300049587 | Bacteria | 1690 |
| 552 | Ga0501072_0003345 | 3300049588 | Bacteria | 12059 |
| 553 | Ga0501072_0009597 | 3300049588 | Bacteria | 7358 |
| 554 | Ga0501072_0018392 | 3300049588 | Bacteria | 5380 |
| 555 | Ga0501072_0033003 | 3300049588 | Bacteria | 4055 |
| 556 | Ga0501072_0035081 | 3300049588 | Bacteria | 3931 |
| 557 | Ga0501072_0148199 | 3300049588 | Bacteria | 1871 |
| 558 | Ga0501072_0187953 | 3300049588 | Bacteria | 1647 |
| 559 | Ga0501072_0264555 | 3300049588 | Bacteria | 1369 |
| 560 | Ga0501073_0041153 | 3300049589 | Bacteria | 3265 |
| 561 | Ga0501073_0131446 | 3300049589 | Bacteria | 1735 |
| 562 | Ga0501074_0020916 | 3300049590 | Bacteria | 4752 |
| 563 | Ga0501074_0072156 | 3300049590 | Bacteria | 2480 |
| 564 | Ga0501074_0092101 | 3300049590 | Bacteria | 2171 |
| 565 | Ga0501074_0112223 | 3300049590 | Bacteria | 1950 |
| 566 | Ga0501075_0002024 | 3300049591 | Bacteria | 13403 |
| 567 | Ga0501075_0003197 | 3300049591 | Bacteria | 10961 |
| 568 | Ga0501075_0004015 | 3300049591 | Bacteria | 9919 |
| 569 | Ga0501075_0021247 | 3300049591 | Bacteria | 4730 |
| 570 | Ga0501075_0051402 | 3300049591 | Bacteria | 3099 |
| 571 | Ga0501075_0114910 | 3300049591 | Bacteria | 2047 |
| 572 | Ga0501075_0205988 | 3300049591 | Bacteria | 1500 |
| 573 | Ga0501076_0004491 | 3300049592 | Bacteria | 9938 |
| 574 | Ga0501076_0006461 | 3300049592 | Bacteria | 8508 |
| 575 | Ga0501076_0010329 | 3300049592 | Bacteria | 6923 |
| 576 | Ga0501076_0037340 | 3300049592 | Bacteria | 3809 |
| 577 | Ga0501076_0081432 | 3300049592 | Bacteria | 2599 |
| 578 | Ga0501077_0000985 | 3300049593 | Bacteria | 17153 |
| 579 | Ga0501077_0001964 | 3300049593 | Bacteria | 12433 |
| 580 | Ga0501077_0008778 | 3300049593 | Bacteria | 6272 |
| 581 | Ga0501077_0012300 | 3300049593 | Bacteria | 5360 |
| 582 | Ga0501077_0012690 | 3300049593 | Bacteria | 5277 |
| 583 | Ga0501077_0019080 | 3300049593 | Bacteria | 4335 |
| 584 | Ga0501079_0010798 | 3300049741 | Bacteria | 6955 |
| 585 | Ga0501079_0014046 | 3300049741 | Bacteria | 6106 |
| 586 | Ga0501079_0017017 | 3300049741 | Bacteria | 5552 |
| 587 | Ga0501079_0029098 | 3300049741 | Bacteria | 4240 |
| 588 | Ga0501079_0072930 | 3300049741 | Bacteria | 2654 |
| 589 | Ga0501079_0073338 | 3300049741 | Bacteria | 2645 |
| 590 | Ga0501080_0005070 | 3300049742 | Bacteria | 11732 |
| 591 | Ga0501080_0007528 | 3300049742 | Bacteria | 9838 |
| 592 | Ga0501080_0026209 | 3300049742 | Bacteria | 5416 |
| 593 | Ga0501080_0032290 | 3300049742 | Bacteria | 4882 |
| 594 | Ga0501080_0043477 | 3300049742 | Bacteria | 4183 |
| 595 | Ga0501081_0002309 | 3300049743 | Bacteria | 12012 |
| 596 | Ga0501081_0009349 | 3300049743 | Bacteria | 6386 |
| 597 | Ga0501081_0009510 | 3300049743 | Bacteria | 6337 |
| 598 | Ga0501081_0013363 | 3300049743 | Bacteria | 5400 |
| 599 | Ga0501081_0044222 | 3300049743 | Bacteria | 3056 |
| 600 | Ga0501083_0007917 | 3300049744 | Bacteria | 7526 |
| 601 | Ga0501083_0012620 | 3300049744 | Bacteria | 5910 |
| 602 | Ga0501083_0031777 | 3300049744 | Bacteria | 3623 |
| 603 | Ga0501035_0030724 | 3300049822 | Bacteria | 4897 |
| 604 | Ga0501035_0031407 | 3300049822 | Bacteria | 4837 |
| 605 | Ga0501035_0051633 | 3300049822 | Bacteria | 3680 |
| 606 | Ga0501044_0072812 | 3300049823 | Bacteria | 3493 |
| 607 | Ga0501044_0076298 | 3300049823 | Bacteria | 3402 |
| 608 | Ga0501044_0081779 | 3300049823 | Bacteria | 3269 |
| 609 | Ga0501045_0001518 | 3300049824 | Bacteria | 15440 |
| 610 | Ga0501045_0002277 | 3300049824 | Bacteria | 13003 |
| 611 | Ga0501045_0005780 | 3300049824 | Bacteria | 8559 |
| 612 | Ga0501045_0011883 | 3300049824 | Bacteria | 6119 |
| 613 | Ga0501045_0147134 | 3300049824 | Bacteria | 1752 |
| 614 | nmdc:mga00v17_4654_c1 | 3300050491 | Bacteria | 7162 |
| 615 | nmdc:mga06z11_39796_c1 | 3300050494 | Bacteria | 2341 |
| 616 | nmdc:mga05p37_123043_c1 | 3300050507 | Bacteria | 3187 |
| 617 | nmdc:mga05p37_208930_c1 | 3300050507 | Bacteria | 2361 |
| 618 | nmdc:mga05p37_22821_c1 | 3300050507 | Bacteria | 7589 |
| 619 | nmdc:mga05p37_230375_c1 | 3300050507 | Bacteria | 2232 |
| 620 | nmdc:mga05p37_24026_c1 | 3300050507 | Bacteria | 7404 |
| 621 | nmdc:mga05p37_376095_c1 | 3300050507 | Bacteria | 1666 |
| 622 | nmdc:mga09592_39819_c1 | 3300050508 | Bacteria | 3948 |
| 623 | nmdc:mga09592_52029_c1 | 3300050508 | Bacteria | 3456 |
| 624 | nmdc:mga06r32_244409_c1 | 3300050510 | Bacteria | 1782 |
| 625 | nmdc:mga06r32_334394_c1 | 3300050510 | Bacteria | 1499 |
| 626 | nmdc:mga08y16_194002_c1 | 3300050511 | Bacteria | 2106 |
| 627 | nmdc:mga08y16_92491_c1 | 3300050511 | Bacteria | 3152 |
| 628 | nmdc:mga0n895_136186_c1 | 3300050512 | Bacteria | 2482 |
| 629 | nmdc:mga0n895_321510_c1 | 3300050512 | Bacteria | 1568 |
| 630 | nmdc:mga0n895_4658_c1 | 3300050512 | Bacteria | 11312 |
| 631 | nmdc:mga0rr50_40202_c1 | 3300050513 | Bacteria | 3399 |
| 632 | nmdc:mga0rr50_60587_c1 | 3300050513 | Bacteria | 2848 |
| 633 | nmdc:mga08x19_49336_c1 | 3300050514 | Bacteria | 2699 |
| 634 | nmdc:mga08x19_9240_c1 | 3300050514 | Bacteria | 5891 |
| 635 | nmdc:mga0a205_60267_c1 | 3300050515 | Bacteria | 3666 |
| 636 | nmdc:mga0a205_94501_c1 | 3300050515 | Bacteria | 2888 |
| 637 | nmdc:mga0a205_9890_c1 | 3300050515 | Bacteria | 8748 |
| 638 | Ga0495601_0000757 | 3300053077 | Bacteria | 17435 |
| 639 | Ga0495601_0047996 | 3300053077 | Bacteria | 2689 |
| 640 | Ga0495601_0072318 | 3300053077 | Bacteria | 2203 |
| 641 | Ga0495655_0005452 | 3300053083 | Bacteria | 2247 |
| 642 | Ga0495595_0011232 | 3300053084 | Bacteria | 3740 |
| 643 | Ga0495619_0005539 | 3300053085 | Bacteria | 8009 |
| 644 | Ga0495619_0023390 | 3300053085 | Bacteria | 3961 |
| 645 | Ga0495619_0031768 | 3300053085 | Bacteria | 3422 |
| 646 | Ga0495619_0074055 | 3300053085 | Bacteria | 2283 |
| 647 | Ga0495619_0085656 | 3300053085 | Bacteria | 2129 |
| 648 | Ga0501084_0003938 | 3300054114 | Bacteria | 12095 |
| 649 | Ga0501084_0004712 | 3300054114 | Bacteria | 11143 |
| 650 | Ga0501084_0009527 | 3300054114 | Bacteria | 8037 |
| 651 | Ga0501084_0011433 | 3300054114 | Bacteria | 7349 |
| 652 | Ga0501084_0049487 | 3300054114 | Bacteria | 3518 |
| 653 | Ga0501084_0105188 | 3300054114 | Bacteria | 2371 |
| 654 | Ga0501084_0118192 | 3300054114 | Bacteria | 2229 |
| 655 | Ga0501084_0183350 | 3300054114 | Bacteria | 1767 |
| 656 | Ga0590071_015562 | 3300059421 | Bacteria | 1783 |
| 657 | Ga0501082_0004646 | 3300060353 | Bacteria | 11979 |
| 658 | Ga0501082_0010213 | 3300060353 | Bacteria | 8082 |
| 659 | Ga0501082_0028347 | 3300060353 | Bacteria | 4824 |
| 660 | Ga0501082_0034830 | 3300060353 | Bacteria | 4339 |
| 661 | Ga0501082_0062532 | 3300060353 | Bacteria | 3205 |
| 662 | Ga0501082_0080366 | 3300060353 | Bacteria | 2813 |
| 663 | Ga0501082_0134218 | 3300060353 | Bacteria | 2147 |
| 664 | Ga0501082_0195660 | 3300060353 | Bacteria | 1759 |
| 665 | Ga0466962_0000627 | 3300061719 | Bacteria | 15671 |
| 666 | Ga0530510_0005684 | 3300061734 | Bacteria | 8638 |
| 667 | Ga0530510_0024608 | 3300061734 | Bacteria | 4299 |
| 668 | Ga0530510_0026776 | 3300061734 | Bacteria | 4129 |
| 669 | Ga0105248_10413668 | |||
| 670 | JGI25407J50210_10013488 | |||
| 671 | Ga0070658_10042261 | |||
| 672 | Ga0070658_10154108 | |||
| 673 | Ga0070670_100180665 | |||
| 674 | Ga0070680_100021911 | |||
| 675 | Ga0070680_100065961 | |||
| 676 | Ga0070680_100079043 | |||
| 677 | Ga0070682_100049452 | |||
| 678 | Ga0068868_100039855 | |||
| 679 | Ga0070660_100000819 | |||
| 680 | Ga0070660_100010792 | |||
| 681 | Ga0070660_100017814 | |||
| 682 | Ga0070660_100056966 | |||
| 683 | Ga0070660_100127123 | |||
| 684 | Ga0070689_100014722 | |||
| 685 | Ga0070661_100049212 | |||
| 686 | Ga0070661_100075497 | |||
| 687 | Ga0070661_100119015 | |||
| 688 | Ga0070692_10029036 | |||
| 689 | Ga0070668_100042803 | |||
| 690 | Ga0070675_100072593 | |||
| 691 | Ga0070675_100083731 | |||
| 692 | Ga0070674_100095256 | |||
| 693 | Ga0070673_100187048 | |||
| 694 | Ga0070714_100134906 | |||
| 695 | Ga0070714_100198495 | |||
| 696 | Ga0070714_100235718 | |||
| 697 | Ga0070701_10007113 | |||
| 698 | Ga0070711_100141808 | |||
| 699 | Ga0070694_100099885 | |||
| 700 | Ga0070708_100057681 | |||
| 701 | Ga0070708_100109458 | |||
| 702 | Ga0070663_100020364 | |||
| 703 | Ga0070662_100018182 | |||
| 704 | Ga0070662_100061948 | |||
| 705 | Ga0070681_10000818 | |||
| 706 | Ga0070681_10002075 | |||
| 707 | Ga0070681_10017507 | |||
| 708 | Ga0070681_10040047 | |||
| 709 | Ga0070685_10040143 | |||
| 710 | Ga0070706_100001869 | |||
| 711 | Ga0070706_100003808 | |||
| 712 | Ga0070706_100004945 | |||
| 713 | Ga0070706_100005263 | |||
| 714 | Ga0070706_100093191 | |||
| 715 | Ga0070706_100209487 | |||
| 716 | Ga0070707_100029065 | |||
| 717 | Ga0070707_100073242 | |||
| 718 | Ga0070707_100129187 | |||
| 719 | Ga0070698_100001821 | |||
| 720 | Ga0070698_100003055 | |||
| 721 | Ga0070698_100008490 | |||
| 722 | Ga0070698_100011112 | |||
| 723 | Ga0070698_100013592 | |||
| 724 | Ga0070698_100195821 | |||
| 725 | Ga0070699_100080550 | |||
| 726 | Ga0070699_100236479 | |||
| 727 | Ga0070699_100415309 | |||
| 728 | Ga0070679_100028811 | |||
| 729 | Ga0070679_100110003 | |||
| 730 | Ga0070697_100059796 | |||
| 731 | Ga0070697_100101473 | |||
| 732 | Ga0070672_100009638 | |||
| 733 | Ga0070672_100033028 | |||
| 734 | Ga0070693_100030067 | |||
| 735 | Ga0070665_100075015 | |||
| 736 | Ga0070704_100022510 | |||
| 737 | Ga0068855_100056886 | |||
| 738 | Ga0068855_100088902 | |||
| 739 | Ga0068855_100192746 | |||
| 740 | Ga0068852_100059311 | |||
| 741 | Ga0068860_100051084 | |||
| 742 | Ga0081455_10003327 | |||
| 743 | Ga0081455_10006995 | |||
| 744 | Ga0081455_10021239 | |||
| 745 | Ga0081455_10022832 | |||
| 746 | Ga0081455_10059128 | |||
| 747 | Ga0081455_10131773 | |||
| 748 | Ga0081455_10146791 | |||
| 749 | Ga0081455_10157153 | |||
| 750 | Ga0081538_10000195 | |||
| 751 | Ga0081538_10037799 | |||
| 752 | Ga0081538_10070943 | |||
| 753 | Ga0081539_10000973 | |||
| 754 | Ga0081539_10008764 | |||
| 755 | Ga0075365_10013300 | |||
| 756 | Ga0075365_10190486 | |||
| 757 | Ga0075364_10057798 | |||
| 758 | Ga0075432_10002179 | |||
| 759 | Ga0075432_10039091 | |||
| 760 | Ga0075428_100002450 | |||
| 761 | Ga0075428_100191844 | |||
| 762 | Ga0075430_100129619 | |||
| 763 | Ga0075431_100079083 | |||
| 764 | Ga0075433_10048678 | |||
| 765 | Ga0075433_10149481 | |||
| 766 | Ga0075434_100128254 | |||
| 767 | Ga0075429_100076447 | |||
| 768 | Ga0068865_100045520 | |||
| 769 | Ga0068865_100065593 | |||
| 770 | Ga0068865_100125017 | |||
| 771 | Ga0075436_100048061 | |||
| 772 | Ga0075436_100049246 | |||
| 773 | Ga0075435_100096578 | |||
| 774 | Ga0105244_10065749 | |||
| 775 | Ga0111539_10036099 | |||
| 776 | Ga0111539_10062191 | |||
| 777 | Ga0111539_10067444 | |||
| 778 | Ga0111539_10229441 | |||
| 779 | Ga0111539_10247175 | |||
| 780 | Ga0105245_10024883 | |||
| 781 | Ga0105245_10030680 | |||
| 782 | Ga0105247_10040212 | |||
| 783 | Ga0114129_10408864 | |||
| 784 | Ga0114129_10501671 | |||
| 785 | Ga0105243_10051860 | |||
| 786 | Ga0105243_10092111 | |||
| 787 | Ga0105242_10034320 | |||
| 788 | Ga0105242_10060368 | |||
| 789 | Ga0105248_10080633 | |||
| 790 | Ga0105248_10120907 | |||
| 791 | Ga0105248_10248154 | |||
| 792 | Ga0105237_10064403 | |||
| 793 | Ga0105238_10028168 | |||
| 794 | Ga0105249_10145438 | |||
| 795 | Ga0105239_10042005 | |||
| 796 | Ga0105239_10140002 | |||
| 797 | Ga0105239_10221047 | |||
| 798 | Ga0157371_10128215 | |||
| 799 | Ga0157371_10186517 | |||
| 800 | Ga0157370_10006933 | |||
| 801 | Ga0157369_10001003 | |||
| 802 | Ga0157374_10047472 | |||
| 803 | Ga0157374_10116535 | |||
| 804 | Ga0157374_10162809 | |||
| 805 | Ga0157372_10031033 | |||
| 806 | Ga0157372_10091948 | |||
| 807 | Ga0157372_10141611 | |||
| 808 | Ga0157372_10258138 | |||
| 809 | Ga0157375_10010053 | |||
| 810 | Ga0157375_10033375 | |||
| 811 | Ga0157375_10040593 | |||
| 812 | Ga0157375_10045570 | |||
| 813 | Ga0157375_10297199 | |||
| 814 | Ga0157380_10019372 | |||
| 815 | Ga0157377_10160446 | |||
| 816 | Ga0157379_10169388 | |||
| 817 | Ga0206356_11828667 | |||
| 818 | Ga0206353_10130899 | |||
| 819 | Ga0207653_10055321 | |||
| 820 | Ga0207643_10012190 | |||
| 821 | Ga0207705_10133034 | |||
| 822 | Ga0207684_10000137 | |||
| 823 | Ga0207684_10000289 | |||
| 824 | Ga0207684_10004500 | |||
| 825 | Ga0207684_10019297 | |||
| 826 | Ga0207707_10010499 | |||
| 827 | Ga0207707_10012886 | |||
| 828 | Ga0207707_10032544 | |||
| 829 | Ga0207707_10093932 | |||
| 830 | Ga0207695_10216916 | |||
| 831 | Ga0207693_10027392 | |||
| 832 | Ga0207663_10069088 | |||
| 833 | Ga0207660_10012383 | |||
| 834 | Ga0207660_10023914 | |||
| 835 | Ga0207660_10076279 | |||
| 836 | Ga0207657_10001876 | |||
| 837 | Ga0207657_10010396 | |||
| 838 | Ga0207657_10030401 | |||
| 839 | Ga0207657_10030447 | |||
| 840 | Ga0207657_10056602 | |||
| 841 | Ga0207657_10085245 | |||
| 842 | Ga0207657_10192613 | |||
| 843 | Ga0207652_10024169 | |||
| 844 | Ga0207652_10031973 | |||
| 845 | Ga0207652_10041086 | |||
| 846 | Ga0207652_10100256 | |||
| 847 | Ga0207652_10106120 | |||
| 848 | Ga0207646_10000665 | |||
| 849 | Ga0207646_10003063 | |||
| 850 | Ga0207646_10048754 | |||
| 851 | Ga0207694_10097942 | |||
| 852 | Ga0207687_10034003 | |||
| 853 | Ga0207664_10032707 | |||
| 854 | Ga0207664_10120910 | |||
| 855 | Ga0207690_10138132 | |||
| 856 | Ga0207706_10004470 | |||
| 857 | Ga0207706_10068537 | |||
| 858 | Ga0207686_10079672 | |||
| 859 | Ga0207686_10121562 | |||
| 860 | Ga0207709_10155036 | |||
| 861 | Ga0207704_10019928 | |||
| 862 | Ga0207691_10010949 | |||
| 863 | Ga0207691_10047893 | |||
| 864 | Ga0207691_10149037 | |||
| 865 | Ga0207661_10010994 | |||
| 866 | Ga0207661_10029560 | |||
| 867 | Ga0207661_10137335 | |||
| 868 | Ga0207661_10187105 | |||
| 869 | Ga0207661_10246593 | |||
| 870 | Ga0207679_10024866 | |||
| 871 | Ga0207679_10162487 | |||
| 872 | Ga0207667_10271257 | |||
| 873 | Ga0207712_10297077 | |||
| 874 | Ga0207640_10086523 | |||
| 875 | Ga0207678_10137567 | |||
| 876 | Ga0207708_10132650 | |||
| 877 | Ga0207674_10024285 | |||
| 878 | Ga0207674_10072447 | |||
| 879 | Ga0207675_100010838 | |||
| 880 | Ga0207675_100057667 | |||
| 881 | Ga0207683_10009335 | |||
| 882 | Ga0207698_10122976 | |||
| 883 | Ga0207698_10165291 | |||
| 884 | Ga0207428_10000431 | |||
| 885 | Ga0207428_10025292 | |||
| 886 | Ga0207428_10106494 | |||
| 887 | Ga0268264_10032711 | |||
| 888 | Ga0265319_1005442 | |||
| 889 | Ga0265319_1008616 | |||
| 890 | Ga0265319_1011220 | |||
| 891 | Ga0265334_10000884 | |||
| 892 | Ga0265334_10027204 | |||
| 893 | Ga0265318_10000561 | |||
| 894 | Ga0265318_10011745 | |||
| 895 | Ga0265318_10059030 | |||
| 896 | Ga0265322_10006466 | |||
| 897 | Ga0265338_10009928 | |||
| 898 | Ga0265338_10016638 | |||
| 899 | Ga0265338_10045778 | |||
| 900 | Ga0265338_10200415 | |||
| 901 | Ga0265332_10044208 | |||
| 902 | Ga0265328_10000876 | |||
| 903 | Ga0265320_10038679 | |||
| 904 | Ga0265325_10002855 | |||
| 905 | Ga0265329_10027508 | |||
| 906 | Ga0265329_10030733 | |||
| 907 | Ga0265340_10046703 | |||
| 908 | Ga0265340_10088295 | |||
| 909 | Ga0265339_10055967 | |||
| 910 | Ga0265327_10000014 | |||
| 911 | Ga0265327_10012029 | |||
| 912 | Ga0265316_10009520 | |||
| 913 | Ga0265316_10027194 | |||
| 914 | Ga0265313_10002358 | |||
| 915 | Ga0265314_10003852 | |||
| 916 | Ga0265314_10008195 | |||
| 917 | Ga0265342_10018395 | |||
| 918 | Ga0307406_10131836 | |||
| 919 | Ga0307406_10134487 | |||
| 920 | Ga0307416_100161270 | |||
| 921 | Ga0307415_100180915 | |||
| 922 | Ga0373944_0037754 | |||
| 923 | Ga0373949_0012154 | |||
| 924 | Ga0373956_0060057 | |||
| 925 | Ga0373943_0001869 | |||
| 926 | Ga0373943_0002003 | |||
| 927 | Ga0373946_0006469 | |||
| 928 | Ga0373955_0116672 | |||
| 929 | Ga0373961_0010445 | |||
| 930 | Ga0373935_0093176 | |||
| 931 | Ga0373927_0041300 | |||
| 932 | Ga0373933_0016032 | |||
| 933 | Ga0373947_0000658 | |||
| 934 | Ga0373947_0010442 | |||
| 935 | Ga0373925_0006545 | |||
| 936 | Ga0373925_0013616 | |||
| 937 | Ga0395899_0005121 | |||
| 938 | Ga0395899_0005857 | |||
| 939 | Ga0395899_0008984 | |||
| 940 | Ga0395899_0030078 | |||
| 941 | Ga0395899_0048992 | |||
| 942 | Ga0395900_0001698 | |||
| 943 | Ga0395900_0001815 | |||
| 944 | Ga0395900_0038976 | |||
| 945 | Ga0395900_0045966 | |||
| 946 | Ga0395900_0055873 | |||
| 947 | Ga0395900_0075457 | |||
| 948 | Ga0395900_0206324 | |||
| 949 | Ga0395900_0229053 | |||
| 950 | Ga0395900_0544117 | |||
| 951 | Ga0395898_0006446 | |||
| 952 | Ga0395898_0009510 | |||
| 953 | Ga0395898_0015449 | |||
| 954 | Ga0395898_0016345 | |||
| 955 | Ga0395898_0034799 | |||
| 956 | Ga0395898_0042119 | |||
| 957 | Ga0395898_0211632 | |||
| 958 | Ga0395898_0212570 | |||
| 959 | Ga0395898_0217643 | |||
| 960 | Ga0395898_0414777 | |||
| 961 | Ga0395905_0006116 | |||
| 962 | Ga0395905_0017788 | |||
| 963 | Ga0395905_0022493 | |||
| 964 | Ga0395905_0033088 | |||
| 965 | Ga0395905_0042113 | |||
| 966 | Ga0395905_0100334 | |||
| 967 | Ga0395905_0142045 | |||
| 968 | Ga0395905_0151268 | |||
| 969 | Ga0395905_0153526 | |||
| 970 | Ga0395905_0234491 | |||
| 971 | Ga0395901_0005917 | |||
| 972 | Ga0395901_0009486 | |||
| 973 | Ga0395901_0016276 | |||
| 974 | Ga0395901_0018544 | |||
| 975 | Ga0395901_0028173 | |||
| 976 | Ga0395901_0056796 | |||
| 977 | Ga0395901_0152151 | |||
| 978 | Ga0395901_0200729 | |||
| 979 | Ga0395901_0274153 | |||
| 980 | Ga0395901_0472476 | |||
| 981 | Ga0436365_0212877 | |||
| 982 | Ga0439436_0022153 | |||
| 983 | Ga0439439_0006996 | |||
| 984 | Ga0439453_0005787 | |||
| 985 | Ga0451789_0293741 | |||
| 986 | Ga0451793_1848829 | |||
| 987 | Ga0451795_0352695 | |||
| 988 | Ga0451807_0428708 | |||
| 989 | Ga0451833_0581219 | |||
| 990 | Ga0451839_1645058 | |||
| 991 | Ga0439433_0003631 | |||
| 992 | Ga0439454_000700 | |||
| 993 | Ga0450920_016532 | |||
| 994 | Ga0450888_006539 | |||
| 995 | Ga0450906_012724 | |||
| 996 | Ga0439446_0002889 | |||
| 997 | Ga0439434_0017512 | |||
| 998 | Ga0439460_0039901 | |||
| 999 | Ga0439460_0073464 | |||
| 1000 | Ga0466969_0018025 | |||
| 1001 | Ga0466961_0017989 | |||
| 1002 | Ga0466963_0002900 | |||
| 1003 | Ga0466963_0003298 | |||
| 1004 | Ga0466963_0010394 | |||
| 1005 | Ga0466964_0003519 | |||
| 1006 | Ga0466964_0039992 | |||
| 1007 | Ga0466971_0008682 | |||
| 1008 | Ga0466968_0095951 | |||
| 1009 | Ga0466957_0048811 | |||
| 1010 | Ga0466959_0050185 | |||
| 1011 | Ga0466958_0007000 | |||
| 1012 | Ga0466958_0054203 | |||
| 1013 | Ga0466967_0010673 | |||
| 1014 | Ga0466967_0042111 | |||
| 1015 | Ga0466967_0150238 | |||
| 1016 | Ga0466967_0158001 | |||
| 1017 | Ga0466967_0195674 | |||
| 1018 | Ga0466967_0286551 | |||
| 1019 | Ga0495592_0054410 | |||
| 1020 | Ga0495603_0002169 | |||
| 1021 | Ga0495603_0067572 | |||
| 1022 | Ga0495629_0000159 | |||
| 1023 | Ga0495629_0067188 | |||
| 1024 | Ga0495629_0167429 | |||
| 1025 | Ga0495641_0003425 | |||
| 1026 | Ga0495651_0014719 | |||
| 1027 | Ga0495653_0047507 | |||
| 1028 | Ga0495653_0086235 | |||
| 1029 | Ga0495580_0104775 | |||
| 1030 | Ga0495582_0000183 | |||
| 1031 | Ga0495582_0024372 | |||
| 1032 | Ga0495639_0004941 | |||
| 1033 | Ga0495662_0000220 | |||
| 1034 | Ga0495596_0019243 | |||
| 1035 | Ga0495596_0049810 | |||
| 1036 | Ga0495618_0045419 | |||
| 1037 | Ga0495618_0112058 | |||
| 1038 | Ga0495630_0004113 | |||
| 1039 | Ga0495630_0005932 | |||
| 1040 | Ga0495630_0017737 | |||
| 1041 | Ga0495630_0133971 | |||
| 1042 | Ga0495644_0072649 | |||
| 1043 | Ga0495666_0030129 | |||
| 1044 | Ga0495665_0003082 | |||
| 1045 | Ga0495640_0057771 | |||
| 1046 | Ga0495640_0072749 | |||
| 1047 | Ga0495640_0073356 | |||
| 1048 | Ga0495587_0022855 | |||
| 1049 | Ga0495587_0079257 | |||
| 1050 | Ga0495645_0041657 | |||
| 1051 | Ga0495667_0128070 | |||
| 1052 | Ga0495634_0006252 | |||
| 1053 | Ga0495634_0164727 | |||
| 1054 | Ga0495635_0049850 | |||
| 1055 | Ga0495635_0070804 | |||
| 1056 | Ga0495635_0075561 | |||
| 1057 | Ga0495588_0011111 | |||
| 1058 | Ga0495657_0031896 | |||
| 1059 | Ga0495657_0095155 | |||
| 1060 | Ga0495599_0113359 | |||
| 1061 | Ga0495623_0017587 | |||
| 1062 | Ga0495646_0034846 | |||
| 1063 | Ga0495646_0102532 | |||
| 1064 | Ga0495658_0003714 | |||
| 1065 | Ga0495658_0068665 | |||
| 1066 | Ga0495613_0001702 | |||
| 1067 | Ga0495613_0016817 | |||
| 1068 | Ga0495671_0074955 | |||
| 1069 | Ga0495600_0022984 | |||
| 1070 | Ga0495600_0062832 | |||
| 1071 | Ga0495581_0002281 | |||
| 1072 | Ga0495604_0021242 | |||
| 1073 | Ga0495674_0003066 | |||
| 1074 | Ga0495674_0059473 | |||
| 1075 | Ga0495676_0008530 | |||
| 1076 | Ga0495676_0151278 | |||
| 1077 | Ga0495676_0152149 | |||
| 1078 | Ga0495680_0004997 | |||
| 1079 | Ga0495680_0015775 | |||
| 1080 | Ga0495680_0020576 | |||
| 1081 | Ga0495680_0104439 | |||
| 1082 | Ga0495593_0004600 | |||
| 1083 | Ga0495602_0016803 | |||
| 1084 | Ga0496100_0003593 | |||
| 1085 | Ga0496100_0018347 | |||
| 1086 | Ga0496100_0031095 | |||
| 1087 | Ga0496100_0043960 | |||
| 1088 | Ga0496100_0065446 | |||
| 1089 | Ga0496100_0320661 | |||
| 1090 | Ga0496101_0003566 | |||
| 1091 | Ga0496101_0007288 | |||
| 1092 | Ga0496101_0045230 | |||
| 1093 | Ga0496101_0058408 | |||
| 1094 | Ga0496101_0106715 | |||
| 1095 | Ga0496102_0000999 | |||
| 1096 | Ga0496102_0003890 | |||
| 1097 | Ga0496102_0022014 | |||
| 1098 | Ga0496102_0227249 | |||
| 1099 | Ga0496103_0031458 | |||
| 1100 | Ga0496103_0047973 | |||
| 1101 | Ga0496103_0081648 | |||
| 1102 | Ga0496104_0000992 | |||
| 1103 | Ga0496104_0078934 | |||
| 1104 | Ga0496104_0172381 | |||
| 1105 | Ga0496105_0000598 | |||
| 1106 | Ga0496105_0003424 | |||
| 1107 | Ga0496105_0074721 | |||
| 1108 | Ga0496105_0141421 | |||
| 1109 | Ga0496105_0143600 | |||
| 1110 | Ga0496105_0145638 | |||
| 1111 | Ga0496105_0170825 | |||
| 1112 | Ga0496106_0020345 | |||
| 1113 | Ga0496106_0163743 | |||
| 1114 | Ga0496107_0025867 | |||
| 1115 | Ga0496108_0014734 | |||
| 1116 | Ga0496108_0052878 | |||
| 1117 | Ga0496108_0059631 | |||
| 1118 | Ga0496108_0121633 | |||
| 1119 | Ga0496108_0150569 | |||
| 1120 | Ga0496109_0002918 | |||
| 1121 | Ga0496109_0004618 | |||
| 1122 | Ga0496109_0019138 | |||
| 1123 | Ga0496109_0020723 | |||
| 1124 | Ga0496109_0056953 | |||
| 1125 | Ga0496109_0209478 | |||
| 1126 | Ga0496110_0001490 | |||
| 1127 | Ga0496110_0003337 | |||
| 1128 | Ga0496110_0008544 | |||
| 1129 | Ga0496110_0014931 | |||
| 1130 | Ga0496110_0052501 | |||
| 1131 | Ga0496110_0096612 | |||
| 1132 | Ga0496110_0134966 | |||
| 1133 | Ga0496111_0000850 | |||
| 1134 | Ga0496111_0001012 | |||
| 1135 | Ga0496111_0002022 | |||
| 1136 | Ga0496111_0009525 | |||
| 1137 | Ga0496111_0037237 | |||
| 1138 | Ga0496111_0069832 | |||
| 1139 | Ga0496111_0134981 | |||
| 1140 | Ga0496112_0002299 | |||
| 1141 | Ga0496112_0025005 | |||
| 1142 | Ga0496112_0108665 | |||
| 1143 | Ga0496112_0395153 | |||
| 1144 | Ga0496113_0015794 | |||
| 1145 | Ga0496113_0028376 | |||
| 1146 | Ga0496113_0069242 | |||
| 1147 | Ga0496114_0001233 | |||
| 1148 | Ga0496114_0009854 | |||
| 1149 | Ga0496114_0015901 | |||
| 1150 | Ga0496114_0048330 | |||
| 1151 | Ga0496115_0022707 | |||
| 1152 | Ga0496115_0041573 | |||
| 1153 | Ga0496115_0064139 | |||
| 1154 | Ga0501031_0009448 | |||
| 1155 | Ga0501031_0011946 | |||
| 1156 | Ga0501031_0012444 | |||
| 1157 | Ga0501031_0032230 | |||
| 1158 | Ga0501031_0165559 | |||
| 1159 | Ga0501032_0005924 | |||
| 1160 | Ga0501033_0019739 | |||
| 1161 | Ga0501033_0020147 | |||
| 1162 | Ga0501036_0004126 | |||
| 1163 | Ga0501036_0017431 | |||
| 1164 | Ga0501036_0024235 | |||
| 1165 | Ga0501036_0036266 | |||
| 1166 | Ga0501036_0065916 | |||
| 1167 | Ga0501037_0000556 | |||
| 1168 | Ga0501038_0016342 | |||
| 1169 | Ga0501038_0017489 | |||
| 1170 | Ga0501038_0042883 | |||
| 1171 | Ga0501038_0114529 | |||
| 1172 | Ga0501038_0190256 | |||
| 1173 | Ga0501039_0001806 | |||
| 1174 | Ga0501039_0010915 | |||
| 1175 | Ga0501039_0028212 | |||
| 1176 | Ga0501039_0054017 | |||
| 1177 | Ga0501039_0093729 | |||
| 1178 | Ga0501040_0014802 | |||
| 1179 | Ga0501040_0030015 | |||
| 1180 | Ga0501040_0039618 | |||
| 1181 | Ga0501040_0057822 | |||
| 1182 | Ga0501040_0139381 | |||
| 1183 | Ga0501040_0247227 | |||
| 1184 | Ga0501041_0001746 | |||
| 1185 | Ga0501041_0006721 | |||
| 1186 | Ga0501041_0006801 | |||
| 1187 | Ga0501041_0011042 | |||
| 1188 | Ga0501041_0067661 | |||
| 1189 | Ga0501041_0159264 | |||
| 1190 | Ga0501042_0015496 | |||
| 1191 | Ga0501042_0018996 | |||
| 1192 | Ga0501042_0110850 | |||
| 1193 | Ga0501042_0150024 | |||
| 1194 | Ga0501042_0155859 | |||
| 1195 | Ga0501043_0010792 | |||
| 1196 | Ga0501043_0057894 | |||
| 1197 | Ga0501046_0002105 | |||
| 1198 | Ga0501046_0010021 | |||
| 1199 | Ga0501047_0060414 | |||
| 1200 | Ga0501048_0001503 | |||
| 1201 | Ga0501048_0005851 | |||
| 1202 | Ga0501048_0011997 | |||
| 1203 | Ga0501048_0027113 | |||
| 1204 | Ga0501048_0047885 | |||
| 1205 | Ga0501048_0069351 | |||
| 1206 | Ga0501067_0002721 | |||
| 1207 | Ga0501067_0130055 | |||
| 1208 | Ga0501068_0002565 | |||
| 1209 | Ga0501068_0056140 | |||
| 1210 | Ga0501068_0056992 | |||
| 1211 | Ga0501068_0172573 | |||
| 1212 | Ga0501069_0005303 | |||
| 1213 | Ga0501070_0013449 | |||
| 1214 | Ga0501070_0016592 | |||
| 1215 | Ga0501071_0001415 | |||
| 1216 | Ga0501071_0011424 | |||
| 1217 | Ga0501071_0033159 | |||
| 1218 | Ga0501071_0046579 | |||
| 1219 | Ga0501071_0158680 | |||
| 1220 | Ga0501072_0003345 | |||
| 1221 | Ga0501072_0009597 | |||
| 1222 | Ga0501072_0018392 | |||
| 1223 | Ga0501072_0033003 | |||
| 1224 | Ga0501072_0035081 | |||
| 1225 | Ga0501072_0148199 | |||
| 1226 | Ga0501072_0187953 | |||
| 1227 | Ga0501072_0264555 | |||
| 1228 | Ga0501073_0041153 | |||
| 1229 | Ga0501073_0131446 | |||
| 1230 | Ga0501074_0020916 | |||
| 1231 | Ga0501074_0072156 | |||
| 1232 | Ga0501074_0092101 | |||
| 1233 | Ga0501074_0112223 | |||
| 1234 | Ga0501075_0002024 | |||
| 1235 | Ga0501075_0003197 | |||
| 1236 | Ga0501075_0004015 | |||
| 1237 | Ga0501075_0021247 | |||
| 1238 | Ga0501075_0051402 | |||
| 1239 | Ga0501075_0114910 | |||
| 1240 | Ga0501075_0205988 | |||
| 1241 | Ga0501076_0004491 | |||
| 1242 | Ga0501076_0006461 | |||
| 1243 | Ga0501076_0010329 | |||
| 1244 | Ga0501076_0037340 | |||
| 1245 | Ga0501076_0081432 | |||
| 1246 | Ga0501077_0000985 | |||
| 1247 | Ga0501077_0001964 | |||
| 1248 | Ga0501077_0008778 | |||
| 1249 | Ga0501077_0012300 | |||
| 1250 | Ga0501077_0012690 | |||
| 1251 | Ga0501077_0019080 | |||
| 1252 | Ga0501079_0010798 | |||
| 1253 | Ga0501079_0014046 | |||
| 1254 | Ga0501079_0017017 | |||
| 1255 | Ga0501079_0029098 | |||
| 1256 | Ga0501079_0072930 | |||
| 1257 | Ga0501079_0073338 | |||
| 1258 | Ga0501080_0005070 | |||
| 1259 | Ga0501080_0007528 | |||
| 1260 | Ga0501080_0026209 | |||
| 1261 | Ga0501080_0032290 | |||
| 1262 | Ga0501080_0043477 | |||
| 1263 | Ga0501081_0002309 | |||
| 1264 | Ga0501081_0009349 | |||
| 1265 | Ga0501081_0009510 | |||
| 1266 | Ga0501081_0013363 | |||
| 1267 | Ga0501081_0044222 | |||
| 1268 | Ga0501083_0007917 | |||
| 1269 | Ga0501083_0012620 | |||
| 1270 | Ga0501083_0031777 | |||
| 1271 | Ga0501035_0030724 | |||
| 1272 | Ga0501035_0031407 | |||
| 1273 | Ga0501035_0051633 | |||
| 1274 | Ga0501044_0072812 | |||
| 1275 | Ga0501044_0076298 | |||
| 1276 | Ga0501044_0081779 | |||
| 1277 | Ga0501045_0001518 | |||
| 1278 | Ga0501045_0002277 | |||
| 1279 | Ga0501045_0005780 | |||
| 1280 | Ga0501045_0011883 | |||
| 1281 | Ga0501045_0147134 | |||
| 1282 | nmdc:mga00v17_4654_c1 | |||
| 1283 | nmdc:mga06z11_39796_c1 | |||
| 1284 | nmdc:mga05p37_123043_c1 | |||
| 1285 | nmdc:mga05p37_208930_c1 | |||
| 1286 | nmdc:mga05p37_22821_c1 | |||
| 1287 | nmdc:mga05p37_230375_c1 | |||
| 1288 | nmdc:mga05p37_24026_c1 | |||
| 1289 | nmdc:mga05p37_376095_c1 | |||
| 1290 | nmdc:mga09592_39819_c1 | |||
| 1291 | nmdc:mga09592_52029_c1 | |||
| 1292 | nmdc:mga06r32_244409_c1 | |||
| 1293 | nmdc:mga06r32_334394_c1 | |||
| 1294 | nmdc:mga08y16_194002_c1 | |||
| 1295 | nmdc:mga08y16_92491_c1 | |||
| 1296 | nmdc:mga0n895_136186_c1 | |||
| 1297 | nmdc:mga0n895_321510_c1 | |||
| 1298 | nmdc:mga0n895_4658_c1 | |||
| 1299 | nmdc:mga0rr50_40202_c1 | |||
| 1300 | nmdc:mga0rr50_60587_c1 | |||
| 1301 | nmdc:mga08x19_49336_c1 | |||
| 1302 | nmdc:mga08x19_9240_c1 | |||
| 1303 | nmdc:mga0a205_60267_c1 | |||
| 1304 | nmdc:mga0a205_94501_c1 | |||
| 1305 | nmdc:mga0a205_9890_c1 | |||
| 1306 | Ga0495601_0000757 | |||
| 1307 | Ga0495601_0047996 | |||
| 1308 | Ga0495601_0072318 | |||
| 1309 | Ga0495655_0005452 | |||
| 1310 | Ga0495595_0011232 | |||
| 1311 | Ga0495619_0005539 | |||
| 1312 | Ga0495619_0023390 | |||
| 1313 | Ga0495619_0031768 | |||
| 1314 | Ga0495619_0074055 | |||
| 1315 | Ga0495619_0085656 | |||
| 1316 | Ga0501084_0003938 | |||
| 1317 | Ga0501084_0004712 | |||
| 1318 | Ga0501084_0009527 | |||
| 1319 | Ga0501084_0011433 | |||
| 1320 | Ga0501084_0049487 | |||
| 1321 | Ga0501084_0105188 | |||
| 1322 | Ga0501084_0118192 | |||
| 1323 | Ga0501084_0183350 | |||
| 1324 | Ga0590071_015562 | |||
| 1325 | Ga0501082_0004646 | |||
| 1326 | Ga0501082_0010213 | |||
| 1327 | Ga0501082_0028347 | |||
| 1328 | Ga0501082_0034830 | |||
| 1329 | Ga0501082_0062532 | |||
| 1330 | Ga0501082_0080366 | |||
| 1331 | Ga0501082_0134218 | |||
| 1332 | Ga0501082_0195660 | |||
| 1333 | Ga0466962_0000627 | |||
| 1334 | Ga0530510_0005684 | |||
| 1335 | Ga0530510_0024608 | |||
| 1336 | Ga0530510_0026776 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8hk0-assembly1.cif.gz_A | crystal structure of fic32-33 complex from streptomyces ficellus nrrl 8067 | 0.8845 | 1 | 354 |
| 6wy8-assembly1.cif.gz_D | tcur3481-tcur3483 steroid acad | 0.8796 | 1 | 363 |
| 4irn-assembly2.cif.gz_E | crystal structure of the prolyl acyl carrier protein oxidase anab | 0.8768 | 4 | 360 |
| 6wy8-assembly1.cif.gz_D | tcur3481-tcur3483 steroid acad | 0.8754 | 1 | 363 |
| 6af6-assembly1.cif.gz_A | piga with fad and proline | 0.8743 | 1 | 360 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P96855_462_572_2.40.110.10 | Mainly Beta;Beta Barrel;Butyryl-CoA Dehydrogenase, subunit A; domain 2;Butyryl-CoA Dehydrogenase, subunit A, domain 2 | 0.9776 | 112 | 221 | 2.40.110.10 |
| af_P96855_462_572_2.40.110.10 | Mainly Beta;Beta Barrel;Butyryl-CoA Dehydrogenase, subunit A; domain 2;Butyryl-CoA Dehydrogenase, subunit A, domain 2 | 0.9605 | 112 | 221 | 2.40.110.10 |
| 2pg0A02 | Mainly Beta;Beta Barrel;Butyryl-CoA Dehydrogenase, subunit A; domain 2;Butyryl-CoA Dehydrogenase, subunit A, domain 2 | 0.9383 | 112 | 216 | 2.40.110.10 |
| 5iduB02 | Mainly Beta;Beta Barrel;Butyryl-CoA Dehydrogenase, subunit A; domain 2;Butyryl-CoA Dehydrogenase, subunit A, domain 2 | 0.9322 | 112 | 227 | 2.40.110.10 |
| af_Q6NWF0_171_282_2.40.110.10 | Mainly Beta;Beta Barrel;Butyryl-CoA Dehydrogenase, subunit A; domain 2;Butyryl-CoA Dehydrogenase, subunit A, domain 2 | 0.9306 | 112 | 218 | 2.40.110.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A353HX35-F1-model_v4 | Acyl-CoA dehydrogenase | 0.9844 | 127 | 224 |
GO:0005886
GO:0016627 |
| AF-A0A351EJS1-F1-model_v4 | Acyl-CoA dehydrogenase | 0.9686 | 115 | 205 |
GO:0005886
GO:0016627 |
| AF-X8C5I8-F1-model_v4 | deleted | 0.9604 | 84 | 216 |
|
| AF-A0A351EJS1-F1-model_v4 | Acyl-CoA dehydrogenase | 0.9584 | 115 | 205 |
GO:0005886
GO:0016627 |
| AF-A0A371PXN5-F1-model_v4 | Acyl-CoA oxidase/dehydrogenase middle domain-containing protein | 0.9516 | 128 | 208 |
GO:0005886
GO:0016627 |